c'ϊx  ?p1L XB0;.text XD .data  B [4e@.bssMM0.loader^.exceptht.infoFBH= ,&2 PБ8A(A | S*~CxN!A(b9}{x~xH;`@,AbDHA(| @__start, M H4N @__threads_init!|A(d| DN!A(b,#Ac| CN!A(b ,#Atc| CN!A(b(,#Ac| CN!A(b0,#Ac| CN!A(8!p}N b(,#AK A__threads_init@AF2_1p|X!|HMA(8!p}N A, call_pth_inith`A( L| N N @__User_sinit_begin|!HA(8!p}N A$__C_runtime_termination|8b8X8!a`?xpH5A(8bsHIA(!}N 8`HQA(|p88`sHaA(K8`cHyA(8`HA(!}N (ap__C_runtime_startupKdN @__4KTN @__3xA( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N |`!qa8~8&!A Hm`88~cH~5`8~8&8 HA`8~H0EA(8!}N Ado_trc_|8!|cH0A( 8(88`8 dHAH}8!p}N AX catch_SIGUSR1Tc> , M HwN @ protm_stringb , M HxN @ prot_end_line|80!|cH/A(8`8C(KYKb 88!p}N AL catch_SIGUSR2aA|8~0(8P(@xi,#!a@,=888|c0|c>t|cJxf|c8|c2|@@c@|yAXH8`PHA(`8~P;8c8e8E_ (H0!`8U8+8,808 °*H'}`8B8b88 8fFgGH'9`< 88 8 8H'`88 8LH'`b , @ 8!}AaN ,%@T,$@<, @$8`HǡA(`8~P;8c8E8e_ (H.`8U8+8,808 °*H&`8B8b88 8FfGgH%`< 88 8 8H%`88 8LH%`b , @K`HPK`HqPK`HaPK`!````|3y@,#@ Kp Axsk_learn_new_sender|`!A8'$8apHzq`yAK }9, @D8a8'a,%AHz)`, 2ApcAHiA(8b 88|&@@h P|&@@(8!}N 8!}K |&@@K8ap8HyU`cHA(8b 88|&@@K@8'aHy `K88a8'|88Hx`, 2AK8!}N Ask_forget_senders b( @PN N @(sk_init_sender_scanerb |+yM 8`( @(P8(N d(8(N @Tsk_step_sender_scaner|`8i!8apH8a8*8hH`, , @t,#APH`(L8@h;|}8{cH½` L||8 H!]`8apH8p8!`}N 8`8DK}K8`KmK88|8```!8c 8 C  (c0 (d08apH98p8!`}N 8`8KKK@,#AK Ask__write_sender_info8`8c | 8  ! H`8(H=`(08h8-8@8HPX`H`8!}N Aprep_own_entry|8`d !!aȀ~ 8,'@ |xfMxg6dxc&}0P||28gxH1`8ap88Hti`88a8HtQ`b c|`yA, @8~808c~8|#@Hfu8!}N 8c0H`8b 8p8Rc8ctHM`8b 8c8cH1`~808c~8|#@K|HM 8Ѐ~ 8 |xfMxg6dxc&}0P||28gxH`8ap88Hs5`88a8Hs`b c|`yA`K A write_entry| p`b !,A,@@\`!, @4,>A, A8!}N cK,>AKc``!K,>cA, A8!}Kpx8!N Ask_dump_sender_infob|P,=!qAT````!88*8Hpy`}Hm8*`e8Hp]`}H8*`e8HpA`888*Hp-`8+(8Hp`8+D8,%AHo`}Hq`888+(A8Ho`8}H8*88+Ho`8B88,Ho`8b88,DHo`888,Hou`888,Hoa`888,8L8LHoE`8-48Ho5`, FA/ C,SA, DAd88-\@DHo`88.8Hn`,=@`8!}N 88.Hn`K88-Hn`K, UA88-@Hn`K88-Hnq`Kp88-Hn]`K\8+pHnM`K\x8!N A sk_print_all,,A8,@ 8d(N ,A@ 8dpN 8dN 8dLN 8dN @Lsk_t_show_wait_reason,,A0,@ 8dN `@ 8cN 8cN b8cN @Dsk_t_show_needs|`8~!q8Hl`8~8dHl`8~8Hl`8~8Hl`8~8Hl`8~8Hlu`8~8Hla`8~8HlM`8~8Hl9`8~8Hl%`8~8Hl` 8~8Hk` 8~8Hk` 8~8Hk` 8~8Hk` 8~8Hk`8~8Hk`8~8Hk`8~8 Hku`8!}N Adebug_INTERNET_addr 8P,%A09@ 8Ġ`g}I, @|+y@8`N ```!8(9|H@C `g}I```!88|@@C |ByA|+yAK`8`N @skc_focus_by_inst_id9 8P,$Ad88`f| ```!88|@@C |By A,$@8`N 9 a#N @skc_focus_by_cpu_id88 P,%A ````!,&@(|+y@`N C%| 0aGC@|e|H@p | Xa~e2xATaa'Zx|:x}Gx}3x};x|KyA|+yAtKT8`N |2x}Jx# |Cx}F:x}g3x}(bx|CyAK8`N @@skc_focus_by_INET_addr8 8` ,$AN 8`N @0skc_focus_on_sender_scanner8` |#yM d8|txтN @(skc_sender_is_up8` |#yM |48TN @(skc_waiting_for_something8` |#yM d8|4T~N @(skc_waiting_for_clockb |#yA(8`8,@N |4T~N 8`N @<&skc_waiting_for_old_entries_or_wake_up8` |#yM d8|4T~N @(skc_still_needs_ask_for_old8` |#yM d8|4T~N @(skc_still_need_say_hellob |#yA$8`,@N |4T~N 8`N @8#skc_still_need_nothing_or_say_hello8 | 8Ġ, AL````!8c8| @C ||`|||4T~N 8`N @pskc_check_focus_by_inst_id|b !ccK8!p}N A,skc_show_wait_reason|b !ccK 8!p}N A,skc_show_needsb c|`yA c,#AN 8d@N b8c@N @8skc_show_raw_hostname8` |#yM dN @skc_get_wait_reason 8d8,&@(8@HPN 8fbN @Dskc_get_last_sendb !|,$8d*@< 8+808 8f" H `b 8c 8!p}N 8!pN A`skc_get_sender_behind| !8d,$@48X88H`8X8!}N x8!N A`skc_get_inst_id 88 !|8ap8pxzHO `|c4,@ 8`58K KEb c8!}N Axskc_get_listen_port|8` aA!8KK8 8ap8H`8apHM`|}y8A\|888~hcH)`;hHaQA(c8!}AaN ;a8a88p8H`!`8B 8`zKK,=~,@ A|K`8`8lKKH`A(~cHM`|}y@$8a8;8H_`8`8KAK}H`YA(c8!}AaK Askc_get_hostent|b !cKm8!p}N A(skc_write_sender_info|b !c8cBH`b 8c8!p}N A@skc_set_last_recive_is_now 8d˜N @skc_set_i_sender_state 8dN @skc_set_still_needs 8dN @skc_set_wait_reasonb 8cN @skc_reset_mod_since_read|!`db 8hc8c*Hm`8!p}N A8skc_update_info8` 8(,%8@( 8 N 8`N @<skc_can_decr_wait_ticks_then_do 828|,8!(A@,@P8dH`8D8!8}N 8`Dx8!dN 8`Dx8!dN Askc_set_sender_disappeared| !,,dAD@X8cH`8b 88c(8!p}N 888!p(N 888!p(N Askc_set_wait_clock8 ,xA,8L (N N N @8skc_set_need_ask_for_oldb 8xcN @skc_set_need_say_hello| 88!8dHU`8(8!}N ATskc_set_wait_old_entries| 88!8dH`8(8!}N ATskc_set_wait_wake_up 88bcdN @8skc_set_last_send``d 8|~!8cbHu`8,@0~8bd8!}N Askc_check_and_set_last_send`|}&a `p`!A~, A8, A{|c"x|2x |c+x|"x|`x|2x|y@T.=AD~, @8 (, sLRBA~, @8v8 ~, @8rt~, A89]c|"x|2x|+x|c"x|y@0|8!} aN 8a 8898)9 HU`8`8 KAK}8!|} K88|Kl88r}r|yA8a8)HU`8`8KKK88 9]v`aD|```!8c8|(@C `aD|``!8c8|(@C |*yA88a888)t99 HTa`8`8KKMK88 9]`aD|```!8c8|(@C `aD|``!8c8|(@C |*yA48ap888)(99 HS`8`8pKaKԝK88`8(ԘK-Kib , AtcKqKh88`8(KKb , A(cK%KaHl`~88|||xH5A({c{Hi`8{|.Kx8`8(HKYKӕ8`KIKӅKAb88P8eH9`8`UK K C<skc_learn_sender|`8cfaA;K8K8J!Af, @@, @,````!8cT>8, AT>|;8`;| ,@8B@$``!, @8c8C B , @8c,@8z {,#@48,#, LFA8xHEA(8{c{Hu`8`D88/|.Ki8`CKY8/8`BKMc8`AHAK}8!}AaN , @$Aa8!N 8a8X8/PHP`88`SKK8!}AaKHiy`|P8,d@{cdH,A,c8a8Xcf8/9?cHO`88`0K1Km}HA(8~8xcȘHA(8}{cH`88!}}|.Kc8a898Xc8.HN`888`dKϡKA8!}N 8X8ap8.HN`8p8`lKUKϑ8!}N Askc_set_raw_hostnameTc> T>, M HHN @ protm_number|!Qa8aH`8 8ap8HP`8ap8Hau`8p8a8H_`88c*HP`b , A8a8888hHM1`88`KK8a8888HM`88`KͱK8a888HL`88`ḰKͽ8a8 8 8(8*HL`88`KMK͉8!}N Apskc_set_sender_behind|b8c8 !HKA`b8 8cHK-`b8 8cHK`b8 8cHK`b8 8cHJ`b8 $8cHJ`b8 `8cHJ`b8 8cHJ`b8 8cHJ`b8 08cHJ`b8 t8cHJy`8`KA(|pH AusageTc> , M HFN @i_writeprotokollTc> , M HAN @prot_begin_line||c!qHi````axcH`HI`cxH98!}N A`main|}&aA8;!;|caA!xp8 ! ȘHXu`88atHX%`b 8 8H`b 8 8H}`t,@; b(B" ;:``!804a8x$|c*H)`;80H8,@ 48`8!He`t|A , @, @b8{ DH%E`H(`8`H`88`HA(808`HA(8X8`HyA(8p8`HiA(88`HYA(88`HIA(B 8zH`8z H=`8{1`H``d8z8H5`0, A8{ D8HF`8{1Hm`(#@| | 8{1HQ`(#@|(|(8{2H5`;;`!(#Aa8a8 DH`" y|`yA, @8`82@K 8`Kǵ8`82tKǩK8`[HA(`x| 88H`zcHA(,A8y|`yA, @, @, Ay|`yA, @0, @\8{8H!`,#@8x8`88HA(,|AX888x`88xHA(,A8{9H`,#@:{a88a8`89XK]8`bKQ8`89KEKƁ|88HIA(,A, @l8{:H1`,#@|;x8`88HA(,A8`ua88|`8|8HA(,AL{a88a48`8:K}8`bKqKŭb88HuA(,AX8`n8:KA8`mbK5Kqb8HeA(,A, @, @T8: : ::|```!,A@abH`Tu>||,#A ,5@|z|@ , @ 88888`8 ,#,@h@(::KKڹ,@X, AT,bATHYA(,Ax88`8AKb8`K8A8`KK ;::, A8`8AKåK,ALH~A(,A8d8Ј, @8`K݈;, @`8 ;8p8{ DHA`aH`,A, @H-y|`yA, @$8`98BKK|KA(|p8c0H`y8 Ry8ctH]`y 88cHE`KHzH}A(8K`aH`8{B8F8H`|,#A8cH~`K8|lH-`|8cH~`KH8ax8dKˁ8a8H`8axK%HAKtKYKT8{B H`|,#A(8cH~)`8d8K8|lH`|8cH}`K8`8BhKAK}K8{AxHq`|,#A$8cH}`x8K8|lH`|8cH}`KK,AK, AKK,AK`d8`K8`8;KK`d8`K8`8;KyKK,,/A A@KK8`K)KxHp`A8`KQK`8`KeKTK؝,A:@oAHK8aHxH!p`A,KuK`d8`K8`8;KKK8`KK`d8`K8`8<$KKKKa,A:@oAKM8a (Hp`A,KYKU`d8`K)8`8T>T>T>K1a8`KK%8=\8`JKb8`IK KI8=t8`GKa8`FK8=8`EKbD8`DK8=8`CKbd8`BK8=8`AKb$8`@KK88aH%`|py8a8=A 8`8KuKp8b 8:Ax: 8, @(````! b~0bD|8H A(`o,AD,@x(8@,,@b Ȉ, @, AK(8`8><8(K8`bK8`8>`K8`8K8`8>xKyK8`8>Ki@8`|KY8`8>KM88`|K=8`8>K1KmK<|p@0, @U~8ax8xH`, @\~1z(@x@88,48@888Al8aKi|`4T~8~8ptALb8be8xK=K, @Ԡx,T, E/aA0A, OA, SAX@$8ax8H#M:Ax: K88`8A4KKQx8:Ax: 8cxKxx8x8d|dtxтH"1:Ax: Kp8ax8pHQ, A:Ax: K8{@8@8AK%:Ax: KX8ax8XH, A:Ax: Kd8{@8@8A K:Ax: KD, e,m/ sAhALA(@8ax8H:Ax: Kh8ax8hH#=:Ax: KxP:Ax: 8PKxH8HH"i:Ax: K8aࠡx8@H8`8`;8K}K8a8@888H8`8`58KQKK8aḰTt>bK~R 8`s8><8 K8`rbK 8`q8>`K8`p8K8`o8@dKK%8`m8>K@8`l|K8`k8>K88`j|K8`i8>KKKxz8a h8?p|~H7`8`8 hKmK8a h8?8xH7`8`8 hKIK8a h8@ H7y`8`8 hK)KeK48a h8>bH7Q`8`8 hKK=xz8a h8?|~H7!`8`8 hKK K8{CBH`|,#A$8bHt=`x080Kl8|lH`|8bHt `KabFbgb(H6`:a8`08=K=KyK8`)8>K)8`(KKYK8{KL8{8H`|,#A8cHpE`K8|lH`|8cHp!`K8{8H~`|,#A88cHo`88b88 8 8Kx8|lH=`|8cHo`K88 H`zK8c0H`y88 8Ry8ctH]`y8 88cHE`KH 8ax8uK-8axKKXz88H A(8z888F8H`(@;(@`!, f,iA@ 8a8 8Hh`8 8,8a@H`83D|@8`, B@K8`@|KK8d@8@888z8F88H`(AT|w,AA,8@8, A, A(;Ȁxxd&xcd|d8c2|A4@, @8{88F8H`8@K8`087K8`/x&xd|82K8`.88KKK88`@H KT8`N86KK8`L86K88`K@|K}K8`I87Km08`H|K]K8`F878KM88`E|K=Ky8`C87\K-H8`B|KKY8`@87K P8`?|KK9K88`Z86`KK|,#AH886H`88b;8 88 |*8K\8|lH`|886Hؑ`K8{6<Hz`|,#A@8cHk`88b;8 8pK8|lH%`|8cHk`K88`83KK 8`83KK, -A8`84hKK8`84KK 8`KK|,#A<884H׉`88b;88 K 8|lHU`|884HA`K8`84(K KIKX8aH`,A8dH8HK08`85KK , @(b8`e,P8P, dA, LF Ac8H|c"xd|c|c"| @ċ88`85<KYK8`83KIK8`84hK9Ku8`85K)Ke 8`KKU8`85K KE|,#A<8 86H `88b;8 8 K8|lH`|8 86H`K8858vH-`K8a8 8Hc`, f,A @\K<8aKp`A88`83K=Ky8aKq8d8888aKyKh8ahKMp`@8`82KK58d080K8`8K-8aKK8aKK8c0H`y88 8Ry8ctH)`y8 88cH`K(8`82KU 8`KI8`82K=8`cK1Km88b888K8c0H!`y88 8Ry8ctH}`y8 88cHe`K8{1|H`,#@<`8 q0K888 Hm`|`t|`810K8`b818KeK8{ DHy`K$8`b80`KA8`8'$K58`80xK)Ke, A808`K 8` K8`80KK-8`81Kv8`KKt,@;@; ;8`81 ```!Kc$8`Kڕ81,8`K8`|*KyK;Zt;8`Y81 |AK8`80KEKKT|f*H_`,@P8`p|*,t, 2@ {Kߤ, 3@ Kߔ88`@K߀80P|e*HL`8,@ K\80Xa8|c*H_A`8,|d@|*, A:b88 HA`x`dxdM|Pxf&|2b8:HKy`|uyA8:8 bH`x`dxc6d|P|Kޠ, A;`KtKKlKKx C" nlsui_main|!`f8ap88`H&`8a8fKpz8B8a萁K`8!P}N Ad write_filenumb!| ,@,8b 8cHA(8!p}N 8!pN AL start_writes;;aA;`! |B" ~ !8xMx6dx&|dP~*,~@8b```!8x|8FH`;{,@ ~P|AP,8d8@xx|`yA, @8`H`,~A8~ ,88c|c |@0cD8ap8H$}`x|`yA, @@p8!`}!AaN 8c0H`8x8p8Rx8ctHky`8x8 8cHA`p8!`}K|8c0HÕ`8x8 Rx8ctH`8x8 8cH`K8zHom`b~8),#A H``;` x|`yApK`8~lH`b~8)H`}`;` K8b8| !(A0a8@H XP8!`|"N A  flush_writes|8t!8appHp8`C@(8"pK-Kic 8!}N 8`K)c 8!}N Atask_local_time`b |a;`!, @HK`~K!,>|}4A`|,8atApxHm5`8`qr8K)c8`K8`8 K 8`KK=8- 8|<B88-8,A````!8 8c C ؈, @lcc8Hm`, @c~888p9HA(,A@;`88!}d8ccaN b8c!Hl%`~,#AD8cH]i`8ap88K cc8!}aK8~lH}`~8cH]`K8a8 H`88`KAK}8a8!8Hm`88`KKYK8ac8 $HA`88`KK-8a8 pH `88`KKK<8`a8!KK88!}d8ccKp8`[8" KqK88!}d8ccK<8`8K9Ku8a8cHe`88`KKQK Asend_question_to_sender|`|8c8!qH, At8|0808& , A48fHi`8|0H8|8K8!}N H8|8K8!}N 88&Hm`8%888@HQ`8808& H`8 8!}`}8c}`N A$ acc_entry|`|8c8!qH}, A80b8c8&H, AlH `K,@,8`8&pKK)8!}N 8|0HM8`K%8|8Ký8!}N K,@8`8&pKK88%H`8%888@H`8088& HE`8 8!}`}8c}`N A\ acc_oldentry |`~8"!8ap, A࠾0H`8p8`KK8"࠾8apH`8p8`KuK8ap8#d828 8 , BA8`8#KEKK},AXK8`UK)KE0, y@`8!P}N 8`K`8!P}N K],8`8A8$D8KKK,0A , y@8`K8$8`KKK`d8`Ku8%48`~KiK`d8`}KY8%d8`|KMK8%l8`zK=K`d8`yK-Ki`8!P}N K-`d8`K8%48`~KKQ`d8`}K8%d8`|KK8%l8`zKK`d8`yKK`8!P}N 8`8$KK8`UKK0, y@hKH`8p8`K]K8r8ap8#88H`8p8`K1Km8v8ap8#88HU`8p8`KKA8ap88$ 88H)`8p8`KKK,AK A acc_sup|T>8`m8!K},?8`l@48KiK8`SK]Ky8!}N 8K9Ku8`FK-KI8!}N A acc_sdown|!`epKq,8e0@DK!`e8ap8hH`8p8`IKKKp8!`}N K8`K9Kp8!`}N A acc_stime|!K5,8`;`A,8KKU8`KKi8!p}N 8`58KK)8!p}N Alacc_all`~b |!, A`8ap80888H`8p8`#KQK8ap888P88Hu`8p8`K%KaK,@48` 8pKKA8~0H y`8!P}N 8~0H Y8`K1`8!P}N Aacc_miss8|b }&,$~P!*-#AH(, A<0, A08`8 KKY8`8 K KIAH 8`8 KK-8`8 KK8`8K8`|KK8`8@K8`|KšK8`8K8`|KŁK8`8Kq8`|KaK8`8KQ 8`|KAK}8`8@K1(8`|K!K]8`8K08`|KK=A8`8K88`|KK8`8K@8`|KĽK8`8@KH8`|KĝK8`8KP8`~|K}K8`|8KmX8`{|K]K8`y8KM`8`x|K=Ky8`v8@K-h8`u|KKY8`s8K p8`r|KK98`p8Kx8`o|KK8`m8K8`l|KýK8`j8@K8`i|KÝK8`g8K8`f|K}K8`d8Km|8`cK]K8`a8KM8``|K=Ky8`^8@K-8`]|KKY8`[8K 8`Z|KK98`X8K8`W|KK8`U8K8`T|K½K8`R8@K8`Q|KK8`O8K8`N|K}K8`L8Km8`K|K]K8`I8KM8`H|K=Ky8`F8@K-8`E|KKY8`C8K 8`B|KK98`@8K8`?|KK8`=8K8`<|KK8`:8@K8`9|KK8`78K8`6|K}K8`48Km8`3|K]K8`18KM 8`0|K=Ky8`.8@K-(8`-|KKY@LH8`8K@8`|KK18`s8Kp8`r|KK8`C8K8`B|KK8`:8@K8`9|KK8`78K8`6|KuK@8`+8Ka08`*|KQK8`(8KA88`'|K1Km8`%8K!@8`$|KKM8`"8@KH8`!|KK-8`8KP8`|KK 8`8KK8!|} N Cdump_statistics|8`!q8K98`(K)8`8(KKYbc(H]`88`w, @PK8`v K88`uK8`t(K8(8`sKKb(c H`8,A8 8`k8KuK88 Db 8cHT`88b 8c HS`8 8`d8Hd`8`[8H-A(`b88c H}` ,dAcHA(8b 8888cHA(,#@@d@8cd@K8`K8!}N 8`68KUKKcHeA(88`EK5Kq8d@8cd@Ku8`K8!}K8`[8HA(`b88c H|` ,dA`KK!b cHFA(,Ap8`w8K}8`v Km88`uKa8`t(KQ8(8`sKEKb(c H~Q`8,A8K8|,HVM`8b`fcc,#AHG`K\8flHg`c8fHGa`K4 A switch_files|`!Km p8axH]`K`e8a8H`8a8hcHT`8apKe`8!P}N Astore_local_entry8`N @valid_timestamp |; |~!q;(@, AtHj``gccc8 8 D9 !HM`c8H!`x`8!|`}H}N Hje``gccc8 8 D9 H`c8H!i`x`8!|`}H}K;T, AK A0prot_begin_line@AF80_61||c!q, xADeHH,`HaxH `8!x`b|}HHLK9xbcHH,I`axHH u`x`b8!|}HN Aprotm_string@AF81_3b(|!,, @, A$88!}N 888~8 XH|0P|t||x|3.H`8~HA(88!}KAl8b8!N Aprot_end_line@AF82_4|c|`8 Ȉ!, ADfHH)`bHcH`x`b8!|}HHTK-b8 fHH`bHcHa`x`b8!|}HN Aprotm_number@AF83_57|!|cKKM8!p}N A(i_writeprotokoll@AF84_60,,$A$,%@88`N 8`N A ,&A4,$@ ,&@,%@K`8 8`N 8`N @t checkArgs|```!1aK5,@T8ap9H`8apHE``8apH`8!}N 8!}N A vvfprintfU16aK< @vvfprintf_sU16|!``8p88pK8!}N A8 vfprintfU16``d8fXK @ vprintfU16!|a8!AK|c8!p}N AH printfU16!|a8!AK|c8!p}N AH fprintfU16|!``8p`d8`8pK98!}N A< vsprintfU16!|a8!AKq|c8!p}N AH sprintfU16|!`a`d8``8KQ8!p}N AD vsnprintfU16!|a8!AKQ|c8!p}N AH snprintfU16|`|a`a=!qHU`( c48T08!}N ApFormattedOutputCtor|!H`8!p}N A$FormattedOutputXtor8,$M 8|&(@9AH|&8@8@}x|.N 80,&A}x|.N `}x|.N N @!OutputStream_writeNullTermination|}&aA`!!c H`;~;(#@ ;`{;@; :;, A``!|dHM:2, |Ac~H`.|}A|8C9"|@8apL1AHG` 8ap 8(x|2HI1`8(.AH98apHK`c28apHNa``|,c.AH`,A\8apHG`,<@ |<@{@ |., @cH`,@|cK@Hc P J8! @|} !AaN cH `|c P J8! @|} K@K| @A,|#@A ;K;cK;|}KcH`,A8K|PcH`.|}K C FormattedOutput_parse|`;8%!Ha`|P,#A|t|c;8!}N A\FormattedOutput_findNextSpec8N @OutputStreamCtorN @OutputStreamXtor|t8xN @OutputStream_isFileOutputStream|!T>|, @HA|c8!p}N Hi|c8!p}N APOutputStream_writeSingleChar|`89!8pa8a8H `(#8`@ 88!}H8`8!}N A"OutputStream_writeSingleCharToFile8/|&@|0PAXx8,,A A,@ |+.88`N 8`N 88`N x|+.88`N @$OutputStream_writeSingleCharToString|T>,;|!Q,@|ax@H9 ca````!K9),A<axca|)@A8!}N 8!}N a@;c`!K,;Aac|=@A8!}K AOutputStream_writeMultipleChar|}&`}*%`!a, xA|Hax@8Hu`,A@cxcH`8!|} N 8`8!|} K|HI`@`~Hax8H`,@;}8K| COutputStream_writeString|```8!q8pH `|#@@$|"8!}H8`8!}N AxOutputStream_writeStringToFile``|c8(P8!q|%@A,(/@@|>@xfAh{@@|`2H=a`c|c|8!}N c|`2{H=`K@ K{|`2H<`c|cK;@|K|{xc|`H<`8!|}KT AD OutputStream_writeStringToStringcN @OutputStream_getMaxLengthcN @OutputStream_getWrittenChars||p`!QAx`pe|f6p|cfpxc @`q`;ap;;pap```!HA(,;A<|=@@|;Kc8!}N 8`8!}K`cap`rx;`caqKP;apKD Aputc_unlockedU16|cH< @fputcU|``!qxHA(xKU`axHA(8!}N AXfputcU16H @fputsU|!aa`HA(aHu`8p8`da9H,`pA,aHA(8!}N aHA(8!}N AfputsU16```}aA!|}&)ӑ!@`,'A 88`8!|} !AaN a<`c; ;(8,=p@,8#,A,A8@};|8c$TP*|,|/./ADA,A`TѾ@,pes`TѾper`TѾ```T>x x x pcaqA @`,p@P::pap````!HAA(,AX:|7@@v:K58@,8`CP(:A,>A>|P|`KT@PK,@~9K8`8!|} K0@ aK4@0`K(T>K ;8K;8((@@8Kt8Kl8}((#A(:A(8@A}(#(LD A8K C fwrite_unlockedU16H @putsU|!aa8~XHA(aHQ`88X`da98pKq,|@08~XHA(c8!}N 8b@8p8X8p8c9Kp||,@8~XHIA(8`8!}N AputsU16!Q|ax`HA(9axK]aaHA(}a8!N AlfwriteU16_impl8K\ @ fwriteU16K @ u16_fwriteU16K @ u16_fwriteUA( L| N A( L| N A( L| N H@ @strlenU`dp`AD`f8p,AA(``!88p,Ah@8`!8%8|}(:8}09Ay'y(y  A`U',*U(>A<,'A ,(@| P|t|`8cN | P|t|`8cN | P|t|`8cN | P|t|`8cN @ strlenU16x,`f`AT`~AB, ``AX88p`e,AA,``!888p,Ap@xT`@|,(A@} 88B@$``!8, A,8C , A`N |0P|t|`8cK8*J}hJ} Z8}kP9A4y y yk A8U ,+U>A,,A,(A`(%A98}hB@```!Jyl9}}8}_9y~U}A,,,{ Uk>A,?A,=Ap,+A$8hC yh}+J}iJ8ylx$}IH9Ujy A(,(Uh>Al,)AD,*A,(A|pAKp|0P|t|`8cK|0P|t|`8cK||0P|t|`8cK\8*J}hJ} Z8}kP9AK|8`N @ strnlenU16x,`f`AT`~A, AP88p`e,AA(`!888p,A@xAP`(B8y *J}R} b8}H9Aly ,+y y A,+yD y yk A,,U A,+U A,,U .A`,+U>A@,,A$,(A9e`A}i````!8h9y}R}~b8},9Aly~,?{̂ yA@,,{D y~{ A,,UlU~A,?U.A,,Uk>A,>A,?A|,+A`C xx$|p8A8| 8B@ `!8, A(8C , A`N |c0P8cN |c0P8cN |c0P8cN |c0P8cN |c0P8cN |c0P8cN |c0P8cN |c0P8cN 8`N @ strnlenRFBH@ @strcatU`e8, A$```!88, @88`!88, @N @\ strcatU16|``!Kec|# @8Ax|,$A$```!8c8,$@8e888|#@@,`!e8|&@d88,A,A88!8`"}N 8`8!}N 8`"8!}N A strcat_sU16|``!K8|# @cA|*,$A(````!88c,$@88c88|$@@,`!8|&@8c8,A,A88!8`"}N 8`8!}N 8`"8!}N A strcat_sRFB|H< @strchrUx 8``!8|,%M 8c@8`N @4 strchrU16H@ @strcmpU88c88c|#,A0@,``!f88,#|AA|P|N @\ strcmpU16H@ @strcpyU`e|P|tT~88}q@09, A`88p`h,M ````!8A(88p9,@N 88````!8y }H:} R8| X9@88Ky ,)U yI AHU >,)A0,+A,*@N y"8N y"N 8N ````!88, @N @l strcpyU16x,`gA}PA@T~}t}q@9%, A88`hp)#,A4`!88A<88p,9@8`N x@hpAP8,$88,AA,`!8,$88,A@88`"KHh}R|B8}h@9Axx T Ay( T >AX,,``8A (,)A8Aa8|8B@p````!Rx|88}9xA0{ ,=TT>A,<A,?A,>A| 9)8C x$|R|*8|Bx }h898A4x,*y T A,(T >Ah,*A<,+A |bpAK\8`N x"8`gN x"8`N 8`gN `(&`88A`KHh}R|B8}h@9AK @, strcpy_sU16x,`gA}PAT~q@9, A88pH`hC,A@````!88A<88p,9@8`N xAh``b8(y KkZ}8}_9Aly,,{ yA|,,{D y y AH,?UA,,U A,?U.A,,U >A,?AT,,A089Aa%` } ```!8 9Zy}8}_9Aly,>{ yA,?{D y{ A,?UUAd,=U.A8,>U>A,?A,=A,>A8C px$|J|pAP8,$88,AXA,`!8,$88,A0@88`"K 8`N y"8`U>gN y"U>g8`N y"8`gN y"8`N y 8`gN y 8`N 8`gN @ strcpy_sRFBH@ @strcspnU8, A<8```!8|,'A@8, @`N @P strcspnU16H@ @strdupU|!qaxKmx8H!A(,#@8`8!}H(ax8H=`}a8!N Ap strdupU16H@ @strncatU8``,A$```!88c,@9#(%Ap,&A ,&A8x9F,(A,A(*@9}IB@X``!8c,'A,'A,'A,'Ap9C 8c,'ATx$TH|J(,*|"CA0,&A ,&AA8`g`N 8d`|`!8c8,&AC x|K8T(%AKa'(%AAK @ strncatU16|````!qK| P|#@A|< @@8,A$```!8c;,@8(<A},#A},#A8{8,%Aܠ,A(&@(8|B@X``!;,$A,$A,$A|,$Al8C ,$ATxc$W |(,'A0 , A , AA088`8!}N 8}````!8c8, AC {|K;W(<AK`(<AA|KpcK|$@A88`"8!}K\8`"8!}KH Ap strncat_sU16|````!qK| P|#@A|< @@8,A$```!8c;,@8(<A},#A},#A8{8c,%A܈,A(#@$8|iB@X``!;,$Ae,#Ae,#A|e,#Al8C ,$AT{dW|(,'A0, A , AA088`8!}N 8}````!8c8, AC |"K;W(<AK`(<AAKtcK|$@A88`"8!}K`8`"8!}KL Al strncat_sRFBH@ @strncmpU8(%A, |A\@X, |AD@@, |A,@(x`iD9f8c, |A`8@a'(+a}i@``!a9`8, AH| P@Ԡ, AH| P@, AH| P@|H, |PL3BAXC x$T|dJ(%|b@<8c8|``!8cD8, |L3BAC | P|N  |P|N  |P|N |P|N T(%@Kt9@(%@Kd @ strncmpU16H@ @strncpyUp(8A08,A,A8,A̡DxC(`/*88A`jA88|9iB@p````!9J,$Ah8,$AT8,$A@8,$A9k8C 9J,$A y$8,&,|JA+8*,A8+*,A|M 8,&889M ``!8, A$8,%98@N 88($L 8|``!8C K|8P|t||(P($M 88($L K|8P|t||(P($@N M K(`gK`K @D strncpyU168,&| @@Ax|P|tAT~|p@8, Ap88p'`g#,A4`!8c8A888p,8@8`N xAP``i8(x Hh}Z|B8}H@9A4x,,y T A,(T>A,,A,(Apa(98cA8}B@p````!}Zx|b88h}L9xA0{ ,>T T>Ad,=A@,,A,?A98C x$|`Z|8|:x }G98hA4x,+x T A,'T >A,*A,+A|dJpAd888c,89, Al```!8A(88c9, ,A8K88`N 8`N x"88`N x"8`N 88`N |#yAK @ strncpy_sU168,&| @@Ax|PT~AT~,'@, 8At88p`g,A8``!8c8A888p,8@8`N xAl``hB8(x*J}R|b8}H9Alx,+y xA,+yD xyk Ad,,TA4,+TA ,,T.A,+T>A,,Ax,+AX8c8Aa` |````!8e9k}Rx|b8H9Alx,?{̂ xA,,{D x{ A,,TTA|,>T.AT,?T>A$,,A,>A,?A8C px$|dB|pAh888c,89, AP````!8A(88c9, ,AK88`N 8`N x"8T>8`Kx"T>8`N x"88`N x"8`N x 88`N x 8`N 88`N |#yAKl @ strncpy_sRFBH@ @strpbrkU, AH8`d```!8|,'M @8c, @8`N 8`N @X strpbrkU16|H< @strrchrU88x `!8(L& @``8c@`N 8cAK @H strrchrU16H@ @strspnU8, Al, AX8c``|'A(```!8,(|@A @,(A8,&@`N 8`N @ strspnU16H@ @strstrU, A,8`f8c| (,AA$`!88c,%|(A@蠤,%A8,&A|%0@8D|*8@`99c,*```!AG&,*|H@A|'aFaf99k,)|PAAT`f,'A 8c| 8A`8f,&@ 8`N |&A@`f,'AKN ,*AK8cK @L strstrU16H@ @strtokUB((#!q|x@*a#K=xd|i"| "., @8`8!}N xaK,#8A$8}a8!Ka8Kja8!}K`iKxd|i"| "., AxK A strtokU16H@ @ strtok_rU|!|jy`x@E}CSyAKxh|jB| B., APxK],#8A$88!}|jBN |jB 8!}N 8`8!}iN 88`8!N aCKaxh|jB| B., @l8`8!}iK A strtok_rU16|`|~y!ax@yAHA(|, AtxcHA(,#8A088!}cN c8!}N 8`8!}N 88`8!N cHA(|, @<8`8!}K A( strtok_rRFB A( L| N |fx|#x|3xH @bcopy @memmove0A( L| N 8A( L| N |`!H m`8Ha`8$HU`84HI`8@H`8clh8!}N ApOutputConversionCtor|`!H `8H`8$H`84H`8@H}`8lh8!}N AlOutputConversionXtorN @OutputConversion_setArgs|``}a!Q,-, +xA;A , ,#L3A;`8`|.8(@,%*A,%.AL/%j,%lA,%L,hL3OFӂA8(@8(@|8(@p/a,%iA,%%,A/%XL3OFӂOAHT>c8x8HH`8`8!}aN 8}@`Hm`88!|c}K,s/%u/xL3OFӂOAKt{`8}4|H`{c|.K,t/%z8L3OFӂA(@pK88}$x|x|H`||;{c|.,%l/%jAK8}xH q`{c|.,%.AKLH -``|{c||.8(@K, 0LFBAK ApOutputConversion_parse|`~!axH %``8~$Hu``f8~@84xHy`8~@H`a,#AKȹ``8~@H0i`,A48~H `,8~@HA`l||Pp8~@H0%`,c@H q`,a@8K5`,aAl8K`,8~@ATH)`T`>8~@, xApH`T`>8~@, XAXH`T`>~r, o@$8p8!}N ~p8!}N ~p8!8p}K8~@H`T`>, uA8~@Hm`T`>, xA8~@HU`T`>, XA8~@H`88-,@hlKdcH`,8@8`+l~hK8@, x80@axcK``{axc8xKu`C,[AcH`,A,=8@ApH`T`>axc, c@K`,AcH`,ax@$r8 cK!`,A8|8!} AaN |c8!|} K|{cc|KccK`,AK@cH`,LJBAaxr80cK]`,@KH`T`>8@, X80@@axcK``{axc8XK`C,[A, oA A K8ax80cK``z|{.KcH)`|,8 axLJBAcrK`,`~@K`axK`a8!}8`N C OutputConversion_output8N @OutputFlagsCtorN @OutputFlagsXtor8N @ %OutputFlags_switchOnLeftJustifiedFlag8N @ &OutputFlags_switchOnSignConversionFlag8N @ OutputFlags_switchOnSpaceFlag8 N @ 'OutputFlags_switchOnAlternativeFormFlag8N @ OutputFlags_switchOnZeroFlagcN @OutputFlags_isLeftJustifiedFlagcN @ OutputFlags_isSignConversionFlagc N @OutputFlags_isSpaceFlagcN @!OutputFlags_isAlternativeFormFlagcN @OutputFlags_isZeroFlag|!888ax`!8, +A/ ,-A, #AlA4`88,@ ,A|8!}N axK,A8`8,@KaxK}KaxK,A 8KaxKK, 0A,@paxK,A 8KaxKKaxK,AK|axK KpaxK,A 8KXaxKEKL ADOutputFlags_parseP8N @FieldWidthCtorN @FieldWidthXtor, @ 8`N 8H @FieldWidth_parseTd>8`8( L 8`N @FieldWidth_isDigit|!`ed`88T>Ky,9@l9 x$````!xh8|:9|||JT>K),x$A̐aC8!p}N 8`8!p}N AFieldWidth_atoic8|48TN @FieldWidth_isDefinedcN @FieldWidth_getValuecN @FieldWidth_isStaticN @FieldWidth_setArgumentPosition N @FieldWidth_setArgumentValue|`L"Bx|``|k".`!```!K!,8Al| *.L!, *@L~|x8|k*.,#AA`8!}N , `@K|*cK`f,@$L |gx|k*.,#A@KTL K AFieldWidth_parse@AF11_38N @ OutputPrecisionCtorN @OutputPrecisionXtor, @ 8`N 8H @OutputPrecision_parseTd>8`8( L 8`N @OutputPrecision_isDigit|!`ed`88T>Ky,9@l9 x$````!xh8|:9|||JT>K),x$A̐aC8!p}N 8`8!p}N AOutputPrecision_atoicN @OutputPrecision_getValue|`L"B`x|`h`|d.!```!K!,8Ax| B.L!, *@L~|x8|kB.,#AA`8!}N 8`| B., @K|BcK`f,@$L |gx|kB.,#A@KHL K AOutputPrecision_parse@AF7_38N @ LengthModifierCtorN @LengthModifierXtor|!/%j,%l8@,tAd,%zAHi,@8!p}N A8OutputConversionSpec_setSymbolTd>8`88((AN 8@,$a(@/$i,%@$,$sA,uA,$xLFAH/$AA,XL3LFA8`N @$OutputConversionSpec_isValidSymbol__cN @OutputConversionSpec_getSymbol8N @ +OutputConversionSpec_switchOnNegativeSign__cN @OutputConversionSpec_isNegativecN @&OutputConversionSpec_getConvertedValuecK @OutputConversionSpec_isValid|``aA`z`c!Q8x8(( @A\b`xH8c| *| N axK1`,@L~888cCHA8!}N axK`,A~888cCKA8!N axK`h`e~8@#A4cCH IA8!}N cCKA PH K,:8APg888}cfzA8!N h88d8H$}`A8!}KaxKq`,@x~8,$A<cC8 8HA8!}N cCK-|8 8HKaxK)`,A|~8,$AcCKxg8 A8!N |cC|888HAA8!}N g8,$A4|cCH9A8!}N h8K``}xc;(>A|8zz,#A88cK؅`A8!}K888IH"a`A8!}KdcKA(zKgh8(>@;|,AcH |}yA{;|(;A8zz,#ALcceK׭`z88!}a|.AN 888/H!u`8!}AaKccKA(zKlc8DK`|`4T~K8cK`|}yAK axK!`,@L~8 88cCHA8!}N axK`,A~8 88cCKaxK`,@L~888cCH5A8!}N axKm`,A~888cCK,#%,AAAdAKH,:8A<8`8%8zA8!}N h8`8d8H]`A8!}K"ALOutputConversionSpec_toString|= 6=@8aA=`a`}!a<`0=c=2`?`eaA;<4!?@y? Axp?C>E818h3!Q9 79*99Kb85=`gA9LdA=i>Gp9[fA9KhA8 j=@k=`mat8 l=ox8 n=@q|8 p=`s!8 r=u8 t=@wa>I8 v>K8 x>`M8z!>@O> Q>S=U=WW>8B8xD8F8Ha8tL8Pa8pT9Jؐ,8N8Xa<Y8ap9R8V+$8Z8;@A8a,%A`,% A,%Al;!|+|} P|yA4``!|+y;9}|:.} P|y8@y|".A, xA, XA,;@@,o@ ,ALZA8}|P,o@,@|`P,@t8dT|<,xAL||8,A(8}},#A|8c8,|xBx;#.@@xB($@080}|B@`!|.;}C |.x"c$xc|`KQ`C8!}px!Aa!AaN h8'8d8H`8`8!}pK|KiA(}K;8,@Kx|@@;,K;@Kc#KY`T`>K4x xT<|#y;!A<````!x x|*.;Z}CyT<8;9@;Z|*.AKh;!;@|xx$y|:| P}CyA@`!x;9}yy$|*.;Zx8}J| P|;y@x|".A(Kx`xT<|#y;!A8```!x`x|*.;Z}CyT<8;9@;Z|*.AK AOutputConversionSpec_itoa__|}&9@%,NBaA88!9.9 *`8!;P;x;!xAp@9@#8`Aq,8p9@L}1}%!@ `d}E898ap|},;|M|!cd|),F/ fL3AAcc,@Ap@pc# 8pAc|cH%A(|A,b,@ 8bh888cHi`88||8|x(#A8,%Ac#cDcFH8{D|#.|9@@@cC0*|} 8! !AaN c#HA(cC0*|} K8bh88cH`8KtK9A(`eK4`~|zK ;KA(|yy@bh888cHQ`;!xNK\bhA,,(A@H @u16_internalErrorMsg|=..`}``8.!pHA((#P8`@X98p|B8at8\H A(8at8Ky08! }N 8p8atp8\cHA(8at8K%08! }N Au16_traceFopen;|;||}&aA!``waA!!8a8}aa؛aaaaaaaA(acHA(8`.,8 8 ;AA;!˘a.@<8aHA(|d8ae| EN!A(;"@T::.:: ````!:x8r`@H @u16_utf8conv_error|`8@``!8ap`H `8ap;8xH 5`8ap,A(b 8!8 }N H %A(8 8|}8p|8ap8|1HYA(8p8ap8K8 b 8!}N Au16_malloc_errorT>,L HN @u16_array_short,M T>T>HN @ u16_unknownFormatStrp`M H8N @dbgAlignCheckStringU16|;`}a8f!, 8p;p@B@@````!8c 8 C `8"8#%C#E% x c$e$|``! |h1Ґx d8C ;`9  |1Ґ8ap%dHMA(|`c|9pB@<```!8 9 C 8(8apG|888H ( (~IKc@8!0}a8N c (8!0N AdbgAlignCheckStringU16@AF21_20|``;`8Y!8appxH A(8apHmA(|`8o |"(@y", y "A|P|N U >| P|N y"y#"|P|N y y# |P|N | @P|N `(%@K( (@8@ `fc|t`} y(9)})B@4````!}@XP, @tcT>Uc>A|(P|N T>|P|N @ memcmpU16|H< @memchrU(%8@08x |``!8|$A8C 8`N x|cN @L memchrU16|H< @memsetU8(%@x |t8Tx |x9G}Kxxd}x}I`!8C |(Px$88|2(%L 8|````!8C N `f(%L K @ memsetU16|!xcK1A(8!p}N A(mallocU|!xHQA(8!p}N A(reallocU|!xHA(8!p}N A(callocU|!xaxKY`ax8!}N A0memcpyU|!xaxH`ax8!}N A0memmoveU|!|& @(@0A8`"8!pN H`8`"8!p}N ``Ka`8`8!p}N Ah memcpy_sRFB|!|& @(@4A8`"8!pN xH`8`"8!p}N x``K`8`8!p}N Ap memcpy_sU16|!|& @(@0A8`"8!pN H`8`"8!p}N ``H`8`8!p}N Ah memmove_sRFB|!|& @(@4A8`"8!pN xH`8`"8!p}N x``H`8`8!p}N Ap memmove_sU16A( L| N A( L| N A( L| N A( L| N @|!,AbH8cH`,#@8` 8!}HT88 H8z4;~HA`,#A(@; , ,8At8`Ac%|8| ``!8|=A8cC 8z\H`,#A(@; ,< |P|t|`;Ap|7@8wAd```!8c|<A(;{C Ki|@`}8zHQ`{{ce|P|",#cA, 0@cK`|8@|#@@H8?88 |P|t|`8| B@ ```!88 C 8!}!AaN KU`|Kp{cccK5`8@||#@@KP{c 8"|t|`;K1|@Kx`~8z\H`,#APK<`~Kc`|`8z4;>x;~H`,#AK A < sapwcpuid|!|`y8apxA|`8H`8(#|(@AH8V8`@8!}N 8apxHIA(8!}N 8`8!}N 8`HA(8!}N AstatU16b|?8H!H`8(#8`@\Há`(#@$b8!}N 8b8!}KHM`(#@K ASetSapparamVersion;;ab|!a, @{K8;K8H```!Kl1`,A;(>p@|;HK{K8;K8X``!Kk`,AD;(?p@~;XK8!}aN {&`8K@8!}|*K{&P8K@|*Klax8!N A,SetSAPPARAMDefaults!|H]A(|pH Aabort_sapparam,|L 8c8| ``!88cC N @8 shiftdown|c!Kjm`|c8!p}N A0 CmpDsTable,#M HqN @Collate,"`~|}&aA!``|aA!@8cP;~`;@!;>0,>Al;c::8K`,#AH:U, A8ap8!Hp88HA(,#A `r, @`rH,#A,"`t@X`*@,2@b8 b8c=8`KC` 0rH!,#A,"`v@$X`(@,2@b8 c8c=8`KB`?8}H Y,#APaxK] `,#A<8a8xKjM`8a8,Kh`8a8Kg`,A8a8Kg`,A8a8Kg`,A8a8Kg`,A`8a8Kh-`b8 888cKA` , @ ,9A,$A8aKg%`,@ccH| @A\88!} |Aa!AaN 8ap88H`8ap8H =`dc8 H-88!} |Kp8a8H `dK(b888cK@`K88a8 8,K8 08a8 8KK88a8 8,K8 08a8 8KK|8a8Kfy`KcDHbcD8Hbc8K,"@(X,8AP8a 08 cKg`K8,@0K,@08(@KNRB@KcDHbcD8HMbc8K,"@(X,6A`8a8 bKg9`KH,@0K,@08(@KNRB@K8d=80K>`K|8!}!AaN 8i88w!H8i8H A(8K!Aa8!N ,@8~(;~8;@; KTK8!}N CH GetDsSpec`|h!,$,A(@apA8apH|+yAe| EN!A(`},?AX8~8U, $A@<8|8|K>`8~xc8Kw`8^c8!}N 8p(8HA(`}Kl;,?AKdHhp,$AK A, sapfparam,#M T>HjN @replace_dollardollar`||}&aA!.!`aA!xp!@;P8H;" ,2A;@|`KV)`(#}AX`y|9@A-:,<:>- ~&, $@:7:w, (@, ),AHAD:w8, ,)```!L3A:s8, ,)K,)8@LKU]`|Pb%`r|t8ap8|8:&|a~0K%`y88p8p|.K``9,8apAK|ny@;@b, @x};9:|9@@!0!*8!! |} px!Aa!AaN 8x8L8p8 K9`}Kl@NX`,/AP,:AHa @ ComposeDsSpec``|}&aA!;; !1a x 8;`a x;App````!H`;{T`>, ,/ `|A,8(LZAza x@;ZKp, #@,@,=A ,9@<8` 8! |} !AaN 8a c|KhY`8a c$|KhA`8` 8! |} K8ap8=KRu`,#@,APK8ap8=KRQ``|;#8ap<8Ku``}, A`, A , @Pc#;98, , A4@(``!;98, , AA, Ac#KGY`xc , @,=@K8||t|`8| ```!8d,# , @8C K@<8C K CReadParameterLine|c!KQ`|c8!p}N A0 cmp_names|8U!<8|||8f K,i`8!p}N AP count_alloc, ||e!A8`@p, A$x| P|t||t|| (@Kw1A(,#pA,8` Kp8!}8@xN b<8dhHw`8bU8c$p` |x|@ pKpKx8!N 8 b8c<8K*M`88!}pN Areserveb!|, Ab8`=8e8l,'@(8 , AK)`KKH88` HHHHHHqHHI88`H8"8`!HHmH8!p}N 8!pN A init_sapparam8w|`,8p!8px>$T>|f8P8P@$KtA(,#dh@|8` Kabh, Abp, A$x&x>$|P|K8pb8| 8K0ch8``! (08@HPX`h8p8pC 8p8p88p(HA(8!}N b$x&|fP`$Ks-A(,#dhA4K A0read_static_data`|aAh!a, A`(|};@c;, ;`A4``!h|`K;(;{pc|@A, 8@,AT, ;;A@8c```!h|`Ky;(;p8c|@A8!}AaN c;;``!h|`K9;(;{p8c|@A, A<;c``!h|`H;(;Zp8c|@A,A\K8!N Areplace_all_d_p;|;h!q8p, A(, A~h|c*``!H8p(pc@<;;p|@@~h|c*K8!}N 8 hp|`KU;p(;8p|@@~h|c*Kx8!N A read_argv_env;|}&aA!aA!!ܑb8c H!;8a8K>`,#A 8a8K>`,#@ b, @b88cK>`,#@b, @8Ub<8|8cK#`##z|8!#p} !Aa!AaN b8c<8 8K"1`K`b8c<8 8XK" `K 8a8K=`,A888|x|"., @l`d8a88|x+.``!K=A`88|,xA(98a`8|2.,% @ ;.K8d, @8a?8Hy`,#A 8`|b88cK[`bb;@; G:U6``!c.,dA H`,`uA X, NR, AA, AA8`KUbpb@ 4::bc,p````!,dcAx| @@HU`,`u@8x88bG,t8 @|K`8#bp,:p:ec,4|(pT8c|(`@4,A|8KHcHA(K8,b, / /=pAOFӂOBA, A , @<8t:, @`!8c:, A8c, Aг:b,=p@bMqb#,`!,dcAx|4@@H`,`ubA. ,, AT, NNBLFADAp#,K, b@ p@MrBbp:pKdbp, A , @D8t:, @$```!8c:, A8c, Aȳ8b- pAH, `eLNA88x88 8cK`bp,```!,dcAH`,`ubA`,- A<, A,@@w 8 KT;w 8 K@A;w 8 K(,t@(48(,pT:,`,@4A|8K0cH!A(K , @lw 8 K8ax8p8xh(bbHA(|ry@Lbc$|@@z>$z&|P<|v:~U2I8(㞠8x B@|B@\<B@4``! |9Ґ㞠|v*x <8C ܐ |9Ґ㞠|v*x 8 |9Ґ㞠x 8 bC8 |9Ґ8KbCbd8K8p8dh(HA(r8\K@`,@H8( @8s8( @(b, @ 8r8xK@]`,@b, @8c8be8KW`8bAHKl8bx>Hx'|0P$K1A(,#dhA8` Kbh(K8}Hg`b##z|h(Kbc K?`bcK4``f8|bbdKԉ|8xbr|8\pK?=`-AhbCb8KKT,t@8x8T8bG8 Ku`8#MrBbp,:p:%#,4|(p8c|(@T`4,A|8K,cHmA(K8x888 cK`b- pA|, A,``!,dcAH`,`ubA(,- A\, A0,@@4K ,t@Ԁ(48(,pT:,`,@4A|8KhcHyA(KX;K, A,#,GA@PcNRBH`,A`u,R@,b,``!,dcAH`,, A,@;K`,t@l4(8(p,T:,@ `|4,A|8KxcHA(Khb,```!,dcAH`,, A,@;K`,t@4(8(p,T:,@ `|4,A|8KxcHA(Kh8x88b,t8 @lKA`:#b4(pT8(`,8,,@4A|8K4cHMA(K$b.,d@ 8x8H88 K`cH9A(K8a8888 HE`8aHbY`b, Apb88c8 KM`KP8pb8cH u,Ap88aK<`K C read_fileN @replace_shares|a!8dK֙8!`Kc8!8Kc8"8K8X88a`K<`8a8K5`8a?8K5`88aH9`a@,#888f8ApKNU`88888 Va@K,Ab``!88ap8(p8phHލA(|y8a A8Kߝ`~8a8\K8`,@ 8Ud8a@888 8Kp`@|a@HA(8|b8U8c K`A08!A }aN cc8K8Ud8Kt8a8 Ha@888 8Kyp`AhK8|8U`8c K5`AA08!A }N Alread_DEFAULT_PFLN @set_memmgn_default|8!Ki,#A,<b, J,jL0BA88cKY`8!}N Adset_j2ee_default;a|!,=,L+BA~@;c```!;{8aph8p(8pHA(||yAt, A4;|A 8!}aN c8 Kݙ8cK݉;|@Kd{HK8!N Aread_program_values;8`|;ph!a, A((@````!8h8xf'xg>H|f8P|@|d*,#@0T>;pA8`8!}N |*,$@8;pT>|@@KaxK4`,A (Kb8 x8c<8K`8`8!}N 8!N A<check_duplicate|8x!KЅ|~y@,b<8x88c8 K=`HX,$@,<b8x8(8c8 K `H|cP,#A@K3q`,A0=?b8x8pPX8c8 K `~H,#ADXK3%`,A0=?b8x8pHX8c8 K q`~@,#ADXK2`,A0=?b8x8p@X8c8 K %`~ ,#ADXK2`,A0=?b8x8p X8c8 K `~,#ADXK2A`,A0=?b8x8pX8c8 K `8HA8!}N Acheck_consistence|!axKQ cK1`,A0b<8 8c888xK `8!}N Ahcheck_consistence_11_21|!a(8axeh|x&x>$|PK!A(,#`~A8axKׅ8`}aKu<`d8a$|0P|~2|)yL 8````!G }lIґG%|ByL =g8C ܑG ,=,}lI%|ByL G| Ig8yL %G G8| IґG G@`@08b8!}h(N `K]A(8b8!}h(K@cK-A(K81*8K 88Uc8p8T>(h8HA(8!}N 8!}N AH AddDefPair , ?AN H9 @$ sapsystem`|;!a,ax8bU;@````!|;,#@4;|A8`8!}N xK-`;,@, @|@K8`8!}K8`8!N A Arg_Present`|aA;;`;U!Q;],ax@`!z;Z,#@@;|A8`8!}AaN xK,a`;,@, @|@K{`&8`|8!}(K8`Aa8!N A Arg_Replace`,!|aA|!aA!@;P:H,2Al, AH|b"`?C,%@cs, (@;{,), APccAH;{8, ,)````!L3A;{8, ,)K,)8yA`88)8 K!`cc;{, @Pa ! 8! }!AaN }KM`|P8`z|t:p8ap|8:F8|c~YK`{;8p.K)`,At8apHa`:,(#A`wbK`|v`u| @A|A@zbcbcKP`|s8c`!;{8c, @8ccK!8! }Aa!AaN @~P|v8cK1bCp,2A|P|t~`~`,@xbCKO`~szz`b|rKO`8{|`P|ct|c|cP|d,@(|y|xfxx|r|2KOa`|c|bDxc|B8pC.KKzbcbKO`K@~P|v8cK1b|P|tCp~`~`,@xbCKN`~szz`b|rKN`8{|`P|ct|c|cP|d,@0Kb8 <8c8K`!8! }Aa!AaN 8! N b<8c8 8KQ` !8! }N ,@;(: K4, @;:K Ka!8! }N A\replace_envparam|``aA``!aa:!QaYK},,#A,> A|Ad,=AH ,<A,,;(A0,:A,98A,$@A(H,%AP0,$Ap8X,%AL`@,$A h8!}!AaN @,$AK8,%@K0,$@|K(,%@XK,$@8K,9@K,:@K,;@K,<@K,=@K@K8a 8(@ ,>A ,=A,<A,;A,:A,9A,#A|,$A`a0,#A@8,$Aa@,#AKa@,#AK8,$@Ka0,#@K,$@K,#@xK,9@`K,:@HK,;@0K,<@K,=@K,>AK A sapgfparam`|H!,$8ap,A(@pA\d| DN!A(,#A c08!}N 8`8!}N 8ph(8HA(,#AKKҥ8apHp|#yAKl A sapgdefparam|`!8ap, A(@pH|#yATd| DN!A(,#Ac8!}N 8`8!}N 8p8(hHA(,#AKKѭ8appH|#yAKl Asapgparam_usubb8U!|c,#8@8!pN K)88bU8!p}N A` sapgaparam8`d;U|a;h(!Q, axA(8~@K5 `8$8~K`P~|#yA d| DN!A(`{8|@x&@t`x>$|cP(&A`|}*```!K2A`,8@4~8T>xe>$xf&|f(P|@@|}*K8!}aN Kϙxh88~(K3`8$8~K `P~|#yAK A sapgsparam88U`d|!a, axA(@48`8ch(K3M`88U8`8c$KM`8UPe|#yA d| DN!A(`~8bU`dc|@xf&@`8Uxc>$|fP( A`8|*```!K0a`,8U@@``f8T>xf>$xg&|g0P|@@8|*K8!}N K͵;8U8x`8c(hK2 `88U`8c$K `8UPe|#yAK Asapgsparam_usub```aA!|}P}h!Q|`yA(Ac| CN!A(`z`;"U( A`|@,LEA@x>$x&8|`0P|c*K.`cD||xT`@T>x&x>$| P|@8|e@c|# @@88`(8A(8Al(@8x>$x&8|P||*X08!}!AaN x>$x&8|(P||*0Kx>$x&8|P||*XKpK`,Ax&x>$| P|eHc|# @@x>$x&|P|dXc0|# @@88`KKY`,Ax&x>$|P|dXc0K-`|`4T~ p|4@p8KK`8,8`@DKX8`8Kx](K A sapgnparam````aAb|Pch!a|#yA(Apd| DN!A(`zb8Uc`(#|@A`{,L!ADx>$x&|`0P8|c*K+`8U||xTf@`x&x>$b|(P|@@|8e|# @@48`(8U8A(A(@T{ဤx>$x&8|P||*H AD8| (@@48!}AaN K{ဤx>$x&8}0P||* A 8| (@@KK|x>$x&8|0P||*HKHKM`,8bUAx&x>$|P|dHc|# @@ 8`KK `,8`@8`K|8`8!}~}K؀(KC(K Areal_sapgnparam_usub|!8K|c48!p}N A(sapgnparam_usub|!8K|c48!p}N A(sapgnparam_usub20N @ sapargrem`8|}&aA!`z;Ty>aA!xp8!Q8A(pH*`.KKi@8`88`8`8| ``!, ,.L3A8c88C ؠ, .,LFAtp8?|8|t|K`8 8K`X8;9|x$K:A(,#A{ $|K,?A{$8c#H`8 88K+Q`8 8hK`0,@$88bU;@":`: :(;Z080|fx$|*~ ,#@p|:@A8!|px} !Aa!AaN K`,A~K`8 (#88ap@ K`8ap8K5``t8`8K5`,4`sA,,#A$Ky`8|d`rx |s8|t|,%AT8|B@0``!,$ , L0BA,8c8C ࠃ,$ , L0BA:t,#A8`!d| DN!A(p:p,#@bX:99X, A@X````!K`,:A n9b~,#AK808+8880|x$|)*KI``t~K`|8x8 ( 8 @L~KU`8,#8+8A K `88+8K e`88+8K `888|K`8|zK7AA(|ry8qAK-bCbebK`y&8x88 x&,@H|w*|v1*K-`,@, /@8\|w*8|x&~U)*K`,|w*bE8x@ :RK`,@X, @L88bE8K'`8K$8bU88cHr`,#AP88bU8cKq``sbCKA`|c8( @8bU88cK =`8bU8bE8cK `8bU:CK8Km`K8{H6=`K|8K m`8;t8+8K `K8$xe&|P(|@h|`2K8`8!}N KUX|#yAKt Asapparam_get_param`|aA!`y!Q, A;8`, @Ȁ, @, AX, AL8`88, A4```!, AT>88, @;c`x&`|K1mA({`&,#@A|KQc@cH`;`y;\;,#A, A`!KQ`8|{#K0A(,#z;ZAc#Kc$zK q`x;K`8|{#K0A(,#zAc#Kc$zK %`;{x;,#A, @P8`8!}!AaN ,@~@<;`!|;,#@p|,#ATKgA(;|=@A,?8`AcKgA(8`8!}!AaKl;|=@@KKgA(|,#@K8`!x8!}aN 8`!x8!N 8`!x8!N 8`!x8!N AP sapsetparamdHN @ sapparam_set_bsearchdPN @ sapparam_get_cntdXN @ sapparam_get_tupeld`N @ sapparam_set_shared_defaults|!,#A`db8cK8bKQ8!p}N ADsapparam_readfile|`,aA;|}!!@H8?8K`,@$;`8cK``~8/K%`,#@c; c88K`,@;Z ,@b8cH`,#Aa(Hʥ`,#A,9`x@8a ;8 ```!888 8K`88a 8pK ,c#@<8T&(@,KE`(#8xAcDK `,Aa(H`|xy8a ;8 @pa(H A(cKcA(ccK=b8c\K8!}!AaN 8a 8K5`8a 8HR%`,#A|a08`KA(`zKiA(`gZ8a 888 cH9 Ky`88a 8pK,A8a 8HQ`|{yA,;@a0HA(K8a 808H A((#@P8`dcf8a `!K~A(8a 808HA(`d8cf(#8a Aa0HeA(cc8K`88cHP`||y@ ccH-A(8a H.`K,8a 88cHMA((#@P8`dcf8a `!K~A(8a 8c8HA(`d8cf(#8a AcHA(ccHA(8 88|Kq`8ccKb8c\K8a H.%`a(HiA(cK`A(8!}!AaKxK-A(`g8a 888 cH9 KA`88a 8pK,A8a 8HOu`|{y@KA(`g8a 888 cH9 K`88a 8pK),A8a 8HO`|{y@lKmA(`g8a 888 cH9 K݁`88a 8pK,A8a 8HN`|{y@ K A(`g8a 888 cH9 K!`88a 8pKi,A8a 8HNU`|{y@K~A(`g8a 888 cH9 K`88a 8pK ,A8a 8HM`|{y@LK~MA(`g8a 888 cH9 Ka`88a 8pK,A8a 8HM`|{y@K}A(`g8a 888 cH9 K`88a 8pKI,A8a 8HM5`|{y@K}A(`g8a 888 cH9 Kۡ`88a 8pK,A8a 8HL`|{y@,K}-A(`g8a 888 cH9 KA`88a 8pK,A8a 8HLu``{K8a ;8 ```!88c8 K`88a 8pK),c#@<8T&(@,Ke`(#8xAcDK-`,Aa(H`|xy8a ;8 A(KpcK\A(K,cK0; 8;C8cK Asapargv_mergeprofiles|!K,#@8`8!p}HHU8!p}N A@SapparamGetBoolParam,#@ 8`N Hp @SapparamParseBoolParam|!xK,#@8`8!}HxHM8!}N AHSapparamReadMemValue|`8 !q8pH=`ap`d, @88cap, @$``!88cap, A?8K`,@0xUd8`8!}N 8 apK`,A8apK`,A8apKi`,A8apKQ`,@$8`8!x}Kt8$apK`,A8,apK`,A<80apK`,A80apK`,@$8`8!xd}K88apK`,A8@apK}`,A8DapKe`,@8!8`xd}K A,SapparamParseMemValue|!K(8`@8`8!p}N A0SapparamIsBoolValue|`e8!8apK`8apHe`8ap8wLKe`,8ap<A8KI`,8ap<8AK-`,8ap8.AK`,8ap8uA8/, ,/Ac@, AKA`,#(A88,%@8c8|#@8cA4````!|#@8c,/@8@8/cK`(#@ c8!}N 8c8!}N @K A( basenameU16H @linkU|`,#!@,$;@,8cHhUA(8!}N 8apcBP888h9 d9*\9JKc8pHhA(8!}N `dBP;p8ap88h89 d9*T9JKu,?@KT AlinkU16H@ @symlinkU|`,#!@,$;@,8cHg=A(8!}N 8apcBP888h9 H9*\9JKc8pHfA(8!}N `dBP;p8ap88h89 H9*T9JK5,?@KT A symlinkU16H@ @ readlinkU|`BP|`y!a8apx@$xd;|eP8|}|KuA(||y@<P88d,8hHu8`8!}N cccHeA(,BP8Acc88h|9 ,ax9*89J@K8|#@|@|A8A4cKT>H8 @ chownU|T>,#BPT>!@08`ccHcA(8!}N `d8ap88h89  9*9JK8apccHc}A(8!}N AchownU16T>H< @mkfifoU|BPT>,#!AL`d8ap88h8^9 9*9JK8apcHbA(8!}N 8`cHbA(8!}N A mkfifoU16H @utimeU!,#BP|xAH`d8ap88h8o9 9*9JK8apxHb A(8!}N 8`HaA(8!}N A|utimeU16T>H< @creatU|BPT>,#!AL`d8ap88h89 9*9JK!8apcHaMA(8!}N 8`cHa)A(8!}N AcreatU16H@ @perrorU|!qaxbcHa8axK`bP88cKYA(8aKŭ`8` 8KSA(8!}N A perrorU16||c!H`A(,#P`dA89"88h98i<9>(9^0KM89"|#@8i9^K=8apc88h8Q99^9>K8p8|#@cAH_9A(|~y@K;BP8a`88h8J9 9*9JK,?@\KH A tempnamU16H@ @mktempU,#@ 8`N HM @ mktempU16H@ @mkstempU,#@ 8`N HL0 @ mkstempU16|cH< @ttynameU|!|cH]A(,#`dAX8bBP888c <8h9 d9*p9JK8(#|@A 8b8c HH @nlsui_wcsar2mbsar8,#8A(%@@``!x$,'Ax$,(@$8c88|&(@A`N 9,)9F8ATT>TѾa+yI|((@Ta*`A$cC#a8c|&(@@Kp`N |*(@TѾATaFa`#8cK`N 8d`!8cx$, ADx$,$@ 8K, @ 8K8K @@ U2sToUtf8s`8;aA|!}&.=!AA88, A(````!8c8, @8|x$KQA(||yAAp;`c:;\; ``!Ka`x`dP8xK A(z;Zc8,#AK|#@Al;;,=c@{d$8c|!*|8!} !AaN ,;A,;``!w:K!YA(;|>@A8`|K8bP8h8c0KA;,@````!w:K A(;|?@A8`|K,88c|!*8!} |N 8bP8h8c0K,=AK< C lnlsui_alloc_mbsar|`!qax`Ka`8{| @a`d@(axKI`c8!}N K`;ax{K`c8!}N Awcstowcs,#A`8($@48c|`!8cx$x%A(,$@8C `N 8C K8C K8`N @l UcnToFileLenR8,U >9aA9 !A}9`|cx}v|c`8(#@89?``c&X@```!|(0@a @|) @/@L@9asW4cA4,9~0@W6@0@e@9 W W|2y{0,,<@~`@ky|,@HA c8c9),;@t@pa#!AaN ?AVp8c@=k,#9)U|}|Ac8cK9`;@A(a[, 9|g@H@P9K<,#A8t8`!AaKP9`;@AK,<;@T|<0@@E@cW[2,;@h9 W{[5,W2,+@ {d,K9`;@AhK@W8;k,<@x|;0@@@9 W2,;@E@9 W[2,;@%@WZ52{9 9`W;2W9,;{c@\x|<{ @$;@AK9`;@AKb8"9 K$ @ Utf8snToU2n,#A``(%@T8|`!8Tx$x%A`TѾ,)|6pT>@$``8cC |`PN `y``8cC KԘ8cC K8`N @ U2nToUtf8x,$88}%BA,#9@A9|P@`!|' @%H@A8@t9,&x$A,*@8c8Kx%AT8TѾTˣ>yLTaja`|' @ACc8cK8"8`N 8|' @ATѾTaKc`C8cK@A,*@t8c8K$8gN `N 8e8&@````!|%H@Aؠ8c8, @DA8x%x$,@8@8`K8A`K8gN x%x$,@K @ U2snToUtf8n|!|Kq`8!p}N A(nlsui_set_trace|!K`8!p}N A$nlsui_set_trace_func|!|K `8!p}N A(nlsui_internalErrorMsg|!|K+q`8!p}N A(nlsui_array_short|!|K)q`8!p}N A(nlsui_utf8conv_errorP|8!K8A(,#A88K8A(8K8`,@8!}N HNMA(|pH Alcast_raw2ucChkFailedp`M T>H9N @nlsui_cast_raw2uc|H< @dlopenU|,#|!AP`dBP8ap88)8h9 9*9JK8apcHMeA(8!}N 8`cHMAA(8!}N A dlopenU16H @dlsymU!,$BP|axAD8ap88h8K9 9*9JK8paxHLA(8!}N 8HLA(8!}N AxdlsymU16H @dlerrorU|!HLQA(,#BP;`dAP88<8_8h9 d9*p9J|K8(#|@A 88f<808L8hK8`8!}N 8ap8pP88 88h90K8`8!}N 8ap88h8 )9 9*9JK8ap8x8pH6A(,#AK8`8!N A strftimeU16|H< @accessU|BP,#|!AL`d8ap88h8 Z9 9*9JK!8apcH6-A(8!}N 8`cH6 A(8!}N A accessU16H @chdirU|BP!,#`dA@8ap88h8 m9 9*9JKI8apH5A(8!p}N 8`H5eA(8!p}N AtchdirU16H@ @getcwdU||y`xd!q|PA8ap($@8H4A(,#Ac8pcK)8|=@8"|@AD8`@ x8!}N cx8!}N c8pPc8 8h9KQ8`x8!}N 8`x8!}N H3A(,#AK08`H3A(|y8`@x8!}N {KMA(|~ycAccK|=@8|@Ax8"c@<K A(cKA(8`8!}N cKA(c8!}N ccPc8 8h9K cKA(cKyA(8`8!}N P8 8d8hKacK9A(8`8!}N A getcwdU16T>H< @chmodU|BPT>,#!AL`d8ap88h8 9 9*9JKa8apcH1A(8!}N 8`cH1A(8!}N AchmodU16T>H< @mkdirU|BPT>,#!AL`d8ap88h8 9 9*9JKa8apcH1 A(8!}N 8`cH0A(8!}N AmkdirU16`,|}&aA!`y.;;aA!!PA@;~L|z8|x$K]A(,#A`r,@t@; ;::c`!K1A(`txd8dK A(w:8,#AK|#@A;9;|9@@u:K{$$bC|!*8!} Aa!AaN zc${$$88h8 *ch|r*| *K,@$`!x;K)A(;|=@A8`KyA(|pcc8h8 "K,@```!x;KA(;|=@AK;; ;bW:```!;KA(`uxd8dKA(w8,#A\KI|#@A ;:;|8@@K88hw8 *chKܩwK!A(Kcc8h8 "K),@;``!;KA(;|=@AK8bC|!*Kcc8h8 K8`K A(|p8~h8 KM8`KA(|p;~4K Cpnlsui_alloc_wcsarBase|c8KX @ nlsui_alloc_wcsar,#@ 8`N H @nlsui_alloc_envbpcK @ nlsui_getenvironU,#@ 8`N H @nlsui_freeenvironU, M HtN @ strtoupperU16, M HN @strntoupperU16`;|a`|!aA(```!~;`{p`,`@`,#{@D8@<;,;@c8!}aN |;,#AKd| DN!A(|K AstrcpytoupperU16, M H N @ strtolowerU16, M H 4N @strntolowerU16`;|a`|!aA(```!~;`{p`,@@`,#[@D8 @<;,;@c8!}aN |;,#AKd| DN!A(|K AstrcpytolowerU16|H< @ecvtU|!|H4A(8|dyAl88f@@c8!}N |,#AKH0A(|Kc8!N AstrntolowerR@AF140_138|``~c!````!p`,@@X,#[@<8 A0~;,#@c8!}N ~;,#AKH/A(~K AstrtolowerR@AF141_137|`,$!qA`~"`|c``!p`,`@h,#{@P8AD|;,#A;|>@@c8!}N |,#AKH.A(|Kc8!N AstrntoupperR@AF142_135|``~c!````!p`,`@X,#{@<8A0~;,#@c8!}N ~;,#AKH-A(~K AstrtoupperR@AF143_134||+y`a`|!aAȈcH-EA(T~>H-5A(;,>T`>Ap;`|>@d(=@\|;``!H,A(T~>;H,A(,>;{T`>A |>@|;@@|;K|P8!|}aN 8`8!N A strncasecmpR@AF144_133|;8c;!qc``!H, A(T~>;H+A(,>T`>A|>@};K|P8!|}N AstrcasecmpR@AF145_132|``~ax!aA(A`|cb```!p`,@@l,#[@T8 AH|;,#A;|>@@c8!}aN |,#AKd| DN!A(|Kc8!N AstrntolowerU16@AF146_128`|`}c!qA(`!p`,@@\,#[@@8 A4};,#@c8!}N };,#AKd| DN!A(}K AstrtolowerU16@AF147_127|``~ax!aA(A`|cb```!p`,`@l,#{@T8AH|;,#A;|>@@c8!}aN |,#AKd| DN!A(|Kc8!N AstrntoupperU16@AF148_125`|`}c!qA(`!p`,`@\,#{@@8A4};,#@c8!}N };,#AKd| DN!A(}K AstrtoupperU16@AF149_124``~c|,#!A$``!KA(~;,#@cKuA(8`8!}N Apnlsui_freeenvironU@AF150_1238`e, A48, A$```!88, @|`d`8K @Xnlsui_alloc_env@AF151_121|`||+yaA`!aA(A<cd| DN!A(T~>d| DN!A(T`>,>;|A;`@(=@|;Bd| ``!DN!A(T~>;d| DN!A(T`>,>;{|L3BA(|;@@ |;d| K|P8!|}AaN 8`8!N AstrncasecmpU16@AF152_106;8c;|c!qdA(| ```!DN!A(T|>;d| DN!A(T`>,<A(|<@};d| K|P8!|}N AstrcasecmpU16@AF153_104|P`888h9!9?9_a8apKE8ap8d88pH `8ap8dKv]``d8ap88KA(Ka8!}N Anlsui_cast_raw2uc@AF154_799||{d|c2;{$!q||;;e|```!K89|#@AP|,@@$};;;|K8`8!}N 8`8!}K Anlsui_wcsar2mbsar@AF155_65|!aaxKp``P8ap888h9|9=9]xK58apH A(;`~ax8pc8h89|9]9=K|#@8|@8`LFA8!}N AmkstempU16@AF156_61|!qaxKo``P8ap88{8h99>9^xK98apHA(;,#ax8pc8h89AD9>9^K|#@8|@8`LFAax8!}N 8`8!}N AmktempU16@AF157_59XA( L| N `A( L| N hA( L| N pA( L| N xA( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N |!KR5`8!p}N A$ vsprintfU!|a8!AKQ`|c8!p}N ALsprintfU|!KR5`8!p}N A$ vsnprintfU!|a8!AKQ`|c8!p}N AL snprintfU|!KN`8!p}N A$ vfprintfU|!KN`8!p}N A$vprintfU!|a8!AKNQ`|c8!p}N ALprintfU!|a8!AKMq`|c8!p}N ALfprintfU||#y!``da!AAH88`p8pKK`,|cA |#@A8`8!}N 8`x8!N A sprintf_sU16,$@ 8`N HP @ vsprintf_sU16|`~|#y!aa!AA8p8`8pcKJ`,|cAD{|#@@8!}N 888!}|#.K{888!}|#.K8`8!N A snprintf_sU16,$@ 8`N H @vsnprintf_sU16|`|#y!a8!AAxcHYA(,|cA@8|>@@|, A88`|8!}N 888`8!}|K8`px8!N A sprintf_sRFB,$@ 8`N H @ vsprintf_sRFB`|#y|!a8!AAhcHA(,8@(8|!8!}N |c8|#@A8!|!}K8`px8!N A snprintf_sRFB,$@ 8`N H0 @vsnprintf_sRFB|``!H%A(|#@,@$88|!8!}H88@8!}N 8!|!}N Avsnprintf_sRFB@AF17_16|``!HeA(,8A<|#@8@|,%A 8`|8!}N 888`8!}|K Avsprintf_sRFB@AF18_14|`~8````!q8ppcKE`|#@,@${88|#.8!}H{8@8!}N 88!}|#.N Avsnprintf_sU16@AF19_12|``d`8``!8ppKD`|#@,@8`8!}H@8!}N Alvsprintf_sU16@AF20_10A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N  A( L| N (A( L| N 0A( L| N 8A( L| N @A( L| N HA( L| N PA( L| N XA( L| N `A( L| N hA( L| N xA( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N |T>8`!A(Hcd| DN!A(|ct8!}N A\isalnumU_wrapper|T>8`!A(HEcd| DN!A(|ct8!}N A\isalphaU_wrapper|T>8`!A(Hܥcd| DN!A(|ct8!}N A\iscntrlU_wrapper|T>8`!A(Hcd| DN!A(|ct8!}N A\islowerU_wrapper|T>8`!A(Hecd| DN!A(|ct8!}N A\isprintU_wrapper|T>8`!A(Hcd| DN!A(|ct8!}N A\isspaceU_wrapper|T>8`!A(H%cd| DN!A(|ct8!}N A\isupperU_wrapper|T>8`!A(Hمcd| DN!A(Tc>8!}N A\tolowerU_wrapper|T>8`!A(Hcd| DN!A(Tc>8!}N A\toupperU_wrapper|aA!!Aax8KA(|yA,?Ac,@08!}!AaN cx8~8hH=A(#O;`8,O8` @,```!K9A(;{8` 8|;@AKA(`g8~8886HA(c8!}!AaKLK-A(`~",@,?AKx8}80HmA(#cO;@8,O8` @,```!KiA(;Z8` 8|:@AK A(`g8}888H A((>c,A`88b8T`f@;8cHA(,O@@#O;`8` c````!KA(;{8` c|;@AKmA(`gc888HiA(K;8f8TcHMA(,O@K| A nlsui_dlopen|aA!!AaxHA(`,@8!}N K-A(`~",@4c8!}!AaN x8}8HMA(#cO;@8,O8` @,```!KIA(;Z8` 8|:@AKA(`g8}888THA((>c,A@88b8 `f@;8cHA(,O@@#O;`8` c````!KةA(;{8` c|;@AKMA(`gc888VHIA(c8!}!K;8f8 cHA(,O@Kh A nlsui_dlclose|!QxKA(a,#A,@8!}N `f88HmA(#O;8,O8` @,```!KiA(;8` 8|<@AK A(`g8888H A(a8!}N ,axA@AKMA(`g8|888HIA(ax8!}K@ A nlsui_dlsym|```!axKIA(`}cK9A(`g|88|c| @xA(KI`8!}N ccH8!}N Anlsui_safe_strcat|aA!!Aaxb, @,@ 8!N 8d8HA(#O;8,O8` @,``!KԙA(;8` 8|>@AK=A(`g88d88H1A(8!}N 8 8IX8K!A(;L8IX(#A`~cKeA(8IX(<A8d(d88IX,#c @8f(fKax8IXdKA(8IX|c;C`8e(D(:Ae88IX,#x@`8f(fK=,>A , @8bIXcKA(b,@"88yHA(,A@;`#CO8,O8` @(``!KщA(;{8` 8|;@AK-A(`g8y8883H)A(8bIXcKKcK|A(,#8IXe@@,@4W>b88{HA(,A@;#O8,O8` @(``!KA(;8` 8|=@AKmA(`g8{888&HiA(8bIXcK A nlsui_setPath|a;bIX!a, A{K A(,@P( @{,#A K=A(88!}aN 8` 8KϥA(,A8~8HYA(#O;8,O8` @(``!KYA(;8` 8|<@AKA(`g8~8O88HA(( @0Kax8!N ATnlsui_resetPath|a8~\!Q, AxKӑA(,#axAD8tKӱ`8,@488!}aN 8|axKe`8,Aax8KI`8,Aax8K-`,@8b8` 8KA(88{HA(#O;8,O8` @(``!K͙A(;8` 8|<@AK=A(`g8{888H9A(88!}aK88!}N 8!N Anlsui_initLoadIcuTrace|b8c!q, AKэA(||ycA8tKѩ`,cA,8|Kэ`,cA8Kq`,cA8KU`,8@88`8KU`8!}N 8`cK!`8!}K88`8K`8!}K88`8K`8!}K\88`8Ky`8!}K$88!}K8!N Anlsui_initUfuncTrace|;IX`e8;(8(!KT` 8!}N ALnlsui_addIcuSearchPath|p`!q@b8c(KA(,#@,A8d8@AKmA(`g8888DHiA(8`8!}AKb88 8{H9A(,AH,O@@;#O8` 8````!K)A(;8` 8|=@AKA(`g8{888DHA(,KK5A(`,AD,?A@8c8~H}A(,A<,O@4;#O8` 8`!KyA(;8` 8|?@AKA(`g8~888CHA(8`8!}AKd@L8888HA(,AD,O@<;#O8` 8```!KA(;8` 8|>@AK}A(`g8888CHyA(8`8!}AKb88 8{HIA(,AH,O@@;#O8` 8````!K9A(;8` 8|=@AKA(`g8{888CHA(,K0KEA(`,AD,?A@8c8~HA(,A<,O@4;#O8` 8`!KA(;8` 8|?@AK-A(`g8~888BH)A(8`8!}AKt@\8888HA(,AD,O@<;#O8` 8```!KA(;8` 8|>@AKA(`g8888BHA(8`8!}AKb88 8{HYA(,AH,O@@;#O8` 8````!KIA(;8` 8|=@AKA(`g8{888BHA(,K0KUA(`,AD,?A@8c8~HA(,A<,O@4;#O8` 8`!KA(;8` 8|?@AK=A(`g8~888AH9A(8`8!}AK@l8888HA(,AD,O@<;#O8` 8```!KA(;8` 8|>@AKA(`g8888AHA(8`8!}AKb88 8{HiA(,AH,O@@;#O8` 8````!KYA(;8` 8|=@AKA(`g8{888AHA(,K0KeA(`,AD,?A@8c8~HA(,A<,O@4;#O8` 8`!KA(;8` 8|?@AKMA(`g8~888@HIA(8`8!}AK@|8888HA(,AD,O@<;#O8` 8```!K A(;8` 8|>@AKA(`g8888@HA(8`8!}AKb88 8{HyA(,AH,O@@;#O8` 8````!KiA(;8` 8|=@AK A(`g8{888@H A(,K0KuA(`,AD,?A@$8c8~HA(,A<,O@4;#O8` 8`!KA(;8` 8|?@AK]A(`g8~888?HYA(8`8!}AK@8888H%A(,AD,O@<;#O8` 8```!KA(;8` 8|>@AKA(`g8888?HA(8`8!}AKb88 8{HA(,AH,O@@;#O8` 8````!KyA(;8` 8|=@AKA(`g8{888?HA(,K0KԅA(`,AD,?A@48c8~HA(,A<,O@4;#O8` 8`!KA(;8` 8|?@AKmA(`g8~888>HiA(8`8!}AK@8888H5A(,AD,O@<;#O8` 8```!K)A(;8` 8|>@AKA(`g8888>HA(8`8!}AKb88 t8{HߙA(,AH,O@@;#O8` 8````!KA(;8` 8|=@AK-A(`g8{888>H)A(,K0KҕA(`,AD,?A@D8c8~HA(,A<,O@4;#O8` 8`!KA(;8` 8|?@AK}A(`g8~888=HyA(8`8!}AK@8888HEA(,AD,O@<;#O8` 8```!K9A(;8` 8|>@AKA(`g8888=HA(8`8!}AK$88 d8}HݩA(,AH,O@@;#cO8` 8````!KA(;8` 8|<@AK=A(`g8}888=H9A(,K0KХA(`,AD,?A@T8c8}HA(,A<,O@4;#O8` 8`!KA(;8` 8|?@AKA(`g8}888@AKA(`g8888@AKIA(`g888<8hHAA(,K( AmapCtypeFunctions88`"bB;  ;P888h8 88 88N @useFallBackCtype|`Te>ap`!aA,A8HMA(|ct8!}aN b8{8HٽA(,A<;#O8,O8` @$`!KA(;8` 8|=@AK]A(`g8{8 `88HQA(,@@8{8H1A(,A@;#O,O8` @,8``!K)A(;8` 8|>@AKA(`g8{8 `88HA(HA(|ct8!}aK A isalnumU_7bit|`Te>p`!qAb,A4HؙA(|ct8!}N 8h8HA(,AH;#O8,O8` @,``!KA(;8` 8|>@AKyA(`g888 8hHqA(b,@888hHMA(,AP;#O8,O8` @4````!K9A(;8` 8|>@AKA(`g888 8hHA(H=A(|ct8!}K A isalphaU_7bit|`Te>ap`!aA,A8HֽA(|ct8!}aN b8{8HHA(,A<;#O8,O8` @$`!KA(;8` 8|=@AK}A(`g8{8 `88HqA(,@@8{8HQA(,A@;#O,O8` @,8``!KIA(;8` 8|>@AKA(`g8{8 `88HA(HuA(|ct8!}aK A iscntrlU_7bit|`Te>p`!qAb,A4H A(|ct8!}N 8h8HA(,AH;#O8,O8` @,``!KA(;8` 8|>@AKA(`g888 8hHӑA(b,@888hHmA(,AP;#O8,O8` @4````!KYA(;8` 8|>@AKA(`g888 8hHA(HӭA(|ct8!}K A islowerU_7bit|`Te>ap`!aA,A8H-A(|ct8!}aN b8{8HA(,A<;#O8,O8` @$`!KA(;8` 8|=@AKA(`g8{8 `88HёA(,@@8{8HqA(,A@;#O,O8` @,8``!KiA(;8` 8|>@AK A(`g8{8 `88HA(HA(|ct8!}aK A isprintU_7bit|`Te>p`!qAb,A4HyA(|ct8!}N 8h8|H%A(,AH;#O8,O8` @,``!KA(;8` 8|>@AKA(`g888 8hHϱA(b,@888hHύA(,AP;#O8,O8` @4````!KyA(;8` 8|>@AKA(`g888 8hHA(HA(|ct8!}K A isspaceU_7bit|`Te>ap`!aA,A8HϝA(|ct8!}aN b8{88HA(,A<;#O8,O8` @$`!KA(;8` 8|=@AKA(`g8{8 `88HͱA(,@@8{8H͑A(,A@;#O,O8` @,8``!KA(;8` 8|>@AK-A(`g8{8 `88H!A(HUA(|ct8!}aK A isupperU_7bit|`T~>a,@p`!a@`@8,[8 @,8!T>}aN c8!}aKb,A,@@Kcb8h8HA(,AD;#O8,O8` @(`!KA(;8` 8|=@AKA(`g888 8hHˑA(b,@\88hHmA(,AP;#O8,O8` @4````!KYA(;8` 8|=@AKA(`g888 8hHA(K A tolowerU_7bit|`T}>aA,`p`!a@d@<,{8@08!T>}AaN c8!}AaKԃ,A,`@KcB8z8HA(,AH;#cO8,O8` @0````!KA(;8` 8|<@AKA(`g8z8 `88HɁA(,@X8z8HaA(,A@;#O,O8` @,8``!KYA(;8` 8|>@AKA(`g8z8 `88HA(K A toupperU_7bit|b!8 Ki8`8!p}N A0 useICUCtypeb8cN @ getIcuLibList|aA!!QK`",@(,@8~KA(,A(#@8~P`e88}HǡA(,O@@;#cO8` 8````!KA(;8` 8|<@AK=A(`g8}888H9A(8KI|}yA܀,@0!x8!c}aN 88|HA(,O@D;`|`8` #O8````!KA(;{8` 8|;@AKmA(`g8|888HiA(c!x8!}aKP;IX ,%A,@p`K%8K9|}yAĀ,@8Kc8!}!AaN 88|HŽA(,O@<;`|`8` #O8``!KA(;{8` 8|;@AK]A(`g8|888HYA(KPK-,A8~KaA(,@(#@8~P`e88|H A(,AH,O@@;#O8` 8````!KA(;8` 8|?@AKA(`g8|888HęA(,,@A8`8!}K88|H]A(,A<,O@4;#O8` 8`!KYA(;8` 8|?@AKA(`g8|888HA(,@l8 ,8}HA(,AH,O@@;#O8` 8````!KA(;8` 8|?@AKmA(`g8}888HiA(8`8!}Kd8$ 8|H5A(,AD,O@<;|`8` #O8``!K)A(;8` 8|=@AKA(`g8|888HA(K88|H±A(,O@@;`#CO8` 8````!KA(;{8` 8|;@AKMA(`g88|88HIA( K8~8H)A(,O@8;#cO8` 8``!K)A(;8` 8|<@AKA(`g8~888HA(K8d8THA(,O@H;|`8` #O8```!KA(;8` 8|>@AK=A(`g88d88H1A(,A@ 8|8~HA(,O@@;`|`8` #O8```!KA(;{8` 8|;@AKA(`g8~888HA(,A8` 8KA(K A openLibIcuUc|aA!a, Ab(B88cK,#dAc88K,#dAc88K,#dAc88K,#dA@c88K,#dApc8$8Ku,#dAc8@8KU,#dAc8T8K5,#dA c8l8K,#dA 0c88K,#@A dc88K,#0Ac88K,#8Ac88K,#dAc88K,#dA,c88Ka,#dA488`Ap8!}N K}A(`~,A8,>AA08`8!}AaN 8c8HA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AK=A(`g8888fH9A(8`8!}AKX@@8888HA(,A,O@;#O8` 8```!KA(;8` 8|>@AK`b888{HA(,A@,O@8;#O8` 8``!KA(;8` 8|=@AK=A(`g8{888fH9A(,KDKA(`~,A,>A@,8c8HA(,A@,O@8;#O8` 8``!KA(;8` 8|>@AKA(`g8888eHA(8`8!}AK@8888HUA(,A,O@;#O8` 8```!KIA(;8` 8|>@AK`b888{HA(,A@,O@8;#O8` 8``!KA(;8` 8|=@AKA(`g8{888eHA(,KlKA(`~,A,>A@|8c8HAA(,A@,O@8;#O8` 8``!K9A(;8` 8|>@AKA(`g8888dHA(8`8!}AK@8888HA(,A,O@;#O8` 8```!KA(;8` 8|>@AK`b888{HAA(,A@,O@8;#O8` 8``!K9A(;8` 8|=@AKA(`g8{888dHA(,KlKEA(`~,A,>A@8c8HA(,A@,O@8;#O8` 8``!KA(;8` 8|>@AK-A(`g8888cH)A(8`8!}AKH@08888HA(,A,O@;#O8` 8```!KA(;8` 8|>@AK`b888{HA(,A@,O@8;#O8` 8``!KA(;8` 8|=@AK-A(`g8{888cH)A(,KlKA(`~,A,>A@8c8HA(,A@,O@8;#O8` 8``!KA(;8` 8|>@AK}A(`g8888bHyA(8`8!}AK@8888HEA(,A,O@;#O8` 8```!K9A(;8` 8|>@AK`b888{HA(,A@,O@8;#O8` 8``!KA(;8` 8|=@AK}A(`g8{888bHyA(,KlKA(`~,A,>A@l8c8H1A(,A@,O@8;#O8` 8``!K)A(;8` 8|>@AKA(`g8888aHA(8`8!}AK@8888HA(,A,O@;#O8` 8```!KA(;8` 8|>@AK`b888{H1A(,A@,O@8;#O8` 8``!K)A(;8` 8|=@AKA(`g8{888aHA(,KlK5A(`~,A,>A@8c8HA(,A@,O@8;#O8` 8``!KyA(;8` 8|>@AKA(`g8888`HA(8`8!}AK8@ 8888HA(,A,O@;#O8` 8```!KA(;8` 8|>@AK`b88l8{HA(,A@,O@8;#O8` 8``!KyA(;8` 8|=@AKA(`g8{888`HA(,KlKA(`~,A,>A@ 8c8HA(,A@,O@8;#O8` 8``!KA(;8` 8|>@AKmA(`g8888_HiA(8`8!}AK@p8888H5A(,A,O@;#O8` 8```!K)A(;8` 8|>@AK`b88T8{HA(,A@,O@8;#O8` 8``!KA(;8` 8|=@AKmA(`g8{888_HiA(,KlKA(`~,A,>A@\8c8H!A(,A@,O@8;#O8` 8``!KA(;8` 8|>@AKA(`g8888^HA(8`8!}AK@8888HA(,A,O@;#O8` 8```!KyA(;8` 8|>@AK`b88@8{H!A(,A@,O@8;#O8` 8``!KA(;8` 8|=@AKA(`g8{888^HA(,KlK%A(`~,A,>A@8c8HqA(,A@,O@8;#O8` 8``!KiA(;8` 8|>@AK A(`g8888]H A(8`8!}AK(@8888HA(,A,O@;#O8` 8```!KA(;8` 8|>@AK`b88$8{HqA(,A@,O@8;#O8` 8``!KiA(;8` 8|=@AK A(`g8{888]H A(,KlKuA(`~,A,>A@8c8HA(,A@,O@8;#O8` 8``!KA(;8` 8|>@AK]A(`g8888\HYA(8`8!}AKx@`8888H%A(,A,O@;#O8` 8```!KA(;8` 8|>@AK`b888{HA(,A@,O@8;#O8` 8``!KA(;8` 8|=@AK]A(`g8{888\HYA(,KlKA(`~,A,>A@L8c8HA(,A@,O@8;#O8` 8``!K A(;8` 8|>@AKA(`g8888[HA(8`8!}AK@8888HuA(,A,O@;#O8` 8```!KiA(;8` 8|>@AK`b888{HA(,A@,O@8;#O8` 8``!K A(;8` 8|=@AKA(`g8{888[HA(,KlKA(`~,A,>A@8c8HaA(,A@,O@8;#O8` 8``!KYA(;8` 8|>@AKA(`g8888ZHA(8`8!}AK@8888HA(,A,O@;#O8` 8```!KA(;8` 8|>@AK`b888{HaA(,A@,O@8;#O8` 8``!KYA(;8` 8|=@AKA(`g8{888ZHA(,KlKeA(`~,A,>A@8c8HA(,A@,O@8;#O8` 8``!KA(;8` 8|>@AKMA(`g8888YHIA(8`8!}AKh@P8888HA(,A,O@;#O8` 8```!K A(;8` 8|>@AK`b888{HA(,A@,O@8;#O8` 8``!K~A(;8` 8|=@AKMA(`g8{888YHIA(,KlKA(`~,A,>A@<8c8HA(,A@,O@8;#O8` 8``!K}A(;8` 8|>@AKA(`g8888KHA(8`8!}AK@8888HeA(,A,O@;#O8` 8```!K}YA(;8` 8|>@AK`888}HA(,A@,O@8;#cO8` 8``!K|A(;8` 8|<@AKA(`g8}888KHA(,Kl8`8!N AmapIcuUtilFunctionsb(8ab|8 `c!aK),#dAHc8 p8K ,#dHA(c8 8K ,#dA c8 8K(,#dA c8 8K0,#dAc8 8K8,#dAc8 8Ki@,#dAc8 8KIH,#dAhc8 8K)P,#dA,88`Xax8!}N KMA(`b,Al,?AA,8`8!}aN 8c8~HmA(,A<,O@4;#O8` 8`!KziA(;8` 8|?@AK} A(`g8~888H A(8`8!}aK\@D8888HA(,AD,O@<;#O8` 8```!KyA(;8` 8|>@AK|mA(`g8888HiA(8`8!}aK88 8~H9A(,AH,O@@;#O8` 8````!Ky)A(;8` 8|=@AK{A(`g8~888HA(b,KK1A(`b,AP,?A@8c8}HyA(,AH,O@@;#O8` 8````!KxiA(;8` 8|?@AK{ A(`g8}888H A(8`8!}aK\@D8888HA(,AD,O@<;#O8` 8```!KwA(;8` 8|>@AKzmA(`g8888HiA(8`8!}aK88 8|H9A(,AH,O@@;#O8` 8````!Kw)A(;8` 8|>@AKyA(`g8|888HA(b,K K1A(`b,AP,?A@8c8}HyA(,AH,O@@;#O8` 8````!KviA(;8` 8|?@AKy A(`g8}888~H A(8`8!}aK\@D8888HA(,AD,O@<;#O8` 8```!KuA(;8` 8|>@AKxmA(`g8888~HiA(8`8!}aK88 8|H9A(,AH,O@@;#O8` 8````!Ku)A(;8` 8|>@AKwA(`g8|888~HA(b,K K1A(`b,AP,?A@8c8}HyA(,AH,O@@;#O8` 8````!KtiA(;8` 8|?@AKw A(`g8}888}H A(8`8!}aK\@D8888HA(,AD,O@<;#O8` 8```!KsA(;8` 8|>@AKvmA(`g8888}HiA(8`8!}aK88 8|H9A(,AH,O@@;#O8` 8````!Ks)A(;8` 8|>@AKuA(`g8|888}HA(b,K K1A(`b,AP,?A@8c8}HyA(,AH,O@@;#O8` 8````!KriA(;8` 8|?@AKu A(`g8}888|H A(8`8!}aK\@D8888HA(,AD,O@<;#O8` 8```!KqA(;8` 8|>@AKtmA(`g8888|HiA(8`8!}aK88 8|H9A(,AH,O@@;#O8` 8````!Kq)A(;8` 8|>@AKsA(`g8|888|HA(b,K K1A(`b,AP,?A@8c8}HyA(,AH,O@@;#O8` 8````!KpiA(;8` 8|?@AKs A(`g8}888{H A(8`8!}aK\@D8888HA(,AD,O@<;#O8` 8```!KoA(;8` 8|>@AKrmA(`g8888{HiA(8`8!}aK88 8|H9A(,AH,O@@;#O8` 8````!Ko)A(;8` 8|>@AKqA(`g8|888{HA(b,K K1A(`b,AP,?A@8c8}HyA(,AH,O@@;#O8` 8````!KniA(;8` 8|?@AKq A(`g8}888zH A(8`8!}aK\@D8888HA(,AD,O@<;#O8` 8```!KmA(;8` 8|>@AKpmA(`g8888zHiA(8`8!}aK88 8|H9A(,AH,O@@;#O8` 8````!Km)A(;8` 8|>@AKoA(`g8|888zHA(b,K K1A(`b,AP,?A@8c8}HyA(,AH,O@@;#O8` 8````!KliA(;8` 8|?@AKo A(`g8}888yH A(8`8!}aK\@D8888HA(,AD,O@<;#O8` 8```!KkA(;8` 8|>@AKnmA(`g8888yHiA(8`8!}aK88 p8|H9A(,AH,O@@;#O8` 8````!Kk)A(;8` 8|>@AKmA(`g8|888yHA(b,K K1A(`~b,A,>A@8c8}HyA(,AH,O@@;#O8` 8````!KjiA(;8` 8|?@AKm A(`g8}888xH A(8`8!}aK\@D8888}HA(,A,O@;#O8` 8```!KiA(;8` 8|?@AK`88 `8hHqA(,AD,O@<;#O8` 8`!KiiA(;8` 8|?@AKl A(`g888x8hHA(b,KX AXmapUbidiFunctions|8b(a!a8 LcK8`h,#eA8`8!}N KA(|y,A@AA,8`8!}aN c88HA(,AH;#O8,O8` @0````!KgA(;8` 8|>@AKjA(`g8888HA(8`8!}aKH@08888HMA(,A;#O8,O8` @`!KgIA(;8` 8|>@AK`bb`e88{8 LHA(,AH;#O,O8` @48````!KfA(;8` 8|=@AKi}A(`g8{888HuA(,?,AAP8`8!}K$ A|mapUshapingFunctionsb(8aA|8 tc!aKp,#BdAc8 8K,#zPAc8 8K,#zXA c8 8Kx,#dA c8 8Ki,#z`Ac8 8KM,#zhAc8 8K1,#zpAc8 8K,#zxAtc8 88K,#dA088`Ap8!}N KA(`~,A|,>AA08`8!}AaN 8c8|H9A(,AH,O@@;#O8` 8````!Kd)A(;8` 8|>@AKfA(`g8|888HA(8`8!}AKL@48888~HA(,AD,O@<;#O8` 8```!KcA(;8` 8|=@AKf-A(`g8~888H)A(8`8!}AKb88 88{HA(,AH,O@@;#O8` 8````!KbA(;8` 8|=@AKeA(`g8{888HA(,KK}A(`~,AH,>A@8c8|HAA(,A@,O@8;#O8` 8``!Kb9A(;8` 8|>@AKdA(`g8|888HA(8`8!}AK\@D8888~HA(,AD,O@<;#O8` 8```!KaA(;8` 8|=@AKd=A(`g8~888H9A(8`8!}AKb88 8{H A(,AH,O@@;#O8` 8````!K`A(;8` 8|=@AKcA(`g8{888HA(,K,K|A(`~,AH,>A@8c8|HQA(,A@,O@8;#O8` 8``!K`IA(;8` 8|>@AKbA(`g8|888HA(8`8!}AKl@T8888~HA(,AD,O@<;#O8` 8```!K_A(;8` 8|=@AKbMA(`g8~888HIA(8`8!}AKb88 8{HA(,AH,O@@;#O8` 8````!K_ A(;8` 8|=@AKaA(`g8{888HA(,K,KzA(`~,AH,>A@8c8|HaA(,A@,O@8;#O8` 8``!K^YA(;8` 8|>@AK`A(`g8|888HA(8`8!}AK|@d8888~HA(,AD,O@<;#O8` 8```!K]A(;8` 8|=@AK`]A(`g8~888HYA(8`8!}AKb88 8{H)A(,AH,O@@;#O8` 8````!K]A(;8` 8|=@AK_A(`g8{888HA(,K,Kx%A(`~,AH,>A@8c8|HqA(,A@,O@8;#O8` 8``!K\iA(;8` 8|>@AK_ A(`g8|888H A(8`8!}AK@t8888~HA(,AD,O@<;#O8` 8```!K[A(;8` 8|=@AK^mA(`g8~888HiA(8`8!}AKb88 8{H9A(,AH,O@@;#O8` 8````!K[)A(;8` 8|=@AK]A(`g8{888HA(,K,Kv5A(`~,AH,>A@ 8c8|HA(,A@,O@8;#O8` 8``!KZyA(;8` 8|>@AK]A(`g8|888HA(8`8!}AK@8888~HA(,AD,O@<;#O8` 8```!KYA(;8` 8|=@AK\}A(`g8~888HyA(8`8!}AKb88 8{HIA(,AH,O@@;#O8` 8````!KY9A(;8` 8|=@AK[A(`g8{888HA(,K,KtEA(`~,AH,>A@08c8|HA(,A@,O@8;#O8` 8``!KXA(;8` 8|>@AK[-A(`g8|888H)A(8`8!}AK@8888~HA(,AD,O@<;#O8` 8```!KWA(;8` 8|=@AKZA(`g8~888HA(8`8!}AK b88 8{HYA(,AH,O@@;#O8` 8````!KWIA(;8` 8|=@AKYA(`g8{888H~A(,K,KrUA(`~,AH,>A@@8c8}H~A(,A@,O@8;#O8` 8``!KVA(;8` 8|>@AKY=A(`g8}888H~9A(8`8!}AK@8888~H~A(,AD,O@<;#O8` 8```!KUA(;8` 8|=@AKXA(`g8~888H}A(8`8!}AK88 8}H}iA(,AH,O@@;#cO8` 8````!KUYA(;8` 8|<@AKWA(`g8}888H|A(,K,KpeA(`|,A,<A@P8c8}H|A(,A@,O@8;#O8` 8``!KTA(;8` 8|>@AKWMA(`g8}888H|IA(8`8!}AK@8888}H|A(,A,O@;#O8` 8```!KT A(;8` 8|>@AK`88 t8hH{A(,AD,O@<;#O8` 8`!KSA(;8` 8|>@AKVIA(`g8888hH{AA(,Kd AmapUnormFunctionsb(88 |c!qKz,#dA$c88 Kz,#dA"c88 0Kz,#dA hc88 DKz,#dADc88 TKz],#dA c88 hKz9,#dAc88 |Kz,#dAc88 Ky,#dAc88 Ky,#dAc88 Ky,#dAlc88 Ky,#dAHc88 Kya,#dA $c88 Ky=,#dA c88 Ky,#dAc88 Kx,#dAc88 ,Kx,#dAc88 DKx,#dApc88 `Kx,#dA(88!8`}N KkA(`b,At,?AA(8`8!}N c8}8HwA(,A@,O@8;#O8` 8``!KOA(;8` 8|?@AKRmA(`g8}888HweA(8`8!}KT@<8888Hw-A(,A<,O@4;#O8` 8`!KO)A(;8` 8|>@AKQA(`g8888HvA(8`8!}K`8|88 `HvA(,A<,O@4;#O8` 8`!KNA(;8` 8|>@AKQ-A(`g8|888Hv%A(b,KKiA(`b,AP,?A@c8}8HuA(,A@,O@8;#O8` 8``!KMA(;8` 8|?@AKPmA(`g8}888HueA(8`8!}KT@<8888Hu-A(,A<,O@4;#O8` 8`!KM)A(;8` 8|>@AKOA(`g8888HtA(8`8!}K`8|88 DHtA(,A<,O@4;#O8` 8`!KLA(;8` 8|>@AKO-A(`g8|888Ht%A(b,K KgA(`b,AP,?A@c8}8HsA(,A@,O@8;#O8` 8``!KKA(;8` 8|?@AKNmA(`g8}888HseA(8`8!}KT@<8888Hs-A(,A<,O@4;#O8` 8`!KK)A(;8` 8|>@AKMA(`g8888HrA(8`8!}K`8|88 ,HrA(,A<,O@4;#O8` 8`!KJA(;8` 8|>@AKM-A(`g8|888Hr%A(b,K KeA(`b,AP,?A@c8}8HqA(,A@,O@8;#O8` 8``!KIA(;8` 8|?@AKLmA(`g8}888HqeA(8`8!}KT@<8888Hq-A(,A<,O@4;#O8` 8`!KI)A(;8` 8|>@AKKA(`g8888HpA(8`8!}K`8|88 HpA(,A<,O@4;#O8` 8`!KHA(;8` 8|>@AKK-A(`g8|888Hp%A(b,K KcA(`b,AP,?A@c8}8HoA(,A@,O@8;#O8` 8``!KGA(;8` 8|?@AKJmA(`g8}888HoeA(8`8!}KT@<8888Ho-A(,A<,O@4;#O8` 8`!KG)A(;8` 8|>@AKIA(`g8888HnA(8`8!}K`8|88 HnA(,A<,O@4;#O8` 8`!KFA(;8` 8|>@AKI-A(`g8|888Hn%A(b,K KaA(`b,AP,?A@c8}8HmA(,A@,O@8;#O8` 8``!KEA(;8` 8|?@AKHmA(`g8}888HmeA(8`8!}KT@<8888Hm-A(,A<,O@4;#O8` 8`!KE)A(;8` 8|>@AKGA(`g8888HlA(8`8!}K`8|88 HlA(,A<,O@4;#O8` 8`!KDA(;8` 8|>@AKG-A(`g8|888Hl%A(b,K K_A(`b,AP,?A@c8}8HkA(,A@,O@8;#O8` 8``!KCA(;8` 8|?@AKFmA(`g8}888HkeA(8`8!}KT@<8888Hk-A(,A<,O@4;#O8` 8`!KC)A(;8` 8|>@AKEA(`g8888HjA(8`8!}K`8|88 HjA(,A<,O@4;#O8` 8`!KBA(;8` 8|>@AKE-A(`g8|888Hj%A(b,K K]A(`b,AP,?A@c8}8HiA(,A@,O@8;#O8` 8``!KAA(;8` 8|?@AKDmA(`g8}888HieA(8`8!}KT@<8888Hi-A(,A<,O@4;#O8` 8`!KA)A(;8` 8|>@AKCA(`g8888HhA(8`8!}K`8|88 HhA(,A<,O@4;#O8` 8`!K@A(;8` 8|>@AKC-A(`g8|888Hh%A(b,K K[A(`b,AP,?A@c8}8HgA(,A@,O@8;#O8` 8``!K?A(;8` 8|?@AKBmA(`g8}888HgeA(8`8!}KT@<8888Hg-A(,A<,O@4;#O8` 8`!K?)A(;8` 8|>@AKAA(`g8888HfA(8`8!}K`8|88 HfA(,A<,O@4;#O8` 8`!K>A(;8` 8|>@AKA-A(`g8|888Hf%A(b,K KYA(`b,AP,?A@c8}8HeA(,A@,O@8;#O8` 8``!K=A(;8` 8|?@AK@mA(`g8}888HeeA(8`8!}KT@<8888He-A(,A<,O@4;#O8` 8`!K=)A(;8` 8|>@AK?A(`g8888HdA(8`8!}K`8|88 HdA(,A<,O@4;#O8` 8`!K@AK?-A(`g8|888Hd%A(b,K KWA(`b,AP,?A@c8}8HcA(,A@,O@8;#O8` 8``!K;A(;8` 8|?@AK>mA(`g8}888HceA(8`8!}KT@<8888Hc-A(,A<,O@4;#O8` 8`!K;)A(;8` 8|>@AK=A(`g8888HbA(8`8!}K`8|88 HbA(,A<,O@4;#O8` 8`!K:A(;8` 8|>@AK=-A(`g8|888Hb%A(b,K KUA(`b,AP,?A@c8}8HaA(,A@,O@8;#O8` 8``!K9A(;8` 8|?@AK@AK;A(`g8888H`A(8`8!}K`8|88 |H`A(,A<,O@4;#O8` 8`!K8A(;8` 8|>@AK;-A(`g8|888H`%A(b,K KSA(`b,AP,?A@c8}8H_A(,A@,O@8;#O8` 8``!K7A(;8` 8|?@AK:mA(`g8}888H_eA(8`8!}KT@<8888H_-A(,A<,O@4;#O8` 8`!K7)A(;8` 8|>@AK9A(`g8888H^A(8`8!}K`8|88 hH^A(,A<,O@4;#O8` 8`!K6A(;8` 8|>@AK9-A(`g8|888H^%A(b,K KQA(`b,AP,?A@c8}8H]A(,A@,O@8;#O8` 8``!K5A(;8` 8|?@AK8mA(`g8}888H]eA(8`8!}KT@<8888H]-A(,A<,O@4;#O8` 8`!K5)A(;8` 8|>@AK7A(`g8888H\A(8`8!}K`8|88 TH\A(,A<,O@4;#O8` 8`!K4A(;8` 8|>@AK7-A(`g8|888H\%A(b,K KOA(`b,AP,?A@c8}8H[A(,A@,O@8;#O8` 8``!K3A(;8` 8|?@AK6mA(`g8}888H[eA(8`8!}KT@<8888H[-A(,A<,O@4;#O8` 8`!K3)A(;8` 8|>@AK5A(`g8888HZA(8`8!}K`8|88 DHZA(,A<,O@4;#O8` 8`!K2A(;8` 8|>@AK5-A(`g8|888HZ%A(b,K KMA(`b,AP,?A@c8}8HYA(,A@,O@8;#O8` 8``!K1A(;8` 8|?@AK4mA(`g8}888HYeA(8`8!}KT@<8888HY-A(,A<,O@4;#O8` 8`!K1)A(;8` 8|>@AK3A(`g8888HXA(8`8!}K`8|88 0HXA(,A<,O@4;#O8` 8`!K0A(;8` 8|>@AK3-A(`g8|888HX%A(b,K KKA(`b,AP,?A@c8}8HWA(,A@,O@8;#O8` 8``!K/A(;8` 8|?@AK2mA(`g8}888HWeA(8`8!}KT@<8888HW-A(,A<,O@4;#O8` 8`!K/)A(;8` 8|>@AK1A(`g8888HVA(8`8!}K޴`8|88 HVA(,A<,O@4;#O8` 8`!K.A(;8` 8|>@AK1-A(`g8|888HV%A(b,K KIA(`b,AP,?A@c8}8HUA(,A@,O@8;#O8` 8``!K-A(;8` 8|?@AK0mA(`g8}888HUeA(8`8!}KT@<8888HU-A(,A<,O@4;#O8` 8`!K-)A(;8` 8|>@AK/A(`g8888HTA(8`8!}Kܴ`8|88 HTA(,A<,O@4;#O8` 8`!K,A(;8` 8|>@AK/-A(`g8|888HT%A(b,K A&mapUbrkFunctionsb(8aA|B8 c!aKS,#dAc8 8KS,#dAc8 8KS,#dAc8 8KSe,#dApc8 8KSE ,#dA,88`(Ap8!}N KFiA(`,Ax,?AA08`8!}AaN 8c8~HRA(,AD,O@<;#O8` 8```!K*yA(;8` 8|?@AK-A(`g8~888HRA(8`8!}AKP@88888HQA(,AD,O@<;#O8` 8```!K)A(;8` 8|>@AK,}A(`g8888HQyA(8`8!}AKb88 8{HQIA(,AH,O@@;#O8` 8````!K)9A(;8` 8|=@AK+A(`g8{888HPA(,KKDEA(`,AD,?A@8c8~HPA(,A<,O@4;#O8` 8`!K(A(;8` 8|?@AK+-A(`g8~888HP)A(8`8!}AK`@H8888HOA(,AD,O@<;#O8` 8```!K'A(;8` 8|>@AK*A(`g8888HOA(8`8!}AKb88 8{HOYA(,AH,O@@;#O8` 8````!K'IA(;8` 8|=@AK)A(`g8{888HNA(,K0KBUA(`,AD,?A@8c8~HNA(,A<,O@4;#O8` 8`!K&A(;8` 8|?@AK)=A(`g8~888HN9A(8`8!}AKp@X8888HNA(,AD,O@<;#O8` 8```!K%A(;8` 8|>@AK(A(`g8888HMA(8`8!}AKb88 8{HMiA(,AH,O@@;#O8` 8````!K%YA(;8` 8|=@AK'A(`g8{888HLA(,K0K@eA(`,AD,?A@8c8~HLA(,A<,O@4;#O8` 8`!K$A(;8` 8|?@AK'MA(`g8~888HLIA(8`8!}AK@h8888HLA(,AD,O@<;#O8` 8```!K$ A(;8` 8|>@AK&A(`g8888HKA(8`8!}AK88 8}HKyA(,AH,O@@;#cO8` 8````!K#iA(;8` 8|<@AK& A(`g8}888HK A(,K0K>uA(`,AD,?A@8c8}HJA(,A<,O@4;#O8` 8`!K"A(;8` 8|?@AK%]A(`g8}888HJYA(8`8!}AK@x8888HJ%A(,AD,O@<;#O8` 8```!K"A(;8` 8|>@AK$A(`g8888HIA(8`8!}AK88 8hHIA(,AL,O@D;#O8` 8```!K!yA(;8` 8|>@AK$A(`g8888hHIA(,K( A mapUidnaFunctions88|(c!qKH0,#dA`c88KH8,#dA@AK A(`g8888HEA(8`8!}K`8|88tHEA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AK =A(`g8|888HE5A(b,KK8A(`b,AP,?A@c8}8HDA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK}A(`g8}888HDuA(8`8!}KT@<8888HD=A(,A<,O@4;#O8` 8`!K9A(;8` 8|>@AKA(`g8888HCA(8`8!}K`8|88`HCA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AK=A(`g8|888HC5A(b,K K6A(`b,AP,?A@c8}8HBA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK}A(`g8}888HBuA(8`8!}KT@<8888HB=A(,A<,O@4;#O8` 8`!K9A(;8` 8|>@AKA(`g8888HAA(8`8!}K`8|88PHAA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AK=A(`g8|888HA5A(b,K K4A(`b,AP,?A@c8}8H@A(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK}A(`g8}888H@uA(8`8!}KT@<8888H@=A(,A<,O@4;#O8` 8`!K9A(;8` 8|>@AKA(`g8888H?A(8`8!}K`8|88@AK=A(`g8|888H?5A(b,K K2A(`b,AP,?A@c8}8H>A(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK}A(`g8}888H>uA(8`8!}KT@<8888H>=A(,A<,O@4;#O8` 8`!K9A(;8` 8|>@AKA(`g8888H=A(8`8!}K`8|88,H=A(,A<,O@4;#O8` 8`!KA(;8` 8|>@AK=A(`g8|888H=5A(b,K K0A(`b,AP,?A@c8}8H@AKA(`g8888H;A(8`8!}K`8|88H;A(,A<,O@4;#O8` 8`!KA(;8` 8|>@AK=A(`g8|888H;5A(b,K K.A(`b,AP,?A@c8}8H:A(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK}A(`g8}888H:uA(8`8!}KT@<8888H:=A(,A<,O@4;#O8` 8`!K9A(;8` 8|>@AKA(`g8888H9A(8`8!}K`8|88 H9A(,A<,O@4;#O8` 8`!KA(;8` 8|>@AK=A(`g8|888H95A(b,K K,A(`b,AP,?A@c8}8H8A(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK}A(`g8}888H8uA(8`8!}KT@<8888H8=A(,A<,O@4;#O8` 8`!K9A(;8` 8|>@AKA(`g8888H7A(8`8!}K`8|88H7A(,A<,O@4;#O8` 8`!KA(;8` 8|>@AK=A(`g8|888H75A(b,K K*A(`~b,A,>A@c8}8H6A(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK}A(`g8}888H6uA(8`8!}KT@<8}888H6=A(,A,O@;#O8` 8`!K9A(;8` 8|?@AK``8d88H5A(,AH,O@@;#O8` 8``!K A(;8` 8|?@AKmA(`g88d88H5aA(b,KL AxmapUcalFunctions8`|d!q| A(DN!A((8`@ȃ,A8!}N 8}8 $H4A(,A@;#O8,O8` @(``!K A(;8` 8|?@AK=A(`g8}8(88H45A(8`8!}N 8`8!}N A( checkIcuDataaAB|!A,A(@8apd| DN!A(8t8ape| EN!A(,@$8apd| DN!A(8t8ape| EN!A(,@,8!}AaN 8t88 H2A(#O;8,O8` @0````!K A(;8` 8|<@AK =A(`g8888EH29A(8!}AaKT8t8~8 hH1A(#O;`8,O8` @,```!K A(;{8` 8|;@AK A(`g8~888AH1A(K``8}8 HH1yA(#O;8,O8` @(``!K yA(;8` 8|>@AK A(`g8}8=88H1A(K Anlsui_traceIcuVersionT>b|!, @( , @Kh,#(dAKp],@XKBQ,@Ke,@K9,@K,@(Ka,@KU,@Ki,A,8`88!}d N KU88`8!}d dK8`88!} dKcK=8`88!}d Kcx8!N AX initIcuUcD8,8T>8,Al99 @`9`#8yG ,*9@|```!}F@@9)98,,Ay |(,,9IA|1`N 9Ih9)9}F8,,AK @nlsui_cpy_cmdline_par8`|aA%v8!Q|p8my' `!& }ґ&y' 8C & ,|ґ&@;8d;8;p;` ;C``! |fKI;|`,|,@$@ ;Z@;|1K8ap8|1K9`8!}AaN 8ap8|!K`8!}N A`nlsui_store_cmdline8`H< @nlsui_initialize|}&a`{!aK5K7b,@Wc>, @K@AKA(`g8888 TH*A(KH8`8!|} KH8` 8K}A(8~8H*=A(#O;8,O8` @,```!K9A(;8` 8|<@AKA(`g8~888 FH)A(K C loadIcuDo|!qK28,@8!}N 8h8PH)EA(#O;8,O8` @4````!K9A(;8` 8|<@AKA(`g8888hH(A(88!}N Anlsui_set7bitUnicodeb8xX`"B( N @HunsetIcu|}&aAБ!aK_U`b.@X,@@  B8K"|}yb;IXAȀ,@8c|8!} AaN 8 8~H'!A(;|`#O8,O8` @,```!KA(;8` 8|<@AKA(`g8~8880H&A(KL ,%A܀,@`K)8 K!|~yA,@$K.Ic8!|} K88 8}H&9A(;|`#O8,O8` @$`!K9A(;8` 8|<@AKA(`g8}888CH%A(KhK-b,A8`|KT8P8}H%A(,AH;#O8,O8` @0````!KA(;8` 8|?@AK-A(`g8}888H%)A(8`|K88}H%A(#O;`8,O8` @0````!KA(;{8` 8|;@AKA(`g88}88:H$A( K8~KA(8b(#@8~P`e8{H$]A(,O,A@;#O@48` 8```!KIA(;8` 8|=@AKA(`g8{888+H#A(KP8|8H#A(#O;8,O8` @,```!KA(;8` 8|=@AKmA(`g8|8)88H#eA(b.@K8` 8KeA(K CopenLibIcuI18n|!q,AHd(,#A0K 8b8!}(N 8!N 8d84H"A(,AD;#O8,O8` @(`!KyA(;8` 8|?@AKA(`g88d88H"A(bc(,#@08!}K< AcloseLibIcuI18n88D|(c!qK!,#dA c88TK!,#dAc88hK!e,#dAc88xK!A,#dAc88K!,#dApc88K ,#dA(88!x8`}N K!A(`b,At,?AA(8`8!}N c8}8H AA(,A@,O@8;#O8` 8``!K9A(;8` 8|?@AKA(`g8}888HA(8`8!}KT@<8888HA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AK=A(`g8888H5A(8`8!}K`8|88HA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888HA(b,KKA(`b,AP,?A@c8}8HAA(,A@,O@8;#O8` 8``!K9A(;8` 8|?@AKA(`g8}888HA(8`8!}KT@<8888HA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AK=A(`g8888H5A(8`8!}K`8|88HA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888HA(b,K KA(`b,AP,?A@c8}8HAA(,A@,O@8;#O8` 8``!K9A(;8` 8|?@AKA(`g8}888HA(8`8!}KT@<8888HA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AK=A(`g8888H5A(8`8!}K`8|88xHA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888HA(b,K K A(`b,AP,?A@c8}8HAA(,A@,O@8;#O8` 8``!K9A(;8` 8|?@AKA(`g8}888HA(8`8!}KT@<8888HA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AK=A(`g8888H5A(8`8!}K`8|88hHA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888HA(b,K K A(`b,AP,?A@c8}8HAA(,A@,O@8;#O8` 8``!K9A(;8` 8|?@AKA(`g8}888HA(8`8!}KT@<8888HA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AK=A(`g8888H5A(8`8!}K`8|88THA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888HA(b,K K A(`~b,A,>A@c8}8HAA(,A@,O@8;#O8` 8``!K9A(;8` 8|?@AKA(`g8}888HA(8`8!}KT@<8}888HA(,A,O@;#O8` 8`!KA(;8` 8|?@AK``8d88DH9A(,AH,O@@;#O8` 8``!K)A(;8` 8|?@AKA(`g88d88HA(b,KL A mapUcolFunctions8aAB|8(!acKe,#dA c88KE,#A 4c88K),#dA dc88K ,#Ac88K,#Ac88K,#Ac88K,#dA0c8,8K,#dA088`Ap8!}N KA(`~,A@,>AA08`8!}AaN 8c8HA(,AD,O@<;#O8` 8```!KA(;8` 8|>@AKmA(`g8888HiA(8`8!}AKP@88888H5A(,A,O@;#O8` 8```!K)A(;8` 8|>@AK`b88,8{HA(,A@,O@8;#O8` 8``!KA(;8` 8|=@AKmA(`g8{888HiA(,KA@$8c8H!A(,A@,O@8;#O8` 8``!KA(;8` 8|>@AKA(`g8888HA(8`8!}AK@8888HA(,A,O@;#O8` 8```!KyA(;8` 8|>@AK`b888{H!A(,A@,O@8;#O8` 8``!KA(;8` 8|=@AKA(`g8{888HA(,KlK%A(`~,A,>A@t8c8HqA(,A@,O@8;#O8` 8``!KiA(;8` 8|>@AK A(`g8888H A(8`8!}AK@8888HA(,A,O@;#O8` 8```!KA(;8` 8|>@AK`b888{HqA(,A@,O@8;#O8` 8``!KiA(;8` 8|=@AK A(`g8{888H A(,KlKuA(`~,A,>A@8c8H A(,A@,O@8;#O8` 8``!KA(;8` 8|>@AK]A(`g8888H YA(8`8!}AK@@(8888H %A(,A,O@;#O8` 8```!KA(;8` 8|>@AK`b888{H A(,A@,O@8;#O8` 8``!KA(;8` 8|=@AK]A(`g8{888H YA(,KlKA(`~,A,>A@8c8H A(,A@,O@8;#O8` 8``!K A(;8` 8|>@AKA(`g8888H A(8`8!}AK@x8888H uA(,A,O@;#O8` 8```!KiA(;8` 8|>@AK`b888{H A(,A@,O@8;#O8` 8``!K A(;8` 8|=@AKA(`g8{888H A(,KlKA(`~,A,>A@d8c8H aA(,A@,O@8;#O8` 8``!KYA(;8` 8|>@AKA(`g8888H A(8`8!}AK@8888H A(,A,O@;#O8` 8```!KA(;8` 8|>@AK`b888{H aA(,A@,O@8;#O8` 8``!KYA(;8` 8|=@AKA(`g8{888HA(,KlKeA(`~,A,>A@8c8HA(,A@,O@8;#O8` 8``!KA(;8` 8|>@AKMA(`g8888HIA(8`8!}AK0@8888HA(,A,O@;#O8` 8```!K A(;8` 8|>@AK`b888{HA(,A@,O@8;#O8` 8``!KߩA(;8` 8|=@AKMA(`g8{888HIA(,KlKA(`~,A,>A@8c8HA(,A@,O@8;#O8` 8``!KA(;8` 8|>@AKA(`g8888HA(8`8!}AK@h8888HeA(,A,O@;#O8` 8```!KYA(;8` 8|>@AK`888}HA(,A@,O@8;#cO8` 8``!KA(;8` 8|<@AKA(`g8}888HA(,Kl AmapUtransFunctionsb(!|,A, AKU,#d(AXKD,@LKU,@@K,@4K=,8@$8`8!p}dN K8`8!p}dK8`d8`8!p(dN c8!pN A initIcuI18nTc>K @loadIcu`Tc>|!dA(| DN!A(( ,A 8`@8`8!}N AhisgraphU`T~>|c!dA(| DN!A(,cA4d| DN!A(( ,@ 8`@8`8!}N AispunctU(0+a@0(AA (F@(f8`LXBAN 8`N (9(A@AK @L isxdigitU```aA!|^!A,xAX|P|x8K`888!}|!AaN 8b`T>8{8HA(,AD;@##O8,O8` @,```!KyA(;Z8` 8|:@AKA(`g8{888HA(,@W>8{8@cHA(,AD;#CO8,O8` @,```!KA(;8` 8|>@AKۍA(`g88{88HA(|P|x8K=`888!}|K Anlsui_safe_strcat@AF60_13A( L| N A( L| N xA( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N (A( L| N 0A( L| N |!8pHQ8!}N A$getc_unlockedU16|``aA!8!AaxHA(,Td0AHT`4,$`},A`xT`6AxTd8, ,AAT88t8!8`#}!AaؐN axHEA(,T`2A8`|, AK`{axH A(,A`zT`2, A8`^~KH`yaxHA(,AT`2, @<{`{ {eTT02T`&Te|3x<|+x`|x|(@ 8^~K|8!}!AaK8^K8KaxHA(,T`2A\8`{, A~KH`|axHA(T`2,Al, 8A~~K { {T02TcT`&|x}|+x8!|aN 8`~~KaxH5A(,AT`2, @4{T`>8!}x0,|N 8~8t8`#8!}N 8!}N 8`8!}N Agetc_unlockedU16_errnoH @fgetcU|`|a!KIA(8pc8tK`~cKIA(,bHAp8{,At`ȀbP,@h8d|A8a|X@h8KA(8a|888K`KE`8`KA({c@8!0}aN 8`KґA(||#@c8888cK`K`8K.8a|X8tK]A(8a|888K`t8auK`cK`Ki`c@8!0}aK4,t@ Kp,t@K| AfgetcU16|H< @fgetsU|``aA``}!`!KG-A(8;c8t8pp,@K=`y,A8``````!x`8,@8`Aа~4p @KAK|T|8p;K),`{A, x`AK| AgetsU16,$@ 8`N H0 @ gets_sU16,$@ 8`N Hp @ gets_sRFBH @freadU,$@ 8`N H0 @freadU16|``aA``!`|`!KAA(8`}(;p@\````!c8t8pKcd;{,x`A8<,|Vp(@X`AcKA5A(|P 8!|t}!A|a|`N |;d@ T|;(;@KH`Kp,t@x8a|bX8,@`.KyA(8a|888K`8atccKU`K`K AfreadU16@AF13_12($|``~aA`}!a@ `4;pT`@а4(8(,Ab8d,Ax;}B```!, ;Ad{;{;| @@L`4pT`@4(8(,A8d,@,A8b4p @0c8!}AaN (?8A8`8!}KȘ8`8!}AaK|=@b8A4p ApKbHA(,A8Kd(48(,AK,AKbHYA(,AKld(48(,AK08`K ALgets_sRFB@AF14_10|``aAc!!!bK=1A(8(>pAd; bK=9A(p,tA,A8b4p @4c8!}!AaN (>8A8`8!}Kİ8`8!}!AaK|=@b8A4p AlK8a|8X88'Gg ,@H|A!aK`8atccK`K)`K,A\K;b8t8pK`y,A8```!8, ADxf8,8t@L=``| @@8pbK,`y@bK;aA(p,t@,Ka!aH A(|yA,8,$@<,$@88 8 ,$A\8@8~+88;a a a;;~+899)9J`!KYq`88|# @(@``A;8{A ,`8@899)d*Ad;;{9J|*,$@| 8x$8!8~}a|)*N ``88c88$K`8`8!}aK8`8!}aK888~8!}|!*N ;8~8@899&9FKW`8(#@8 8|@LFA  ,$AxK8`8!}N 8~(;(8@899&9FKW`(#@8|@AA,$AK8 A getgrgidU16H@ @getpassU|!Q,#`d@t8`HA(,#AL`db8868c(9`9&l9FtKV`8(#|@Ab8c(@8`8!}N 8ap8@8/9`9&9FKP]`8apH!A(,#AKp A getpassU16``}aA`|^!Q,:@;@^|@@Dx$8|*, -@,|K>`,A8|9#<,$:,A`@b, A, :@T8`? , @;Z8^8!}AaN b8c8,K`<KccxK=Y`,#<A<89,':ax@|d,@At{, ,:L3A(b8c8K`888`:, :A8`?K|`8xg$ax9|8*K`8ax9K8,$@h;ZK\K^88`8!}KD888`8!}K||`y@KX AgetoptUH@ @opendirU|!,#`dA@8ap8899&9FKLm`8apHYA(8!p}N 8`H=A(8!p}N At opendirU16H@ @readdirU|!HA(,#8Ad889&9F(8h209KQQ`8(#|@A bA8!p8c(}N 8`8!p}N A readdirU16H@ @ readdir_rU|``!a8x8pHA(,8@T8 88Q9x9&9FKP=`8,>(#@A,A(8`A8!}N b8!}cK A readdir_rU16xA( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N 8`N @tol_dummy_function|}&aA`,!`~b`|!A,,$L+Acc~HY`c,A$`!;z;ZH5`,@8NB8`,$-,A9@l8;N1,,0O@@cA ,@,'XA,'xA ,@; ',$ccA|};{) }GA!j```!,<,0AT,$9/$aAt9DAlUL>|,H@4|#@@;AH|X@LEA<|g|l8,$@|@,=A8"9A,@XxAp|@NBA@@|c |8!} !AaN @9|h |K|@NBA@K,=8`A|P|t|, A0, XA , x@8,$0@ KH 8!|} K@NK,$z,AA9DAUL>|,H@K,$Z8LD AT>|,H@Kd;; K@; K,$+@8N0;K8N0K,@@,=b8A!8!8`}N 8apc%8KA(8ap8884KA`K C strtolU16|K @strtolU|}&aA`,!`~b`|!A,,$L+Acc~H `c,A$`!;z;ZH `,@8NB8`,$-,A`8@(8;,,0O@,cL0BA,&x,XLFA,@; &,$ccA|3{( }&9!I````!,<,0AT,$9/$aA09$A(U+>|+@@4|#8@;A|P@LEA|f|k8,$@|@,=ApA,@@@|c |8!} !AaN 8"8` |K,=8`A|P|t|, A0, x,XLFBA8,$0@ Kd 8!|} K\NK,$z,AA9$AU+>|+@@K,$Z8LD AT>|+@@K;; K8@4; K,,$+@䠜;K؀,@@,=b8A!8!8`}N 8apc%8KA(8ap8884KY`K Ct strtoulU16|K\ @strtoulU|}&aA`,!`~b`|!A,,$L+Acc~H9`c,A$`!;z;ZH`,@8NB8`,$-,A9@l8;N1,,0O@@cA ,@,'XA,'xA ,@; ',$ccA|};{) }GA!j```!,<,0AT,$9/$aAt9DAlUL>|,H@4|#@@;AH|X@LEA<|g|l8,$@|@,=A8"9A,@XxAp|@NBA@@|c |8!} !AaN @9|h |K|@NBA@K,=8`A|P|t|, A0, XA , x@8,$0@ KH 8!|} K@NK,$z,AA9DAUL>|,H@K,$Z8LD AT>|,H@Kd;; K@; K,$+@8N0;K8N0K,@@,=b8A!8!8`}N 8apc%8KA(8ap8884K!`K C strtollU16|K @strtollU|}&aA`,!`~b`|!A,,$L+Acc~H`c,A$`!;z;ZH`,@8NB8`,$-,A`8@(8;,,0O@,cL0BA,&x,XLFA,@; &,$ccA|3{( }&9!I````!,<,0AT,$9/$aA09$A(U+>|+@@4|#8@;A|P@LEA|f|k8,$@|@,=ApA,@@@|c |8!} !AaN 8"8` |K,=8`A|P|t|, A0, x,XLFBA8,$0@ Kd 8!|} K\NK,$z,AA9$AU+>|+@@K,$Z8LD AT>|+@@K;; K8@4; K,,$+@䠜;K؀,@@,=b8A!8!8`}N 8apc%8KA(8ap8884K9`K Ct strtoullU16|K\ @ strtoullU,0/A@,F8`LX A8`N ,9,a@A,fA8`N @D isxdigitU16, ,Al, @\A`, ,LF BAH,,AN 8`,@A(AA@$8`CN 8`AN 8`?N 8`=N ,D/LA<,F/HA(AA@8`KN 8`IN 8`GN 8`EN ,N/PA(AA@8`SN 8`QN 8`ON 8`MN ,Z/jA,T/\AN 8`?N 8`@N 8`AN 8`BN 8`CN 8`DN 8`EN 8`FN 8`GN 8`HN 8`IN 8`JN 8`KN 8`LN 8`MN 8`NN 8`ON 8ޠ,!o(AbxH8c4X| *| N 8`!pN 8`!qN 8`!rN 8`!sN 8`!tN 8`!uN 8`!vN 8`!wN 8`!xN 8`!yN 8`!zN 8`!{N 8`!|N 8`!}N 8`!~N 8`!N A08(AdbxH8c4|c *|iN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8`!N 8`"N 8`#N 8`$N 8`%N 8`&N 8`'N 8`0N 8`1N 8`2N 8`3N 8`4N 8`5N 8`6N 8`7N 8`@N 8`AN 8`BN 8`CN 8`DN 8`EN 8`QN 8`SN 8`UN 8`WN 8``N 8`aN 8`bN 8`cN 8`dN 8`eN 8`fN 8`gN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`pN 8`qN 8`N 8`rN 8`sN 8`tN 8`uN 8`N 8`N 8`N 8`vN 8`wN 8`N 8`N 8`zN 8`{N 8`N 8`xN 8`yN 8`|N 8`}N 8`N 8J<8|2((AbxH8c=| *| N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N AN 8`?N 8`@N 8`AN 8`BN 8`CN 8`DN 8`EN 8`FN 8`GN 8`HN 8`IN 8`JN 8`KN 8`LN 8`MN 8`NN 8`ON 8`PN 8`QN 8`RN 8`SN 8`TN 8`UN 8`VN A 88 8T8((I+AbxH8cH|c *|iN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`xN 8`N 8`N 8`N 8`N 8`N 8` N 8` N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8`"N 8`$N 8`&N 8`(N 8`*N 8`,N 8`.N 8`IN 8`2N 8`4N 8`6N 8`9N 8`;N 8`=N 8`?N 8`AN 8`CN 8`EN 8`GN 8`JN 8`LN 8`NN 8`PN 8`RN 8`TN 8`VN 8`XN 8`ZN 8`\N 8`^N 8``N 8`bN 8`dN 8`fN 8`hN 8`jN 8`lN 8`nN 8`pN 8`rN 8`tN 8`vN 8`yN 8`{N 8`}N 8`SN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8` N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`"N 8`$N 8`&N 8`(N 8`*N 8`,N 8`.N 8`0N 8`2N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N A|bxH8c|c *|iN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N AbxH8c0|c *|iN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8`!N 8`"N 8`#N 8`$N 8`%N 8`&N 8`'N 8`(N 8`)N 8`*N 8`+N 8`,N 8`-N 8`.N 8`/N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8` N 8` N 8` N 8` N 8`N 8`N 8``N 8`bN 8`dN 8`fN 8`hN 8`jN 8`lN 8`nN 8`pN 8`rN 8`tN 8`vN 8`xN 8`zN 8`|N 8`~N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N ,,EA\A@`N 8ސ,!(AbxH8c| *| N 8`!`N 8`!aN 8`!bN 8`!cN 8`!dN 8`!eN 8`!fN 8`!gN 8`!hN 8`!iN 8`!jN 8`!kN 8`!lN 8`!mN 8`!nN 8`!oN A8(A4bxH8c|c *|iN 8`N 8`N 8`N 8`N 8`N 8` N 8` N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8`"N 8`$N 8`&N 8`(N 8`*N 8`,N 8`.N 8`0N 8`2N 8`4N 8`6N 8`8N 8`:N 8`N 8`@N 8`BN 8`DN 8`FN 8`HN 8`JN 8`LN 8`NN 8`PN 8`RN 8`TN 8`VN 8`XN 8`ZN 8`\N 8`^N 8``N 8`bN 8`dN 8`fN 8`hN 8`jN 8`lN 8`nN 8`pN 8`rN 8`tN 8`vN 8`xN 8`zN 8`|N 8`~N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8` N 8` N 8` N 8` N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`(N 8`)N 8`*N 8`+N 8`,N 8`-N 8`.N 8`/N 8`8N 8`9N 8`:N 8`;N 8`N 8`?N 8`HN 8`IN 8`JN 8`KN 8`LN 8`MN 8`YN 8`[N 8`]N 8`_N 8`hN 8`iN 8`jN 8`kN 8`lN 8`mN 8`nN 8`oN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 80<8|2((AbxH8c'| *| N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N ATbxH8c(h| *| N 8`!N 8`"N 8`#N 8`$N 8`%N 8`&N 8`'N 8`(N 8`)N 8`*N 8`+N 8`,N 8`-N 8`.N 8`/N 8`0N 8`1N 8`2N 8`3N 8`4N 8`5N 8`6N 8`7N 8`8N 8`9N 8`:N @ toupperU16|!q, @A\8, @<, $@, IA;, @Ƞ;, /@c, /8c@(`8c8, A0, /A, 8c8A, /@K($8A`8,%@, AX|P|t||,@@8ccH `c8!}N cK`,@@c8cH `c8!}N cx8!}N cc/#``!,% , /%.A4OL^A(8c8/#,%@, AHK``K8,%AK`;, /@K8, d@8d, :@`d;, @K`d, $@KĠ, (@$, #@8, )@`8, @Kx AModulnameFromWhatstring``T>aAT>!|!,8ATKHd @ strfeql||y`aA`!!QAX,%|A,|0|Acc@cxcEH,A48`8!}!AaN ||PA0|H)Tc>8!}!AaK|P|~HTc>8!}!AaKcy`xcEH,@PK|{ccH8!|`4}aT~N txт8!N |P|t8!xтN Astrffeql88|8c,A |i`!8, @C 8`N 8`N @D strfempty||#y,``!q@pAX,|@4c8 Kb`8!}N px8!N x8!N ,Ac|@cKҍ`||`A||@8ccxKM`8!}Khc|cxK`8!}K0`|xcc`K`|P|8 |Kau`8!}KAK Astrfcpy`,%`||`|!q@T,@px8!N 8 K``8!}N | @\`xK`|@|P{||"|8 K`e`8!}K`xK}`|A8!}Kd AstrffcpyT>88|88,A,|```!8|%A8C 8`N x|cN @\strfchrT>|x 8|c"|t|,%8A,|````!8c| @C 8`N 8`N @dstrfallT>| |d|,%A`!8c| @C 8`N 8`N @DstrfallR,|L 8c| ```!| 8cC N @8memtr,|L 8c8| ``!8|(8cC N @<memctr|8`~|!x``|2 | @|(P|t|,'@\x@(8~88!}|.N c8KQ`8~88!}|.K|f.,# @8e|# @A,``!88, @8`|& @@|P8~p8|t8!|x|#.N |P|t|xA8c8K`KX A0strzcpy8,@l|888} ````!9'D8, ,*LFA G88C `y}#" |N 8`N @strz2cpy8,@h8|88} ````!9'D8, ,*LFAG88C `}( |N 8`N @| strz2cpyR|9```|!qx |B, @ | P|t|`8|@,|@Tc{``K`{8,=|.A 88!}N 8{,'|.@x8!N ,,AD@,8x8,=|#.A8K,=A8Kt8`c|xK`K`|2., @@8|$(@A```!8c8, @`|&(@AK| P|t|`8|@4K Astrz3cpy`d, M 8 , _A 8, M , _@谤8, M , _AKN @`strca_`d`e, ,_AdA,8, A`!88, @8 , _L ```!8, _AN 8, A$``!8`8, @8|$@8 `8,_L3BM |$@8,_L M ``!8|$@8,_L @Kd @strct_|& @Axx|P|2|"|%@@8|@PexB|#8@8|@|9%`fO'X@<`9@@,`!'8F8)P@(@9AM 8c@8`N N M 8c@K|@P|@|#8@xB8| ```!M 8c@K @ UcaFindUca|```!qK=``}cK-`|=@Axc{|P, |c"AT8`e, |@|8,'A,``!8|@@08,'@8!}N A|#@8c@8`8!}KAK A UcsFindRevUcs|& @A| P|*}:|%@@89$|HP|#@@|'`f%@`| @<9%9E)@@,`!(9f8|X@(*@9JAM 8c@8`N N M 8c@K8|#@@| P|@|````!M 8c@K @ MemFindMem|& @A| P|*|"|%@@8e&`|@`|)X@<9%9E|@@,`!(98|)`@0|@9JAA|$@8@8`N `N AK|@A|%@``!8A|@AK @ MemFindRevMem|`|#y|!qAK`~cK `|c@ 8!Q| x888X,À a(daB@4`!g8 f8 C 8a8'8 G&F ( (08@H PKP`8a88 KP`ce(8aKQ`8a(K=`8a88 KP`9cC88!89A(99!xpxH`axc88HU`8!}AaN 8a8 8 KO`8a8 8KO`8a8 8(KO`8aH`8a8 8KO`8a88 KOu`8a88 KOa`c(8a`K`8a(K`8a88 KO!`A9!9`0cCx8 98x89!A9A̐apHA`axc8 8H`A8!}N Arslgwri2b0|!,,A @b0`d,A܈8d, A@H` 0(8@`,ATKm `,#8@T8apKq`88apK`88apKñ`88apHA` 8!}N `e8ap8Kɹ`88apH ` 8!}N  8!}N 8!N b 8cXKlM`80,#@ K88 K`,0d@K Axlook_after_daemonsN @look_at_file_length_and_swap|aA!!H5`bX|+yAx4, @D ;84 8 8 T8 c4|*|)dPd8cH@`b 88c8cTKi`b 8 8c8cdKK-`b 888R &(08@&Hc8ctK`b 8 8c8cKJ` 88~ Kj)`,#@ <`8d 8b0c8,% @88`8THD`|}yBA8~8K`c88HM`,A0, @ 8|#(@@,@H 8|#@A00|xBxxc>$||4T~c88HL`,AL8c>88x8p9r!H_I`0,|`4T~,@A"  `!ax8|<@A`,;@, aAx88a8K`,@ ;hKc;c H`=`cH]q`;hdKl88a88 K`8x KTcHT`,?AT8~t8K`b 88!}!cAaؘN b 8cH8!}!AaKcHYa`,c@T888x8p9rH]y`|`4T~KdA$"  `!ax8|<@A,;@, aAx88a8K!`,@ ;Kc;c H^}`cH[`;dKl88a88 K`8x KTcHX9`,c@,888x8p9rH\Q`|`4T~Kb0c8K`8~8K`b 8A8!}cN  80A8!}|c8xhтyMy>$|gPy.|gPy$|c:d|c4Tc~fN b0c8K`8~l8K`b 8A8!}cN b0c8K`8~\8K`b0 8A8!}dN 8<88@8TH?A`|}yKp88 K` dKb 88cK!`8!}N b 88cTK`b088!}N Arslgcscsa_create;0 |~ !q8 ```!} , A8;,8|(@@d 8 A`, A;b 88cK`8 8 c8!}N }|c 8cHt `K8K88;,|@@@d 8 @P}8c 8cHs`, @8K8hc8 8!}KP Areserve_slot_in_file|!Hm`X|`yA 4, À4|"4, Ax |(@A0| /&,A\,&ATALLZAD8b 8c8Ke`8b08,$A$8!}N 80H=`8b088!}Kb 8c8K`8`;,&A$,&,L3A|K8```!H`(<8`;,L3BAKb 88cKE`8b088!}Kb 88cLK `8b088!}KK4|"4, @4b 8Kb 88cK`8b08 8!}N Ax rslgascsa`0|!, A,,@,A,A,Ah,@, @8 8~PK^`(#@}8}88~K^`(#@}@}@,AK,A ,@8~K^U`,#A, 9@|8, @}8,#@ 08! }N 88`Hoe`08! }N K8`IH_A(, a}8@888h8H8`}H,#A8aH_iA(K8}8Kq`aH_EA(8~8KQ`8K8888H8 `}H,#A8aH^A(K8~H88KU`K\}HHI%`8K,@,@HsA`, @8`IH^A(, a}8@8 88h8H7Y`}H,#A48aH^9A(08! }N 8}8K)`aH]A(88K `808! }N 88 88H6`}H,#A8aH]A(KP}HHG`K, @8K}HHG`88K, @8Kl}HHGy`88KLAHKH;b 8cPKZ`(#@}8}888 8h8TH5`}P,#@Db 8cKZ`,#A, 9@8KKt88H>=`88h}PHG`}PHF`8ap88K:`88ap t8ppK`8ap 8pK`,@<8ax88K:Q`8ax x8xKu`8ax 8xKa`|`4T~}K Arslginit8`N @rslgnf_number_of_filesb0c8|48TN @rslgnp_no_problemb08N @rslgwrc_reset_cacheb08N @rslgwss_stop_sending|`8 88F8!q8}HI`c84888FH-`8}8888FH`8} 8888FH`8h88@88FH`8}8888FH`8} 8888FH`888@88FH`8}8888FHi`8!}N A< dump_to_2``0|aA!```aa7aV!1Tu>, @A488 }| a8apt `!: 8 C 88xH7$ ( (cسv| ```!8 8 C H+E`,A<8a,,@ A, AK, @ ,A,5cAHKK]8!}!AaN c 88 K `8,@KHmA(K||d|H8H85`8p8x,|H89w8@D|8KI`b 8c 8K1`|HH@e`8HKHJm`8a8h, @Kՙ`|HHLA`8h|H, @`HIe`|HHV`,@|8Kե`b 8c \8K`|HH?`8HKX8HI`K88K`KdKK,K8!}K@8h8a8KԹ`8a`8 8 K3Y`8a8 8 K3E`8a8 8 K31`8a 8 8 K3`8a48 8 K3 `8aH]8at8*8K2`K48`K=K A rslgwr1;; `| |aA!;`aA!xp }!x `l`x`v`t`rc0A(8xc.899!9A|3y:8x;A|}ya}9~~Α`:dt(A|8` 8 fFN!A(,x|`4T~@L($ 8@\8|hx| `!;Z 8c C ؓp,;8 AX;a8` 8|3yAtf| FN!A(,@P88|( @|``!;{ 8c C 8;a 8` 8|3yApf| FN!A(,@L88|( @|`!;{ 8c C 8app |#yA$d| DN!A(,A\8!p}px!Aa!AaN 8|(p8K`8!p}px!KxcdKe`K,xcdKQ`Kx8|hcDK9`K ARslgGetPassport  " B gN @$RslgSetFunctionPointer|}&`;!1, ,A@.>@a88K `,aA;p8p88FH`xf8,8ap@88 |3.Kp`|`,`@`HE`T~>a.>HA(@8,Ac8!|} N aHA(@K@K|H`T~>K.>K CPsaptet_test_existence_of_task|!|c|HmA(|c8!p}N A0 rstrwriteR|!|cxT>H A(|c8!p}N A4 rstrwriteU|!|c|HA(|c8!p}N A0 rstrreadR|!|cxT>HqA(|c8!p}N A4 rstrreadU|!T>T>KmA(|c8!p}N A0 rstrfreadR|!T>T>KV`|c8!p}N A0 rstrfreadU|!T>T>K-A(|c8!p}N A0 rstrfwriteR|!T>T>K`|c8!p}N A0 rstrfwriteU|!Tc>K`8!p}N A(rstrptc|T>``!q`ax8` K}`,?`@|c8!}N axK.A(8!}N At rstrpteol!q|axK-`Td>8axKU`|c8!}N AHrstrpts|``~!HF`,AX,,Ab p,@h;(,?Ab p, 8Ab p8Ac8a pc8K|`8b pH8 888c8, @ccKӭ``HF!`,A((?bH p8@hc, @$c8!}N 88H5A`c8!}N cc, @KH4`ccK``HEe`,AlKD,@ ;$K,AP,`d@ ;LKx,@ ;dKh@ ;|K\;p8apc8K{`K@;c8!a8apKz`cHA(8!}N AL rstr_sleep8A( L| N @A( L| N HP!8`||#yA@, @, A(,,$@A8`8!pN 8!pN @HR`8!p|`4}T~hN Arstrcaut`hP|aA`T>!`bHp!,8aapxA({x,#AA, @, Ag, ,@A|bx, ,AA${.|P{dcW8zd~";Zd8 KM``t|c8,| @8`@K=A(`v8}8Kq`,c@ zx`||vKM`t8wxe8(x|.K`,8`vA``|{,8| @8`@KA(`t8}8K`8,||@:8xx`|t8`K`;|t88{"|<@|.A8} }HQ`P8!@}!AaN ~Kh8}|xK$1A(`t}K$K8}|xK$A(`v}KTKL8} }HQ5`K@P8!@}!AaN 8} 8eHQ5`8,@K!Aa (088!@N @dHLQ`,:0,Ax@L{, AdK8 A rstrwautbh8 N @rstr_set_auth_delimiter_tabbh8&N @rstr_set_auth_delimiter_defaultbhcN @ rstr_get_auth_delimiterHP!8`||#yA@, @, A(},,$@A8`8!pN 8!pN @HJ`8!p|`4}T~hN Arstrcdb|`a<aA`{`!`8aW!HA(}|`yAP, @, AD}, @, A,,%A 8a`8KQ`8a8K`,?A8a|c8K%`8a|8K`, @D}}, AHIQ`,A\|, @, @8bx, Ah, AtP, AP,A4bp|;yA8a8p8t;8g| GN!A(,@\tbp8|8``!x; f8 C p8x8 f8d&( (!Aa$Dd̛dD$08@ƐHO=`H5`p8x8xf,} (HM`,@x88!p}!AaN 0;8|8````!8c 8 C 9 8 c( d(!t!pKcKm``wKHJ=`,@Kbp8d8cxHK`,@8Kl8a|8pxH,A, A8a|8xH,A|, A8a|8xH,AT, A8a|8$xH,A,, A8a|8`xH,@bh88!p}K xe8a80H,AH`|, Axe8a8lH,A d|, Axe8a8H,Ah|, Apxe8a8H,AЀl|, AHxe8a8 H,@0K8a|8 8KA`KL8a8 8K)`K(0!8A@aHPX`h8!pN (!8A@aHPX`h8!pN A rstrw7db````|aA`H|e!|`yA(ÄP, @,, A}, ,@A,@(A8!}N 8}8K`88}NK`, @H`8x`{bx, AbP, Ac (HI`,8ax8@HG`,,/ d@@\8`A$<H4HEa`,AL8Hp8ap|+yAĀ<ex|pEN!A(pT~$|P{d&cW8zp~DP;Zp8K=`|8~#`t,$`v:| @8`x@ܓ=KA(`p}8zzs~_|pb8TK=`}8wt8}x+.K`|z|8`q`p, 9|@X8`x@$=KA(`n}8z~x`8Xb|nK`|8w8||2K)`||ò|2`w8, `u|@8`x@l=K A(`n}8z}x`8b|nK-`|;{|v|||"88f|;@.@PK(x(}8|xKA(`n}8K8Kx(}8|xKA(`n}8K8Kx(}8|xKA(`p}8K8K8!p}aN bp8f8{ H<`,@8KpP8!p|N h8!pN @DH7`,@48!p}N A rstrw1enqH```abP`||#y!A(A, @0, AȈc,, @A, AH`8x`|bx, ATbP, ADc (H<`,8ax8@$H:`8:,8 8a,f@@K=`8,8:K `xe8a8,Ke`8al8 8K`88K`xe8al8K-`8a8 8 K`88 K`xe88aK`8`aH7`,bp 8@|P|(@d|eP|8@88axH95`8!}aN 8axH9`8!}aK88ap|+yxA,ep|EN!A(pT~b 8|P| @c|dP|8@lK48ax `88HH9`8!}aK(8ax `88|H9e`8!}aKa8!N @``8H!ј A(v|`yA@a7P, @, A@d, ,@\A(bx, Abh, AP, Ap|;yA8a|8p8t:|8g| GN!A(,@t,:SA,:OA ,:C@c7:8u8> ^~0(HPXU`5hpuxu5|```!: 8c C , ( (@8u4H7`H`uv (8x8(H6!`,@x8@8!0}!AaN ,<@8KlcKpI`uKXh:|8| 8a|0````!8 8c C 9 8 ( (!t!pKH2`,At@8!0}!AaN bp8j8c(H3-`,@8bhK!Aa (8!0N @H.9`,A\\|, @Ѐ, A|c|8pxH,A , ATc|8xH,A, A,c|8xH,AЀ, Ac|8$xH,A, Ac|8`xH,AKxec80H,A `|, ATxec8lH,Ad|, A,xec8H,AЀh|, Axec8H,Al|, Axec8 H,@K|!Aa (8!0N A  rstrw1buf|``bPH`!, A(@0|#yA$, AHc,, @AHQ`x, A`|b8pP, A, @c (H2-`8,8ap@H0U`8xx ,,j?@@,@8` 8`@|P|@|(P|8@tH-`,A48@p8a<|+yAe| EN!A(8apH/-`8!}N H-A`,AKЀ| P|(@|P|8@KP8ap `88HH/`8!}K8ap `88H/`8!}KL8!}N 8!N @AH)`,AK؈, AȈc,, @AK A rstrw2buf8`N @rstrcioN @rstrwso_start_openN @rstrwfo_finish_openN @rstrwsc_start_closeN @rstrwfc_finish_closeN @rstrwsa_start_actionN @rstrwfa_finish_action8`N @rstrcitmN @rstrwitm8`N @rstrcmca;`}`aA`!ț``H|H!A, |@, @bxBp, Ap, AbP, @H)`,@D8zH-`8z8 $;:8 Ki`:88 8 KQ`,,A@, 8@c|````!8c ;9 C |````!}; w: C ;8z8 8 K`,,AP`@, 8`@|i``!|; }; C 8z(H) `,A88!}!AaN H|`88!}KxccK`K|cKd``{|`K xc#ccK`bccK`KcKd``x|`K8!}AaN 8z8hH(5`8,@KPc|8xH,A , Ac8|xH,Al$, Ac8\|xH,AD(, Ac8|xH,A,, Ac8|xH,AKp8xH,APc8, |AxH,A(c8, |AxH,Ac8F, |AtxH,A؀c8, |ALxH,@"xT>T> , M HN @$ rstrwr_return|!qaxH!M`,bHAc~, @8!}N ax8888KA8!}N Atrstrwefb__enter_function_block|!axH `,bHAc~, @8!}N 8` `8x888K8!}N Atrstrwlfb__leave_function_blockT>HT>~, M HN @$rstrwcf__called_c_func|``!axH]`,bHAc~, @8!}N 8` `x8KE8!}N Arstrwrf__return_from_c_funcK@ @rstrwefb_enter_function_blockK @rstrwlfb_leave_function_block`888K0 @rstrwcf_called_c_func|c`88KP @rstrwrf_return_from_c_funcK @"rstrwefb_enter_function_block_procK @"rstrwlfb_leave_function_block_proc`888K @rstrwcf_called_c_func_proc|c`88K @rstrwrf_return_from_c_func_procHP!8`||#yA@, @, A(,,$@A8`8!pN 8!pN @H`8!p|`4}T~hN Arstrcrfc|``abPa!HA(|#yAD, @, A,c, ,@A8pbp8t8a|8|;yA$g| GN!A(,A8a|h8| 0````!8 8c C 9 ( (tp8bxh, A,, AtP, AP8'8{&d8 8'', ,L3A&d{&l8{',8 8(K1`88|| 8'8{'`!8 8 C 8|%& ( (Ke`8{&tt'|88 K`aKY`,@0|`x8{&tK`8{&88 KU`aKY`,@|`x8{&Ku`8{&8 8K`8{&8 8 K`8{&$|2x.|(Px$|(P8|2`| 8B@D``!89$|@@@|@@A|P!8C ̀|@@@| @A8aa8gH`,@88a a$a(aa, AcKU`,|`@Lcdlt|KU`, A|`acx8cK`8`DۤH1`,ATbp|+yAD8ap8e| xpEN!A(apT~ax ax,a@8 `x $(,C0xx} @Pxtd}JxM}Jx6d|:|1||"||aH`Tc?@@b8c8`@:(|}  ˡ8!0AaN 8Ka8| 8c````!; 8c C 8`DۤHq`,AK@x8ddcK}`cKSe`, AXK8c8 8(K`cKS9`|`,(@t8| 8d`!; 8c C  ( (Kx8dcK`KTc>@:(|} KLM)JBa8MBB Kta8d e (H`M)JBKLb8|`c (HE`-A@-(,8|,@8-,-0H%`8!}aN cKNU`-0|-,8|,H`8!}aKcKN`,@8@A,|`P8|`8|,x|2K`|-(KD|f8|,xcK`|-(K$8ibp8c,H`8,@P, @Kax8!N @`AH `,bxA, @Hax8!}N d, ,A@AK A rstrw2usrU|T>`aA`aZT`>bH`!Aa;A(8,?Ad|+yAX/$, bP,A@\A8bx, Adb, AP, @H`,@88~ H`aecK~`,:@8cH`8!}AaN ;08`H `,pA8apcD|+yApe| EN!A(pT~KhcH5`8,@TP, @KAa8!N bxA, AKAH -`,AK,A@AKh A writeStatistic|Pp!8nh9 9E6928``bHx8682pccKQ8!}N Adrstrw1_rfc_server|Pp!`hbHh8o9 9@8x99T8898cpcK8!}N Adrstrw1_rfc_server_dest|Pp!8ph9 9EB9?8 ``bHx8B8?pccK8!}N Adrstrw1_rfc_client|Pp!`hbHh8q9 9@8x9F8 8EcpcKq8!}N Adrstrw1_rfc_client_dest|Pp!8xh9 09EQ9L\8 `` bHx8Q8L@pccK8!}N Adrstrw1_http_server|Pp!`hbHh8y9 9@8x9R8 8Rc pcK18!}N Adrstrw1_http_server_dest|Pp!8zh9 9E^9Y 8 `` bHx8^8XpccK8!}N Adrstrw1_http_client|Pp!`hbHh8{9 09@8x9_d88_Hc pcK8!}N Adrstrw1_http_client_destH|!, A@H`,8`A|48T8!}N 8`x8!N Aprstrcusr@AF59_48|`aaAT}>`!`!aP, AH\U`8hp`z`8c؈, A`8cH %`,bp;!pg@ 8ap `8c`c8K+`pd bp# , @b 8p|P|(@@|P|z8 |8~p8| 8````!8c 8 C 8bp8cؘH`8!}!AaN ` |Kd8bp |KT,? `cA@KC`|g `88apc8`cK*M`pd K8ap88cK*)`p$ d , @xKH`,bp8 @d8 8cKE`8 bp8 8c ;|!QA,?|PA(|8@08 |``!8C `x``*;`p@,88`{8@x|0p@8````!T>8| |t|0*8{AT>| |t|*,@d8~,@,8*| ```!8cC x8!}AaN 8 ,#.@ ;,;Ac 8Ki`A48!|} AaN 8~84cEcK`8!|} K8apH ``{Kl;@K8apH ``{8c8l8K`;;K$8appH q`8D cKm`8!}aN |,|T>L @`8`KX C rstrt1print|,,|aA!/'|!QA`@ ,A@\9@9`9;9;;;;` 9 ;@ |<`|90A\8|0@H||jP8|i9` ````!e8C `xc||aCa@\}IB|Pfp@,`!x8T>|B|0|X|t|RAx9H|X|tUH>|2}F,)@,(@D`8K?`8!}!AaN ```8K-`8!}!AaK,A,,AA`,@,88*|i``!8C x`|8!xAa8!N ``8K`8!}!AaK ``8KI`8!}!AaK``8K`8!}!AaK<`Ɩ|90Aci8K<8B@|90Ac8Kx<`Ɔ|90Ac8K\,9'Ac8KH,9Ac8K4,9dAa8K ,9 Aai8K ,9@aZWI>8K9@9`9;;9;;;`9 ;@`K, @88d8 | ````!8cC x8|b xH8cX|(*| N `K<`8!}N `8K<`8!}N |`x8|(|vt|2K9`8!}N |`x80(|(|^t|K`8!}N |`x8H@|(|>t|K`8!}N |`x8`X|(|P|6t|K`8!}N |`x8xp|(|t|KE`8!}N |`8K`8!}N |`8K`8!}N 88e(@8!N @ ,A8|f@`f``8K`8!}N |`8Ku`8!}N A rstrtd2print<<9&B?`|B|R|H@|"L 8N @L rstrtdadd<`|*N @ rstrtdecr_day|p,|,@Dp|@|p|N <|p8^|2|N |p}@@p<|p`A` |p|"N |pN q|@|p|N @ rstrtdhalf<8Q|*N @ rstrtincr_day8x |A|,|A|*A4,L <,`ŽL |*8N <88B@|:,L K @rstrtsub<<9&B?`8|P| P8B@,|H@H8|R,A ,@ N N |*8,@N @K @ rstrtdsubA( L| N !|axbc,,AhAL,axA,HdaxH/=A(8!}N He8!}N axH8!}N HY,dAK Alocaltime_cont!b|A(8c, @x |#yADd| DN!A(`db8cHb8!p}cN 8b8cHab8!p}cK|8!pN A getPPContTime`b;| 8,%!q @p80L*B @0`| (AH8|(L(B@88H ,,AAĀ,,A@t8ap0|(P8(|t||*pH e,#@( b8!}N b8! 8c(}K8app8(H ,#@KK,~@K\8"8!b }K|K~c8(H,#b@h8! }KDAK8b8cK `b@8c(, @b8!}K Alocaltime_cont_old8PH @ ContLoctLocaltimeCont|!qax,,AA,,AX,AaxA,KQaxHa8!}N H8!}N axH8!}N axH8!}N K,AKP Alocaltime_cont_r|`c!a8p8xH,,AAd,,Ad@<x8a|P|t||H-8!}N 8aH 8!}N K,d@K8"8`8!}KKecH8!}N Alocaltime_cont_r_old|y`|}&aN!A(Ahb, Ax,>@b,@H(|3yAp}J.p}}jJyi>$yj.HPykdZyM}^@Py>$}+HP, @y&})R} @P,@8cnC %D|P|8P||HP|pxxx td|}HJ|x dxgdxhM}*Jx M|(Px6dxd|8Pxc&} R|x>$|(P|g|*|@P|8!|dN 8cmC KT``K}|c8!}N AContLoctTmDiff|!8d 8apKA(8apK8!}N AD ContLoct_Init|`aA!aA b!QcA(x.H`c;bB"p|?A8bxB`!8pH`u,8ax8AK88axKi88aK88aKр,@X(, AL8a8,6A8K|g(b888h| HN!A(p|| @x rzd||0PAP|#(@|p||x.@`K;!A(z. ,#fAK;M`sxdx.| P|p|8x| @|1*`p8a| 8y.@`8|A*8x.~1Kux.,8|d)*AlZ(}@SyA`y8<,#x.AD j98P| |2|0*(A98HJN!A(p8dax|$8@8!}Aa!AaN b8! }KKA(,#ЀA,|xd|0Pd|px.|KP8b8!|x.}c8c|)*KN 8 H8b 8 8 8apH}A(Kh Apfclock1|b !88cH dH8!p}N A< init_globals|``!HHݐ~8`8!}N AH pfget5_adjust|`b `8!HyHѐ~ 888`8!}N A` pfinit_clock;|aA!a8! 8x$H < @`|`?@; ;: `!8b H`u8ax8pKˡA(8zIH uH`t8p8aKˁA(88axH V>V>|@||| PTf>|e"8@0x>Hx.xW>|P|`"|38x||t|`|#@Ts>Hi`u8ax8pKA(8zIHHI`t8p8aKA(88axH IV>V>|@||| PTf>|e"8@|x>Hx.xVu>|P|`"|38x||t|`|3ATu>H`t8ax8pKQA(8zIH%H`s8a8pK1A(88axHV>Ve> |||@|0PTh>8|e28@x>Hx.x|P|`*|C8x||t||5@bT>`8|T(@`H`u8ax8pKɁA(8zIHUH`t8a8pKaA(88axH;|@@|P|8|cP|`p|c(8|dx| P|@+A@ `bA@8 8c`|T(@L8!}a!AaN 8!}aKbc8!}aK|P|cPKK|(Px>HK@|(Px>HK|(Px>HK A 4 adjust_clock;|8!qx$```!H`}H HHHHHHHHHHHHHHHHHHH|@ 8|P@|P|c8(@\T>{ ;x ||c|8|*(?T>AX(8`AT~8!}N c;W>(?@K(@K A,clock_null_time|` ;!q~H(@4H~ 8`8!}N ~H~ 8`8!}N A pfset_adjust| !, @ K݀8!}N x8!N ALpfget2_clks_per_mu10|!Ku8c<`| T8!p}N A4pfget1_clks_per_mub !|, Ac8!pN Kb 8!p}cN ADpfget4_clk_null_time10|!Ku8c<`| T8!p}N A4pfget3_clk_null_time 8`N @pfget6_adjust10 |~(!,#A(A8c| CN!A(Tc>8!}N 8 @8xH`d~(8H~(c| CN!A(K Apfclock|!Q8ax8pKA(8p8a;`!K±A(;8a8p(?A8aK‘A(8ax8H<b8!8M}|cTcѾN Adelay_of_gettimeofday|`!a8p8axKA(8p``!8aKA(88axH]8p|@@8!}N Ah delay_usec=8B@|@9&x6dT>@XU&>xȢ|8Px˃x.} @Pxtd|"|PP|JxM}'BxMx6d|c P|2|P|c|T>N yCx6dyF|8P|fPx.yFtd|@P|c2yHM|BxMyC6d|8P||P|d|T>N @ timeval_diff8b(N @ PfGetSapClock||!aaxcK`~axKL`a @,#AK=`,@$;@c8!}N a @8K` @,cA4x8g80KU`c8!}KK8!}K APfGetDefClockOrEnv|!q8p8axK A(xxx|Pxt|f:xM|"x6|f|*T>8!}N A`pfclock2N @ PfDebugClock|``!a8p8axK=A(xa~8!}N ATpfclock38`N @PfClock2Interval @,!,|@(8@(8eK8`8!p}N (AK8`K`df(8eK8`8!p}N A| PfSetClockb |c0,#!A(A4c| CN!A(Tc>8!}N 8 @8Ka`d e08Ke0c| CN!A(K APfStatisticClock8` 8(0|$@M 8`N @ PfGetStatisticClock @,!,|@(8@08ehK8`8!p}N 0AK8`K `df08ehK8`8!p}N A|PfSetStatisticClock`, |8!q,A(AA,,Ah8`A 8!}N 8`K5c| CN!A(Tc>8!}N KY8!}N }8c| CN!A(Tc>8!}N 8 @8~xK`d}88~Ka,AK A0PfRuntimeClock|!,,A| ,AdA,d8`db @8cK8`8!p}N 8`K``d @e88fK8`8!p}N 8b@d8K8`K d8K APfSetRuntimeClock8` 8(8|$@M 8`N @ PfGetRuntimeClock,,A8`AN HHK @ PfIntervalSize|!Kb c8!p}N A(PfClock1Interval|c`8H4 @PfTime|``|c!KA(? @|;,%@,88`8!}N |(@ 8|P@$|P|88`K8`K,%AK APfTime2|@ 8 @| P@,|P|d8T>|(@L 8`N T>| @L K @P pfclock_diff|!8 8apHA(8ap8 HA(txxdxd|Px$|g0Px|"xd|g0Px|Pxtd|g0Px]$|"xM}|8!|d*N A pfnanoclockb X @d|`|PxB|"xBN @(PfNanoClockInterval8`N @PfNanoClockResolution (A( L| N  0A( L| N  xA( L| N T`?8`M `8HLN @saptep_test_exist_of_process|T>8|c!HA(,,d8|48TA @(H@8`xc 8!}N c8!xc }K A"saptep_test_exist_of_process@AF2_1 A( L| N  A( L| N `T>|aA!!aK`,>@; 8}XKsA(H-A(,@,9A8xcH `cK`8} 8tK%` ~,#A$8cKE`8`KAA(|p8~K `~Kc8cH`K`88pHA(`e|A ,AD8} 8K`8!}!AaN b 8cK)` ~,#A48cKi`8!}!AaK8~K`~8cK)`K cK``}8~K`,=A8,#A0aXK)`,A;ah`z8ah8XK`;,L@$88ah|x|"., @#.; xa8ah8 K`,#A;a8 8```!8c{T>|;{K`8 8,#@88x|cx$88 9*KA`|A88 XcE8}K`K;@K A8sapsbgp_start_background_proces A( L| N ,#8@8`N HD @ vexeclU16!|a8!AK|c8!p}N AHexeclU!|a8!AK|c8!p}N AHexeclU16|``aA!|`y!Q `?A,$8pA`8c899>9^ KY`c;`;\;?h````!Kq`xedc(Pc!88y99>,9^8|j8apy;9K`88`c|=@A;{;,@A;Z,=c@||8x$|Bp8c,=L@X88p|!j;p88pc|1*HA(!!Aa}N 8`, A(````!88c, @8c;`|c; xc$|cxc|j;pc;Ah```!K`xedc|c(P 8x|j8apz;ZK=`;{|#@A\;,=c@c8xf$8p8pc|1*HA(!!AaK8`!!AaK8~@88Tc8K&`8`!!AaK88`!N a< vexecleU16!|a8!AKq|c8!p}N AHexecleU!|a8!AK|c8!p}N AH execleU16`|aA`!|`y!Q`?@,$;A\ c;`;Z;?h;```!K1`xedc(Pc!88y99<,9\8|j8apy;9K`|>@8A;{,@Al;Z,>c@|8xf$8p|2cpH A(!!Aa}N 8|@88Tc8K$-`8`!!AaK8`!!AaK8c8pcpH QA(!A}N ;p 8p`8899F 9&hK]`,>AK8 a vexeclpU16!|a8!AK|c8!p}N AHexeclpU!|a8!AK|c8!p}N AH execlpU16H @execvU|`;aA!|`y!Q`?@,<ALc8;`8, A(```!8c`8, @c8|x$|x|!j;Ah;!p````!Kρ`xedc|c(P 8x|j8apz;ZK`8;{|#@Ad;,<c@d8x$cc$|)*H A(!!Aa}N 8`!!AaK88c8p|)*H %A(!}N ;p 8p`889|9F 9&K `,<AK< aexecvU16H@ @execveU|``aA!|`y!Q`?@;d,;A8c;@8, A `!8c`8, @cc8|x$|x|!j;!h;p````!K`xedcd|c(P 8x|j8apy;9KM`8;Z|#@A\|;,;cc@8Dx$|*,<APc8;`8, A$``!8c`8, @c8|x$|x|!j;Ah;!p````!K`xedc|c(P 8x|j8apz;ZK]`8;{|#@Al;,<c@d8x$ccc%|1*HA(!!Aa}N 8`!!AaK88c8pc|1*HYA(!!AaKa8a8`;p|*,<AKH;p 8p`8869p9F 9&Ke`|,;AK a4 execveU16H@ @execvpU|`;aA!|`y!Q`?@,<ALc8;`8, A(```!8c`8, @c8|x$|x|!j;Ah;!p````!Ka`xedc|c(P 8x|j8apz;ZK`8;{|#@Ad;,<c@d8x$cc$|)*HQA(!!Aa}N 8`!!AaK88c8p|)*HA(!}N ;p 8p`88P9\9F 9&hK`,<AK< a execvpU16||#y`daA`! !Q`?A88pc8m9 9=9] KA`;c;`;Z;?h;````!KQ`xedc(Pc!8}8y9 9=,9]8|j8apy;9K`|>@8A;{,@Ah;Z,>c@|8px$8p|pHMA(!!Aa}N 8}@8 8Tc8KQ`8`!!AaK8`!!AaK88`!AN avexeclU16@AF16_1 A( L| N  A( L| N  A( L| N  A( L| N 8` |aA!!Q, A8!N 8~hKt`8 8Ka``{8~Kt`8 8KA`8 `|88pp}H`8~KtQ`,#@|ryc#H=A(b @\{,A,,@8`L1A08!}!AaN 8~K`8}E,#A0K-`8`8!}!AaK8},K}`8}EK`8`8!}!AaKd8`8!}!AaK<,b H,/ @ @K8 Pc#r8H<]A(\{K88pH!`r,@t8}8pH`ryc#H< A(b @\{,@\KT Asapescsa_existsaABX|z8!,#@ ؈, A8 X, AL8`| @A@b 88cK`zPA8!@}N 8|4Kq`88 K=``db @8cH; A(8|#@Ax h8zT>9(| @ 8`N H| @( reallocbuf|``8!qKu,8`@(88H8`8!}N A copytobuffer|8c !, /,@A,,A/A;; Ax;;APH"I`T`>, p@ 8!}N 8!}N ;H!`T`>, p@KK;;@K;;K|;;Kp,//@;;KTA;;@K@@K8 A$ getLengthType|``!qH``}c,AKe|` AlAHA$8!}N 8!}N 8!}N 8!}N AgetCount|}&aA``!`T>!-a8`@KܥA(,#AL8`y8K``}HA(,;-8pcA ,;+;`AAp;@a8pK88@,,A<@8aKA(8`|%@A8` 8!|} !AaN K8HA(a@Kd@\8" 8@0$@\,|@ALP@K88H}A(a@,K8" 8@@@,|@A P@ K>K8HA(a@Kc#KQA(8` 8!|!A} aN 8dNy!8`@t!axK{%!:t!; xA;.;:0.````!8ap8,%0A,%9A`8x8t8pKe,@dAt||@@a8pH`,A(apKI`,Aa8pH`8aK$aKA(8` 8!|} K 4T~|9A0,7eA ,7E@ ,%-A ,%+@;`K(,9A$,%eA ,%E@; :`K,6AP|<(@H:`KaApH`,AK ;`K8` Aa8!|} N "C  getFloating|}&aA``!`T>`U>aA!a8`@KuA(|yy8;A@:8}::::`KA``r8} Hq`,<0pT`>,pLFAH:pa8pHa`,Aa8pp, X,xLFAH5`8!8`@!tax`!,p:/ +, -A@.:,7A4_A -,0A ,@Ah@ ;@ :A, 9,/ 7A OFAa8pH`ta, 8p,A @@, +,-LFBA,Ha`,8} AH-`T`>, pA,8A8aa,-, A@, +LFBA, A(cK5`a.8EA,HIA(`ta|#@AW>| ,$@A@haK 9A(8`0*8! |} Aa!AaN @aKAaKaK|@~aKl@~aK\A~aKL~aK@K uA(8`0*8! |} KH`,:p,A$,0@$K,0@K@KH`,pA pKp80pKd80pKX8`08! }!AaN C getNumberT`>T>T>|@A |@@ |@A8`AN 8`N 8`N @@ isBetween|}&aA``!``;;`a!a8dK``z>, ^@c#;9>NBc3, ]@c#;9>, Ad, ]@p8}3@;|P:|t:-~:bf8@b````!xp8h9,-|$A@,],%@|8|'@Az|`|#@@H@08{T{>, @;p;A|a@8pH%`,@H,;@`8`8|8!} a!AaN , A$8`8|K8`8|Kt,;APKa8pH M`,A,KlAK8paH)`K8{T{>, AK, LFAhK,@8|'@@pK,A|&@@@Kl, LB3BAh,#]A@K8`a8!|} !AaN , -@TK@Nc3, ]A0K C | getCharClass|}&aA``!``;`;@!1; a8dKi``xp.;````!ap, A;9@,A`a8pH y`,AapK`,A,@8paH E`, @,@]8!|!} AaN ,;A, @K8paH `Ka|8p@H `,AK8;9~;;@,A`K C getString|`|``a!qH5`( c48T08!}N ApFormattedInputCtor|!H`8!p}N A$FormattedInputXtor`;|}&aA!;;b ( !;cxd,#,%A@, %@8xdK}a`,A4ax8xc,#A4``!K}1`,axA8xc,#@c8pKc8pH U`ax, ,%A@, %@8x, AcH`,Aax8xKc8pH`,Apax| @c8xKc8pH`,@` |8!} !AaN ,8`@`|c |K,%@,8aH E`x8a8(8xHI`,A|d8a, xx|@8;@xH `Ty>(8(,9nA8,9[A ,9c@c8pH`cHI`,@$c8T8|{*(A<|iN pc8cK,:A,@ c;,.A\8aH `@ xK ,<@ |KlcH`|`4T~h||KK. Kpc8c8Ki,:~A\c;KPpc8c89 KT`>,:A. A8aH `K(pc8c89KT`>,:AdKc8cK8aH `xKpc8c89KT`>,:AKppc8c89KYT`>,:AKDpc8c8KQ,:~ADc;K8pc8c89 KT`>,:AK,9F/9A,GA(,EL3LFA8aH `xK ,9X/9[AA8@@pc8c8xK T`>,:. AKtc8pKMKcxH}`Ty>cK@tKTax, K CFormattedInput_input|```!qx(x|KġA(,#@8`8!}HDccKĵ`c|KQA(8`8!}N Areallocbuf@AF16_48 N @ InputStreamCtorN @InputStreamXtor`|,|8!AH,@ 88!}N 8!8}KKFQ`,|c@K A"InputStream_readSingleCharFromFile88,$A8`N 8`N @<$InputStream_readSingleCharFromString|`e`!H,@X`, A(K|``8!}N K)|`8!`}K8`8!}N AInputStream_readSingleChar|48TN @InputStream_EOF, L HN @InputStream_unreadSingleCharcN @InputStream_successfullyRead|`c!, 8ALdxe%@THA(88c8!}N 8cx8!N x8!N A"InputStream_unreadSingleChar@AF9_7 A( L| N 8N @InputConversionSpecCtorN @InputConversionSpecXtorTd>8`88((AN 8@,$a(@/$i,A@$,$sA,uA,$xLFAH/$XA,[L3LFA8`N @#InputConversionSpec_isValidSymbol__|!`f`T>K),@8!p}N A8InputConversionSpec_setSymbolcN @InputConversionSpec_getSymbol A( L| N  A( L| N  A( L| N  A( L| N |`8c8!K`8K`8 K`c8!}N AXInputConversionCtor|`8c!K̉`8K}`8 Kq`8!}N ALInputConversionXtor|``a;8;;`!a|28c, *@|2.8( @T,&*/&jAH,&lA(,&L,hL3OFӂA8(@88f((L)Ap/a,&iA,&A,X/&[L3OFӂOAH 0T>c8h8Ky`8`8!}aN 8 `K`88!|c}K,s/&u/xL3OFӂOAKt{`8|K`{c|.8(@K,t/&zL3OFӂAKKʱ`{c|.,&l/&jAK;|.c;`8( @Kl AInputConversion_parse 8A( L| N  `A( L| N T>aA! x|}&aA~!A8,A@;b ;MA, A;@p8a8 8@K`8a 8 cF8dKkm`8a8p8K`8a88 K`b A(, A{,# @bX`,%A, A8a8d8 Kj`8a88 K]`8`i88K)`c8|8!} Aa!AaN 8a8|8 K`Kxb X|+yA8`|#(@AK,8K`K,<@|, A{,# @88`i88KE`c8|K8K`8`i88K`K8`KM`, A{,# @88`i88K`c8|K8K`8`i88Ky`K; MBB 8xPK2`88 KV``w8xlK2`88 KVm``z8xK2`88 KVM`|rp~88pK`8xK2e`,#@r~bVbKA( @,ut,@L1A,rbb` KA(u|e,A;,?N@x`bD8KyA( X8|#@AXA`eb88{Kf`8atH`L@(8|@,>A$@ ;,>AKc`8a8p8 Kq`8\8a88/K`b , Ad8i 8` |i8d8 ```!; 8c C 80b @8cHA(8 X8 @ .8`A8X|8!} N 8a @ 8Ka`8aK`b x8`fcc,#A(K `8`@8`|K8f,Ke`c x8fK`K8`i c8 K`8b @80cHA(8 X8 @ .8`AXK8a 8Km`8/ 8a8KU`b , A`K Csapdscsa_destroy@AF3_2|`!8apKA(8apKN`,dA <280808T>,d@T||p|*x$x|280|8P|808T||p|*808T||p|2x$x|*| P80 T||p|*80 T||p|2x$x|*| P80T||p|*80T||p|2x$x|*| P80T||p|*80T||p|2x$x|*| P80T||p|*<080c80Td||p|"x$x||`P80K<189K AP rslgtstamp A( L| N  A( L| N |`!!89A9!9a`|x88p88H,a@HH<x,H|}y  A(,A`H%A(8 aK˭`}`~H%A(,cAp88, AHq,A4c8!x&}N 8`8!} KHU8`8!}N b 8cK# `8 ,#At,%0,7A8A8c`,7,&0A4```!T88A8c|x,7,&0@b x K`K8 8`8!}K88!8`}N A rstrbopen|``aA`a 8a;!a;@8d9d0f0e ,iA ,%s@P8@c ;,i@(```!c ;,iA,%sAcKx `,#r@,Aؠ, +@X, @L8`88}cC8!}AaN ,#a@h,@$8`88}{K@8, +@,, @ 8`8}|{Kl;@Kd88cC8!}KH,#w@\,@$8`88}|K@,, +@0, @$8`88}K,#a@XK,s@d,$y@,;`c;,i@$K,$u@(A,$r@A,$nLFA ;K;@K Arstrboo_open_options|!,$T>AL, A,|xxd`8!p}N xxdK8`@KA(|dyA`K8`8!p}N Arstrbacb_allocate_control_block|`,$!A4< xx6p8FB!q|@,A,#@ (8|c P||dT}>|}|||AH|}|||@$AxKd8` 8!} |N H`,8A 8H*YA(,AKl8`8!|} N 88`x8!} N 8KD c8@8d8\H`8 8`8!} |N C rstrbseek|`!A89A99!ax`8p888K(@~K-A( ,AH`HA(8 aK`~HA(,A~8<(xcxcFx8xFh4 ~<x.x` `~~xx><x,K|y A88(, A\K,cA(8!x&}N 8`8!} K؈8!x&}K8 8`8!}K8 8`8!}Kx88`8!}KX A rstrbdopen|`~<`LI;8FB!~|@``8FB!a``8`|@,r8!p}N A0rstrbsa_store_addr|!`eH0 @4rstrbsc_self_check|,;`!@h8pcH=A(,A(c@8!0}N ;@8!0c}K8` (8!0N Arstrbsc_self_check@AF27_26| !`e8@8d8\Ha`8 8`8!p}N AHrstrbfn_fileno@AF28_21| !`e8@8d8\H`8` d8!p}N ADrstrberrno@AF29_20| !`e8@8d8\Ha`8 8`8!p}N AHrstrbeof@AF30_19| !`e8@8d8\H`8 8`8!p}N AHrstrbtell@AF31_14 A( L| N |`<`LI8FB!|@,<8`8!}N |8` 8!}KԀ8`8! }KH A(8,#A,6K]A(,AKD8`8! }K` c8@8d|8HY8 8!8`}N A rstrbfl_flush|}&aA``!`aA!xp``!` 8A(K0`8 cc8,K0e`p;,@ ;`{a; @W:8a|a:|d|"c: ~:`%:@..-8ap8 8#K-`8ap b8PK0`;9}AL 8~8a~ :!~8`````!:K0i`:8q:18`|6@A|b|Pb;e8|8~Kڅ`:8w|~޺da| DN!A(,A,/%@ :q9,LLBA :,LLBA9,LLBAD:,LLBAಯ9,LLBA|:/LLBA:LLCBA8p8|8Kٙ`8 8p8lK.A`|9@A<8 8tK.%`8K)A(pj8!`|px} !Aa!AaN |~rda| DN!A(,A,/%@:qKQK|~rdb| DN!A(,A,0%@:/oKOK|~r#db#| DN!A(,A0,1%@T9pKHPK@|~r#db#| DN!A(,A/,1%@:oKOK|~r#db#| DN!A(,A0,1%@9pKPKx|~r#db#| DN!A(,A/,1%@(:oKOK|~r#db#| DN!A(,A0,1%@9pKPKQK|8a~ 8`K,I`8a 8`K,1`8a 8`K,`8a 8`K,`8a 8`K+`8a 8`K+`8a 8`K+`8a 8`K+`:!;{8a8|8K`:K`W:8a |: : :%:.~`.-````!8ap8 8#KՅ`q8ap b%8PK+ `;9}@0~^| 8a~8`K*`8a 8`K*`8a 8`K*`8a 8`K*`8a 8`K*`8a 8`K*i`8a 8`K*Q`8a8`K*=`;{8|8a8Kԅ`:c|wd`r| DN!A(,AA,2%@ ::0,LLBA:,LLBA<:0,LLBAԲ:,LLBAl:0,LLBA:LLBA:PLLCBA<8r8|8Kӥ`88p8lK(Q`|9@@K`|~#db#| DN!A(,A0,1%@:PKK|`|~CdbC| DN!A(,AQ,2%@,:K K`|~CdbC| DN!A(,AP,2%@:0KK`|~CdbC| DN!A(,AQ,2%@`:KTKL`|~CdbC| DN!A(,AP,2%@:0K첐K`|~CdbC| DN!A(,AQ,2%@:KK|`|~CdbC| DN!A(,AP,2%@(:0KKK|Pbc~;d8|8K`:K C D rstr_prbin|`~H< @ getpwuidU|Tc>!HA(|~yA 8,$@$P,$@8b X`d,$@,8b h ,$@8b p(,$A8 87 8hW@;W@9d9&9FKT`8(#|@A, A$8!8dP}xN 8`8!}N 8 8!8dP}xK8 8/ 8hO@;O@9d9&|9FKS`8 (#|@LFAp(,$AK 8 8& 8hG@;G@9d9&\9FlKS`8 (#|@LFA,h ,$AKT8 8 8h?@;?@9d9&<9FLKSI`8 (#|@LFAX`~dd,$A KD8 88h7@;7@9d9&09F KR`8 (#|@ApAlP,$AKD A getpwuidU16||H8 @ gethostbyaddrU|!||HA(,#@8`8!p}HHI8!p}N ALgethostbyaddrU16`|aA !8!Q,$@ 08|#yA 88~@8s`;; 0,$A`;``;@;>@99)9J`!KQ!`; |#@;{(``A8yA<;,@;9`988s9$A9J|#yA|*,$@x$88|~ 8,A$;; 8;`|#yAxc;^08c0,$A``!K``8\;{T>;{&|;Z|g,@|:At8f0|#yA|*,$@x$8|8!8~ 0}!Aa @ 8 o@9)T9JD```!KGQ` 8|#@;{( ``A<;8y@A0<;,@;9@`98 89$TA9JD|*,$@8|x$|~* ,$A`; 8~8899&x9F KF`(#8|@A8~A(8! }K88~8!}( Kdb 8`e`f8c88Kve`8`8!}!AaK,8c ,$AK ; 8~8 899&89FDKE`(# 8|@AA,$AKc8HA(|yAK AgetservbyportU16|`~`aT>!Q,,Ax8x@Lc, @H%A(xcK A(`}xd8dKTA(`| 88:c99&9FKD`8|#@b XA<xHA(8`8!}aN ccKmA(8`8!}aKHYA(xcKAA(8 c8L`99F9&KC`|#@x8|@b XLFAH!A(K@8`8!}aK!8ap`8KH`8a88KH`c8pKY` 8!}N Alwrupdown| !`e`8p8`bptK18!}N ADrslgwrup| !`e`8p8`c ptK8!}N ADrslgwdd_daemon_down| !`e`8p8`dptK18!}N ADrslgwdp_daemon_problem A( L| N T>T>|P| (A808`N 8:8`N @4sub9T>T>|P| (A808`N 868`N @4sub5TxT T>U>} *U&>|ZTx9T } }f|:}+PP}HP=`ff9,89Kfg|}g|}Z|(P8|0AKe|8~T>K|8~T>K5pi8~ 8@ <0|90|x@L|8|:x@8|8|:x@$  |8|:x@|:x,80@L 8~x |k8!T} -N K,apx}a@;8aptx!|A|*x|2x|#x|Bx}%Rx|#x|+yA````!H`8ap;tx|*x|:x||3x|*x|Bx|x|+y@{ 8~||t|*x$xx|2|P80 ||t|:x$xx|2| P80||t}Byy$y|*|8P80||t|"xx$x|:|@P80||t|*x$x|| P80K8aH`Kxcc`K Arslgtsub|`~`aA`<08c80!A, +@XK|8~T>K|8~T>K}|8~T>K8pi8~@$ ]h0|Bx|Rx};x|yAX K<<` 8D ; Te> c? Th$W80TX(W(4}JZT@.}`PW:UP*T8U(4T<}KPPT 6}l}PU8|:9k@|28 } B|}f9)|"|J||*||2||*"8, A `!H`c;|<@A8!}AaN 8!    }N 8p8+ccpxpHy`8!}N A rslgtdsub }&#L2B<0 ,&3A,&2/'0@H/9.2NӂNNޱA0A81  ,%1A@,$9@$80`8 } N 8 } N ,$2@,$9@d80,$9@<,$9@8K8 } N 8 } N 8 } N ,$9@\K8,%9@$80 8 } N 8 } N /2OAH/%8@@T8@8T<}:|B8p@/ 0, 0A@ ,0L0BAtK@,)0OBBAK,%1/0Ad,&2/'0@/4.6N޳AH/9.1A<@`/1A0KT B0 rslgtincr_day # ,$0CcAT,%0A,8cC# N 898cCK,%1,0@`,)0/)1AA8 T >,)6,4@8380KA,)9A,)183A,*081@`,)2x$@Tx,0/'0||28p@8289A<@$,&0@82c88C#  N ,&0@AK,*1ALKl9 99J8380K,&0,0@X9 29@1@@89,'0A8T>K89,(0@9k99K8T>K8T>KAK,%0AtKH @ rslgtdecr_day88|8|"T>|2,( @8`N 8`N @<add988|8|"T>|2,(@8`N 8`N @<add5T>T>|T>x$xU>U(>|*|:|UH9Efg,TA<||p|*x$x} 280| 8Pa|80N U |P|p|x$x|280|HPa|80N @add23|``~`8c!1, +@dK|8~T>KA|8~T>Kɠ|8~T>KTi>8~8 KQ8(8x8pc AKY`8 c8x8pxKR`ax8x, A0c``!K`cx8x, @8!}N cxKR1`ax8x, AK88+cK `8!}N A rslgtdadd|`Cc 8!A9!|9x8t88p8atAax|KP`p8a tT }I|txUI||Jx|pAt}+}GU*}Ry } pAx}+}HU*|R| pA|}IK=`a8!}N A rslgtdhalf`T~>` |?8}!qKe`,>,@ @ 8888 |&8f|A@88e|@d,#AP;``!K`|~Atc~;K!-`,A4~,#@8`8!}N 8`8!}KK `;|ec`K `,AKb 8c,#AxK(8K `,>,AAK A RelCompare|`,aA`~;!AA(@dKA`8(#;``#,;An@``!|c.d| DN!A(z;Z;;{K`| @@ (Ax8`,|dp@<8ap ?8K `,8apAD8K }`,A08`8!}AaN 8`8!}AaK԰p@Kp ApIsVersionRequested|`,a`!AA(@;dK`;(#;an@``!|c.d| DN!A({;{;;KI`| @@ (Ax 88ap|*<8pK `,@,8`8!}aN 88!|48T}K8 8ap`%<8pK `,@K A`IsLoadDbRequested|c8H8 @ RelPrint|}&a`|~`}c`!AKE,AccceKT~>,@.@0;8`(=@||dx|v|}9A88ap8K `8apKu`8ap <8K*}`,#A|H8`KaA(|pH A, RelPrint2Tc>|H8 @ RelPrintNewNoExit|;|p`!8a899A888Aax8a9aa8a8apc9 aHb ?8|xK`cH`d8|Ku`8|Ki`8|KY`8|<KI`a,#@ |#yA, @8|$8xK`8|K`8|K`8|,K`cH=8|tK`8|K`8|K߽`8|K߱`8|H;, A0```!K߁`8|H;|*,$@a|`yA, @8|KE`8|, A(`!K!`8|;|*,$@, @$08! }N 8|K`cH08! }K8|Kޕ`8|;, A,````!Ka`8|;|*,$@K8|K9`K8K)`,A8aK`,A8|K`Kaxc89 pHMK AlRelPrint2NoExit|``aA`a!a9aX``w!!hP|xy@:,6@,<A0b >8v:K`|`t8vxуA`|,>b 8``dA,?8BA,;!q?8}, AK`K`d8}K٩`8}Kٝ`,<,A4`!AL88}T>Kq`;,<,@8!}N 8},K1`8`K%`d8}K`8}`K `Kpx8!N APrintPatchInfob cN @ RelSrcProtectb cN @ RelForCustomers`aA!|#y|8!Q@,A; ||c8cAc```!H p`@H;;(c(> SA8!}!AaN ;HcL;((> S@KcC````!H p`@ ;;{(cC(> S@tK܀L;{(;cC(> S@PK; |~Ac8```!H p`@<;;(c(= SA!x8!}N H;(;c(= S@Kc8c```!H c;(= SA8!}K,A,K A( GetPatchLevel|;|~ SaA`!|;8c @`;`!A8~;FH?'b```!Hp`c@(;;9  S|8(? SA,=AH`,yA{f6d @{`E{c$|P||c,$|Al;FHc@`;c```!H ;,?;Z;(,A(;8~(A,;(c, AA{d$b @88!|"8cP}!AaPN ;8ycH a;;  S;Z;9|c,( S8L#B@K A GetPatchTextsAndNumber|aK;a ```d!Q8`( !pax``8K8!}N AlRelInfo |!, A  |8!}N H`,# AԠ,$A8cH]|c8!}N Aget_sapreleaseno|ࠣ a8!a?8ap8pA(ptvK`,At8ap8K`,ADprat88( ( L!Ad| DN!A(,W80atAW(4WP*|(PW(4W:|PW8|:?|281:d| DN!A(T|>,XAxT`x,<0Tc ,9A<|8/A0|~8!}|"|N 8`8!}aN `{,A,<0,AA 81,<9A|~||KT`xA,,<IA$`T` 8/@|d||*|K|,<JA ,<R@<8/,Tc |,<Z,S|~|"@c`K8c!08@Kn`cKa0cKK``f8a80Kq`8a@8K޽``f8a88@Kq`8a0888899 H`,@ w,|@w0||`8|||4TA8cK`gcK: :A`j8@x`:@8a@884`:wap:7P!Ks`8D:@!x8888088a@t8A8pK݉`a<(<8ap<,(<<8(9<8h8|ȑ8888*H!`,@Ap8ap8H`,,@A@|8 8ap8pH`|@|@8a808cKl1`cKea8cKYKU``f8a88Ko=`8a@8KM``f8a88@Ko`8a0889889 pHq`c8!}!Aa!AaN 8`KcA(a8aK`8X #8l8C8aK`cKI`g8!8a888A9 9 pbjx8@KY`8:8! A*;V8a8 'ARK`a8c&;j8a f8 K`8a0988 z889 hH`|`4T~K8`8!}!AaKL8V;aj 8a88 K``|8a88 K``{K|Kh ANotifyPatchHistory| (8@!K9`8p`~ 08exc$|P. ,@, 0x| (08@HPX`hp``!|8cC 8`8888 ,>xdx$8 XA 08b88X@8!b 0}K A db_describe|!xK, @8`8!}H4`gax (8 8 8XKu`8`8!}N Ah DbSlControl8`N @db_dsql28`N @db_rtab0|8p|c!KkA(8` X8;KpM`8 8b Ȉ,&AHP8ap8;K%`8`8KkmA(HiA(8p8`Ko``8!P}N A catch_SIGINT|8!|cKjA(8` X8HKoY`8b 8 X 8tc,#A 8!p}N Al catch_SIGALRM|8X|c!Kj=A(8` X8<; X8,|c@8T8}Ky`NKTK)A(,8A , X8aA|8HK!`88`Kj`8` X8Kj`N~,#A8c8bK=`K8~K`~8c8bK`K8` X8Kj`aK`,@aK}`8Fb X88c K7`~,#A8IcK`KH8~K`~8IcK`K$ X8a,,c8A@K`8,8`Ki`~,#A@8GceK%`8aNB X8K`88`Ki}`K8~Km`~8GceK`K8AxK0@K48} X8dKi`NKDaK5`8b X8F8cK6}`~,#A8HcKa`K,8~K`~8HcK=`KH-``e8a X88`c8F8pKdi`{c|8K9QA(c8pKd`8`F8pKc`cKMA(8apKc`@d8!|Aa} N Crslgsm1_write_pid_file xA( L| N | !a8,K{`axKˑ`8;@|cx~8||;|c,xAXKi`8c8+|.Kե`,#A808!}N 88@Ka`c;8||;|8K`8c8+|.K-`,#AK A tracefilenameb 8@8888 8(d  N @4getlocalbuffer88b@(@ N N @$reserve_slot_in_file8@!|, @X 8@8d | P,A8!pN |H`88b@8!p}N 8!pN Axclear_rest_of_buffer`;;@8|}!qKn`9l 8p}88 8Ko`8} 88p@ @cH `8 8P88e;$(04< (DLT\^K`,A88} 8!}` 8p N c88 K`T`Ǿ 8!a`}d 8p Kc8H `8 8P88e;$(04< (DLT\^K`,A$x&|P|0P,% @@8x>$x&|0P| (@8b@c,#A8@, A8@8 KX`,@8b@8c|K`b 88cK`8b@cK``88b@K8b@c,#A08cK`8!}N 8b@8cDK%`8@dKcK8b@cKv`,@8b@8c|K`b 88cK`8b@cK``88b@K8b@c,#Ah8cK`8b@(, A(8bL88@ d (|P, p8(Ac8| ```!8 8c C 88@%E#C ( (d ,&8p A8b@, @8Pd8K8c8H8Pd8Kb 88c@Km`8!}N 8b@8cDK!`8@dKcKKK8b@cK88b@ KK8b@8c|K`axKsA(b 88cK`K8b@c,#A(8cK`8b@(, AK8b@8cDKQ`8@dKK}8b@(, A K A rstrw1_write;@|!, A|T> , A\, APK,?,A,A~  8!}N K,?AKpx8!N p8!N A i_rstrf_flushN @ rstr_control8`8K @ rstrf_flush8b@8N @rstrfn_flush_next8;@|!, @(( @(HK 8 , A!|xT>0|#xA8,A8 0,$R,D/$SA@h,$VAD8@$c8!8}N 8!}N 88!}N ,$LA$88`@8!}Kc8!8}K88!}N 8 K9`b 8!} K@8K`b ,AK Arstrf2_fill_entry|}&aATk>`!a<`aaY`T>!ad8a`K8(||||,(|8a8(|*8(;|*@(8<8 T|(|*|.p|B;,:.--:@~&~ @L,$AD88| 8;8c;{T>|,~&~ @C @,$8A8;T>8cF|B@H````!8.T>8c|;Z8@,;8C 8c;ZT>.|@,$8At8;T>8c&|B@<`!8-T>8c|;98@,;8C 8c;9T>-|@,$8A8;T>b8|B@<`!8-T>8c|:8@,;8C 8c:T>-|,$A 8c|``!8cC 8aK `~ A LQKLMBA(;8a~ 8?8?8?@K8L, @L8!|} !AaN ;8aK `88a8Ku`9bP8`8p88x8 99 9@k8 K8!|} KP;8a8?8?8?K C H rstrw2_write|;!,#@(K@IA(Tc>8!}N x8!N APsaptid_task_id |T~>!, @0cKUA(HMA(8!}N |e 8K`8KLA(K A|wait_for_interrupt|8!|cKLA(b , A 8Fb 88c\K`8!p}N AXrslgdcc_catch_clock A( L| N  A( L| N  A( L| N  A( L| N  A( L| N |!|cHA(8!p}N A(select`~`|p}&.!a.88 x$|Px@8| ````!|8cC 8a |8 x8xcdx$8  }8a 8@8a 8@xc$| P x              |````!|8cC 8a@|8@x@xcdx$8@}8a@8@(8a@8`xc$| P@x@@@@@@@@@@@@@@|`!|8cC 8a`|8`x`xcdx$8`}{b {т8x$|"c|6,#d @|xd|+xd |3x@@8p8}8p888xKi,@,@,8```|8!`} N b 8ctK`;h,#A8cK`K8Kq`8cK`K|`|xT`|Kx cc8~8K]`8~KFaA(K8 8H`K8 8H`K8a8 8H`K C\ wait_on_input A( L| N  A( L| N  (A( L| N !|KOA(|pH A rscpsc2_c__no_more_malloc__abort`8b|8!q8|x&2,(A|@0},#@hcK߽A(,#}@,K)}8!}N }8!}KK]A(cKQA(,#}A8!}}K|@xKH Arscpuc_next_buff8, A@8c, A,```!888c, @8N @XUcsToU2s,|L 8c8| ``!88cC N @8UcnToU2n|!|$@A xK5`8!p}N 8!pN A8NeutralUcnToUcn|!|# @A xK`8!p}N 8!pN A8UcnToNeutralUcn|!`g`````H`8!p}N A< UcnToUcmbn| H!`h`a9```H`8!p}N AD UcmbnToUcn``;= aA=`= |!?@98 (!b @|< @ H P9 ~A(@````!9<<:W**( (@|) @9:W*P*@<; $U)**( @9;(c9@@:|)0@AD(W| @h*A iN a;P9)9x;iRA`~8!}!AaN a;c8s9)W9ѾKa;c89)W9Ѿsa;c8sKa;c89)W9Ѿsa;c89)Ka;c89)W9Ѿsa;c89)Ka;c89)W9Ѿsa;c89)Ki;Bz,#A|9bX" h8O88` p8x8 99@9)8l | LN!A(`}~8!}Kb hK`9bX" h8O8z88` px8 9Kx9;(;9@@:|)0@AK9;|X@;9@@:|)0@AK9;|`@;9@@:|)0@AK9;|@;9@@:|)0@AKh9;;9@:|@A|)0@AK@9;%;9@:|)0@AdK ;Bz,#A|9bX" h8O88`p8x899@9)dl | LN!A(`}~8!}Kb hK`9bX" h8O8z88`px89Kx;Bz,#A|9bX" h8O88`p8x8 99@9)l | LN!A(`}~8!}K(b hKQ`9bX" h8O8z88`px8 9Kx@l;Bz,#A|9bX" h8O88`p8x899@9)l | LN!A(`}~8!}K\b hK`9bX" h8O8z88`px89Kx A 8 Utf16nToUtf8n``;= aA=`= |!?@98 (!b @|< @ H P9@~A(@````!; 9<:W *+ ( @|) @:W P*@<:$U)* ( @9;(9@(@ :c|)0@AD(W;| @h*A iN a;'P9)x;iRAX~8!}!AaN a;cs79)WѾKa;c9)WѾs9;a;cs7Ka;c9)WѾs9;a;c9)Ka;c9)WѾs9;a;c9)Ka;c9)WѾs9;a;c9)Ki;Bz,#A|9bX" h8O88` p8x8!9S9@9)8l | LN!A(`}~8!}Kb hKQ`9bX" h8O8z88` px8!9SKx9;9@@:|)0@A K9;|X@9@|`@@:; |)0@AK9;9@@:; |)0@AK9;|@9@:@; |)0@AKp9;9@:|@A; |)0@AKH9;9@:|)0@ApK,;Bz,#A|9bX" h8O88`p8x8#9*9@9)dl | LN!A(`}~8!}Kb hK`9bX" h8O8z88`px8#9*Kx;Bz,#A|9bX" h8O88`p8x8919@9)l | LN!A(`}~8!}K4b hK`9bX" h8O8z88`px891Kx((A@(LD A\;Bz,#A|9bX" h8O88`p8x89A9@9)Tl | LN!A(`}~8!}KPb hK`9bX" h8O8z88`px89AKx;Bz,#A|9bX" h8O88`p8x8$989@9)l | LN!A(`}~8!}Kb hKI`9bX" h8O8z88`px8$98Kx A Utf16nToUtf8nNoCC``;= aA=@=` |!9=b @ H8 (|< @!! P9~A(@``!\; :WI*( @4;|8 @@<U8*(@Z9)$WXP*:XJ(@ 9;c;`;|)0@A<(W9| @(*A )N a9خ9)ZxYiA`~8!}!AaN a9cXs9)WZѾKa9cX9)WZѾsa9cXsKa9cX9)WZѾsa9cX9)Ka9cX9)WZѾsa9cX9)Ka9cX9)WZѾsa9cX9)Ki;Bz,#A|9bX" h8O88` p8x899@9)8l | LN!A(`}~8!}Kb hK1`9bX" h8O8z88` px89Kx(@9;;`;|)0@AK|P@@ 9;; ;`;|)0@AK|X@@ 9;; ;`;|)0@AK|`@@ 9;; ;`;|)0@AKt#|H@A 9;; ;`;|)0@AKL9;E;`;|)0@AlK0;Bz,#A|9bX" h8O88`p8x899@9)l | LN!A(`}~8!}Kb hKܙ`9bX" h8O8z88`px89Kx A Utf16nToUtf8nGD``;= aA=@=` |!9=b @ P8 (|< @!!~9A(@```!\; :WI*( @0;|8 @@<U8*(@ Z9)$WXP*:XJ(@ 9;c;`;|)0@A<(W9| @(*A )N a9خ9)ZxYiA`~8!}!AaN a9cXs9)WZѾKa9cX9)WZѾsa9cXsKa9cX9)WZѾsa9cX9)Ka9cX9)WZѾsa9cX9)Ka9cX9)WZѾsa9cX9)Ki;Bz,#A|9bX" h8O88` p8x8"9/9@9)8l | LN!A(`}~8!}Kb hKq`9bX" h8O8z88` px8"9/Kx(@9;;`;|)0@AK|P@@ 9;; ;`;|)0@AK|X@@ 9;; ;`;|)0@AK|`@@ 9;; ;`;|)0@AKt#|H@A 9;; ;`;|)0@AKL9;`;`;|)0@AlK0`K( @`K A Utf16nToUtf8nSubst HK @ Utf16nToUtf8nSubstAll``;aAc|!9b p x9|< @!! c~A(@x`!c<;;|0@~HV:V|8 @A(}hX*A}iN ;I@`}'P.E})P| P@U*>AT;c;|< @A~8!}!AaN |90@@(=*y*U+}*bK[;;{K 8bc,#A|9bX" h8O88` p8x899@9)8l | LN!A(`}~8!}K$b hK`89bX8" h8pxd8` 8OKt 8bc,#A|9bX" h8O88` p8x899@9)8l | LN!A(`}~8!}K\b hK9`89bX8" h8pxd8` 8OKt <;W02K <;W02 <K <;W02 <K <;W02 <KcU:02;+ <;W02K;Bz,#A|9bX" h8O88`p8x89v9@9)0l | LN!A(`}~8!}Kb hK`9bX" h8O8z88`px89vKx A 0Utf8nToUtf16nGD|``aA;!a!e|< @A(@,'8:Ad,(Ab p;Bcc " B xb 9`!c|;0@;@~c~|7 @@D,3@t;{(;9(|< @A~8!}a!AaN ;;Bz,#A|9bX" h8O88`p88x99)h9@ l| LN!A(`}~8!}aKDb hKѵ`9bX" h8O8z88`p89xKxVw(~*A4~N ;{K<;W02~x|8z Vy:, ~.~PV>@ ,6A,P8;{(:;9(K\).|@A8*|@A;{K8+|@A;;|90@@(?8{8W78~w{;;{K z,#A|9bX" h8O88` p88 x99)89@ l| LN!A(`}~8!}aKb hK`9bX" h8O8z88` p8 9xKx<;W02~x|8z KX<;W02~x|8z Kċ<;W02~x|8z K;9W02~x|8z K;;Bz,#A|9bX" h8O88` p88x99)89@ l| LN!A(`}~8!}aKLb hKν`9bX" h8O8z88` p89xKxb p;Bcc  " xB 9z8````!c|;0@;@,~cȮ|8 @@$,3@䁇;{|< @@KVx( *A4 N ;;{Kԉ;W902,~cx|`8{ Vl:, `.PW>@ ,6A P8;{:K|}`.|`@Ad|`@A;{KX|`@A@9|,0@@=yU}~;{K;W902,~cx|`8{ K,;W902,~cx|`8{ Kĉ;W902,~cx|`8{ K;W902,~cx|`8{ Kb p;Bcc  x" 9Zp```!c|;0@;@(~c`~Vy|7 @A(**A<)N ;{|< @@K|;U02}b~[x|X8{6 , @0,6@(Vk:%X.}gX.~`P|@V>AD|`@A;{K;;|`@A0|90@@(=kylUy}l~{;{K\8~z,#A9bX" h8O88`p88 x9{9)9@ l| LN!A(|ca8!|!AaN b hK`9bX" h8O8z88`p8 9{xKX z,#A|9bX" h8O88`p88x9j9)9@ l| LN!A(`}~8!}aKb hK`9bX" h8O8z88`p89jxKx z,#A|9bX" h8O88`p88x9V9)9@ l| LN!A(`}~8!}aKb hKQ`9bX" h8O8z88`p89VxKx|;U02}b~[x|X8{6 K̉|;U02}b~[x|X8{6 Kĉ|;U02}b~[x|X8{6 K;kU02}b~[x|X8{6 Kz,#A9bX" h8O88`p88 x99)@9@ l| LN!A(8~|ca8!}!AaN b hK`9bX" h8O8z88`p8 9xKL,3@d;z,#A|9bX" h8O88`p88 x99)@9@ l| LN!A(`}~8!}aKb hK`9bX" h8O8z88`p8 9xKx A  Utf8nToUtf16nSubst`j```aAa|!aA!xpj!E|; @aA(8`@88;;"X: ` x`B :$```!cd|:@;{@ 8 }怮|zU| @(@,,=@@ ,7A,=,A0oP;;Z:A8K 8b{c,#A\" h;88`8O889j l9)p9@x| LN!A(K(b hK`8;88" hd8`8OK,=| .| @@@ 8b{c,#A\" h;88`8O889x l9)p9@x| LN!A(Kpb hK`8;88" hd8`8OK| @A;ZK,=8| @@@88bcE,#A|" h;88`8O889 l9)p9@x| LN!A(|cP8!@}px!Kb hK`8;88" hd8`8OKt|&@<@$Tx||;ZK 8b{c,#A\" h;88` 8O889 l9)8p9@x| LN!A(Kb hK`8;88" hd8` 8OKb hK`8dKV02~"KXV02;{|"(8~+xT02~:|08|+xK(;{V02~"|x|8x K;{V02~"|x|8x K;dV02~"|x|8x K,=@8bc,#A" h;88`8O889 l9)@p9@x| LN!A(8|cP8!@}]KDb hK`8;88" hd8`8OKp,=@8bc,#A" h;88`8O889 l9)p9@x| LN!A(8|cP8!@}]K|b hK`8;88" hd8`8OKp;{8bc,#A\" h;88` 8O889 l9)8p9@x| LN!A(Kb hK-`8;88" hd8` 8OK A Utf8nToUtf16nNoCCSubst`,'|aA`;!::aAb H!eA(@| @,(@l;BccAb p8P`!c|0@;@'~H}\V| @/5@@t;{8| @A~8!}Aa!AaN ;{hA8!8~}K(B %X*V:A4)N ;;{KL;U)02}'J~;x~88{6 ,|X./6'HPW'>@ " A(;{P::8KB x})X.|H@A" J|P@A;;{K9[)|H@*0@A<@$T鲾x}Ib[}';;{K z,#A|9bX" h8O88` p8x89<9@9)8l | LN!A(`}~8!}AKb hK`9bX" h8O8z88` px89<Kx;U)02}'J~;x~88{6 KP;U)02}'J~;x~88{6 KĈ;U)02}'J~;x~88{6 K;U)02}'J~;x~88{6 K;z,#A|9bX" h8O88` p8x899@9)8l | LN!A(`}~8!}AKb hK`9bX" h8O8z88` px89Kxcb pc 8" B xb ``!c|0@;@,~Ȯ~|V| @/5@@t;{| @@K(~g*V:A4~iN ;;{Kԉ;W902,~cx~`8zv ,}./6,PW,>L2A;{P::K .|@Ap |@@:{ |@AT=y|0@@U9 ;;{K0;W902,~cx~`8zv K@;W902,~cx~`8zv Kĉ;W902,~cx~`8zv K;W902,~cx~`8zv K A,Utf8nToUtf16nSubstAll|cN @rscph_rscpe__error(#8X`@8N dN @$rscpSetHook_rscpe__error`;T>|!,88A,$@@8, (, A@8aK5`@A8!}!AaN ``!K]1`;x|Al;,#@ "|p|,@KXc8`|xK\` !|p|,@K A printtitle|}&`!Aa8dh8KM``8}8(K9``~8`88T8pK`,A`,AX aKI`8a 8h8KI`9(8 a88@A@@KH,,@pK8`8KaA(8`8KQA(8`8KAA(KA(,,A@8HA(8`8KA(KA(,,A@K\8`KYA(|pb 8cKu`;~,#@\8~K9`~8cK`8`KA(|pb 8cDK`;~,#A$8cK]`8`KA(|p8~K`~8cK-`8`KA(|pH A0sapdaem2!|K]A(|pH Acannot_fdopen_for_stderr!|KA(|pH Acannot_grap_fid_2!|KA(|pH Acannot_reconstruct_stderr|!,,A,A\,A4 @ 8dhK `8!p}N `8!pN b 8cHK `8!p}N b 8c(K `8!p}N b 8c K a`8!p}N Asapdir A( L| N  A( L| N  A( L| N  A( L| N A( L| N A( L| N |}&aA`,#!```!ޱAh8b8KA(|zyA8a;!88 cFK+A(8|",#|xx@,5N@D,#A(, A, A, @t;9|9@@ AT:`!:y;9,##|A:A:|9@@Ԉ, A A|KAt, @h:8:o```!8yv8:,#A`(@X:|$@`@@88ap8 KA(,@$}, A8a}KA(K88ap8KA(,@(, A8aKA(~K88ap8 KaA(,@(z, Ap8azKiA(}K\88ap8K!A(,@<~, A08a~K)A(|K;!8a88 cFK)QA(8,#@.~@K:K88ap|8|!K8a;!88 cFK(A(8,#@.~K:.~KcCKuA(,#@~,#@},#@x|,#@`88`!Z!`8!!P} |!AaN KA(KKA(KKyA(KlKmA(KT8a;!88 cFK'A(8,#@b~.AK:KcCKeA(8`!`!Z8!!P|} K48`!`8!!P}AaN b8{0KA(8{KA(~8{KA(}8{]KA(|8`!`8!!P}aN C (GetSAPFileVersionstarting (1st step)starting (2nd step)starting (3rd step)gestartet& entries written& (+&) entries writtenwaiting for timestamp of start pointwaiting for connectionsendingwaiting. & entries sentwaiting after write error (errno=&)finished normallyaborted: unknown reasonaborted: cannot open SysLog file (errno=&)aborted: file has wrong formataborted: too many format errorsaborted: read erroraborted: incomplete fileaborted: error at socket() (errno=&)aborted: error at bind() (errno=&)aborted: error at listen() (errno=&)aborted: error at connect() (errno=&)aborted: error during startupaborted in test modeaborted after signal &aborted after signals & + &finished after long idle timeaborted: internal assertion failedunknown reasonSAPPARAM(rslg/central/file)missingSAPPARAM(rslg/central/old_file)missingno problem.0000010100000000TRUEFALSEwait_for_nothingwait_local_clockwait_old_entrieswait_wake_up <strange_reason>need_nothingneed_say_helloneed_ask_for_old<strange_needings><raw_hostname?>SAPPARAM(rslg/collect_daemon/pid_file)missingcannot open actual SysLog fileread errorhalf of a recordsocket errorbind errorlisten errortime outBadBoyo.K.many file format errorswrong file format self%s (%5d)(%d) %c%c : IBrslgcollIB%s IBSIGUSR1 switched trace on release: 710, version: 07, Date: 2007-08-30 usage : rslgcoll <SAP-Parameter> [-v[2|t]] [-F] [-d] [-z hours] [-VERSION] -vt : with logging (to TRACE) -v2 : with logging (to STDERR) IB -v : with logging (both) -F : to stay in foreground IB (def.: become a daemon ) -z x: stop, after x hours idle IB "hh:mm" as x allowed. IB -VERSION: show patch version and exit IB%ldStatistics:===========accept_problem................ accept_success................ recv_entry_success............ recv_EOF...................... recv_partial_and_wait......... recv_partial_at_EOF........... recv_problem.................. paket_cnt_this_connection..... paket_cnt_total............... received_all.................. received_end.................. received_entry................ received_entry_ill_timestamp.. received_miss................. received_oldentry............. received_sdown................ received_stime................ received_strange.............. received_sup.................. rename_problem................ rename_success................ sendto_sender_no_address...... sendto_sender_not_ready....... sendto_sender_problem......... sendto_sender_success......... close_call_up_socket_problem.. close_call_up_socket_success.. close_working_socket_problem.. close_working_socket_success.. gethostbyname_problem......... gethostbyname_success......... time_pingpong_too_slow........ write_entry_problem........... write_entry_success........... senders....................... sender_did_wait_too_long...... scanner_wait_ticks............ scanner_next.................. from_file_new_sender.......... from_file_sender_again........ from_file_filenumber.......... from_file_data_entry.......... from_file_format_error........ rslgcoll(41).write(SysLog)IB%7ldIB%0*ld IBunlink()rslgcoll(20).fclose(still actual SysLog)IBrename(,renaming failed.IBE05cannot open fresh SysLog file.IBNew c. SysLog file is not empty.IBLong raw hostname truncated:IBsk__write_sender_info: hostname still unknown.IB?no cur sender?missing_range.from : %*.*sIBmissing_range.to : %*.*sIBUnrequested missing range. Nevertheless stored..IBEnd of sequence of old entries.Unrequested old entry end mark. Ignored.IBStart of question : %-*.*sAnswer arrived at : %-*.*sSenders clock told : %-*.*scollector before sender: %-*.*sI %s. Unrequested time stamp ignored.Sended_all : NoIBYesINTERNET : Fam__ Po-rt NetHost_Imp __ __ __ __ __ __ __ __ IBINTERNET_addr: %02xI try SAPPARAM("rslg/send_daemon/listen_port").I try its SAPCPUID."gethostbyname(man:3n)" cannot find "%s".I still got the raw hostname.send_question_to_sender:IB.. %-47.47sSend to port at IBsended data content ........ %25.25sIBbegin data before convert = %0lx/%0lx/%0lx/%0lxIBbegin data after convert = %0lx/%0lx/%0lx/%0lxIB****************************************IBrslgcoll(22): sendtoIBsend_question_to_sender: ** tosenders not ready **IBI cannot get address of sending daemon.I could not ask for time stamp.know_what_to_send : %cIBpaket format : %cIB : no more inforamtion.IBsender_cpu_id : %-*.*sIBsender_inst_no : %-*.*sIBsender_inst_id : %-*.*sIBsender_listen_port: %-*.*sIBSender was up, but I did not ask fast enough !IBSender was not up, but needed ask for old !Now he knows what he sent.IB: Now I am waiting for .IBSender still needs:rslgcoll(29): invalid timestamp: I read %ld pakets, %ld this time. IBcollected new entrycollected old entryUnrequested old entry. Ignored.TRC:rslgcoll.c:%d: %sIBrslgcoll(28): invalid timestamp: Release: 710, version: 07, Date: 2007-08-30Must forget %*.*s (no %ld)IBMust forget %s (no %ld)Must forget sender without name (no %ld)IBFiXGUUUUUUUVSender, who I did not know before:IBI note down the INTERNET address:I note down the new (!) INTERNET address:inst_id/sender_id: %-*.*s <--> %-*.*sinst_id: %-*.*s <--> %-*.*sinst_no: %-2.2s <--> %-2.2slisten_port: %-*.*s <--> %-*.*sIBM 00000101----------------------------------info-on-sender-- wait_reason: %s IBstill_needs: %s IBwaiting_since: %-16.16s IBwait_ticks : %d IBraw_hostname : %s<=- raw_hostname : <missing> valid_I_addr : %s IBinfo.sender_behind: %-12.12s info.last_recive : %-16.16s info.last_send : %-16.16s info.computer_id : %-8.8s info.inst_id : %-20.20s info.native_s_id : %-*.*s<=- IBinfo.sender_state: sender_disappeared clock_only sender_up sender_stoped sender_finished <strange_wait__> -------------------------------------------------- Empty raw hostname unuseable for %-6.6s.IBUnuseable raw hostname for %-6.6s: "%-*.*s".IBNo raw hostname for %-6.6s.Raw hostname "IB" of length IBRaw hostname for %-6.6s changed from "%s" to "%-*.*s".IB-VERSIONIB-vIB-FIB-zIBStarting (IB) ...I will die after idle secondsI will live as long as possible.IBargc..... IBargv[].. IBI become a daemon.IBrdisp/mynameIBrslg/max_diskspace/centralIBrslg/central/filerslg/central/old_filerslg/collect_daemon/pid_fileIBopen actual SysLog file "" ...cannot open actual SysLog file "IB" errno: One more sendern knownIBMore info about known sender.Current central SysLog is file number IBCentral SysLog file has wrong format.I can handle 'cent_format1993apr'.IBBut I found 'cent_format1988'.IBPerhaps it is best to remove the currentIBcentral SysLog file(s):fi_formatformat errorIBentry from fileCentral SysLog file has many format errors. central SysLog file(s):Or look at them with option -v2 -F .IBvalid data in fileIBrslgcoll(3).readIBI read half of a record.IBwhole recordIBpre-existing SysLog file read.IB filenumber.... new_sender.... sender_again.. data_entry.... format_error.. Idle limit smaller than first call round of some secondsIBrslgcoll(24): Central SysLog file was not numbered. IBrslg/send_daemon/listen_portIBrslgcoll(6): socketrslgsend(26).setsockoptrslg/collect_daemon/talk_portSending questions from port IB [bind]rslgcoll(7): bindrslgcoll(7): : port=%ld IBrslg/collect_daemon/listen_portrslgcoll(8): socketrslgsend(27).setsockoptListening at port IBrslgcoll(9): bindrslgcoll(9): : port=%ld IBrslgcoll(10): listenIBStopping after %d idle secondsIB: I waited very long for . Restarting.IB: I asked sender for old data:IB: I could not ask sender for old data: I shouted a hello.IB: I could not shout a hello.IBrslgcoll(11): acceptIBConnection established on sd= family : port : net.host.lh.impno : IB.#%d.%d.%d.%dIBBut I dont know that host.IBaddrlen should be 16, but is Paket has length (must be IB). Discard because EOF.I read pakets, this time.received bytes ...... %dIBbegin of input before = %0lx/%0lx/%0lx/%0lxbegin of input after = %0lx/%0lx/%0lx/%0lxdata after convert ... %25.25sIB++++++++++++++++++++++++++++++++++++++++++IB). Continue waiting.IBpaket_type: %cIBsender_id : %*.*s%s: %sIBdata_ok = FALSEacc_old_entryacc_entryUnexpected record type. Ignored.IBrslgcoll(15).close(working_socket)IBconnection on sd= closed.IBstart termination.IBrslgcoll(16).close(call_up_socket)IB'call_up_socket' was not open.IBrslgcoll(25): I cannot unlink. Finished. rslgcoll(14): recvIBSIGUSR2 switched trace off@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_str.c#1 $ SAP@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_str.c#1 $ SAPIBM IB~@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_put.c#2 $ SAP@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_put.c#2 $ SAPIB @(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_OutStr.c#1 $ SAP@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_OutStr.c#1 $ SAP@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_FldWd.c#1 $ SAP@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_FldWd.c#1 $ SAPIBM IB@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_OutCS.c#1 $ SAP@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_OutCS.c#1 $ SAP(null)(nil)vvfprintfU16IBMu16_OutCS.cIBM B:QnٺzfpH=c)\Buffer overflow (floating point output)@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_aux.c#1 $ SAP@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_aux.c#1 $ SAPnonelowmediumhighIBM --- Unicode interface ------ End of message --------- Unicode interface [%.60s line %d] pid = %d time = %ld:ICmdline : %s IBM IB --- Unicode interface ------ End of message ---dbgAlignCheckStringU16(): ERROR: The following string is unaligned: IBMIBM IBError in format string at or near 'Y': Error in format string at or near 'Y': Function %.64s : Array %.32s length %.32s is too small. : malloc : Out of memory.I--- Unicode interface ------ End of message ------I %02xIB %04xIBCharacters previously read: encountered invalid UTF-8I (but where?)IBAll bytes to processIBMNLSUI_FILE_TRACEI0%.10s "%s%s" (fileno 0x%x)IInternal errorIU16 trace level set to u16_aux.cIBM IBU16 trace level set to @(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_OutCon.c#1 $ SAP@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_OutCon.c#1 $ SAPIB0u16_OutCon.ccpuid/IBcpuid/trunc_sizeIBcpuid/before_firstIBcpuid/behind_lastcpuid/trunc_leftIBM IBcpuisapcpuid.gethostnameIB?ConvertSCCSID_w failedCommand Line ConversionEnvironment ConversionIBMnlsui1.cIBMfdopenU16IBcmodeIBMAX_MODE_LNMAX_NDIGITSexcvtU16IBMwstringmkdirU16IBMcpathIBMAX_PATH_LNchmodU16IBMgetcwdU16IBchdirU16IBMaccessU16IBstrfctimeU16IBMcformatMAX_FORMATSTR_LNIBMstrftimeU16MAX_TIMESTR_LNIwteststrIBMsystemU16IBcstringMAX_COMMAND_LNIEntering cleanup_putenv_table(). Allocated table lines = %i IBEntries after shrinking: %i IBMEnlarging table to %i IputenvU16IBcptrIBMlengetenvU16IBcnameIBMAX_ENV_LNIremoveU16IBrenameU16IBcfromIBctofopenU16IBMopenU16dlerrorU16Ierr_msgUIBMMAX_DB_ERROR_LNdlsymU16IBMMAX_SYM_LNIdlopenU16IBSAPCASTRAW2UCCHKI0nlsui_cast_raw2ucIBfileCIBMAX_FILENAME_LNERROR: Casting an odd adress to SAP_UTF16* in file %s, line %d nlsui_alloc_mbsarIBConvertSCCSID_wwstrIBMinlenIBttynameU16IwttynameIBMmkstempU16IpatternCIBMpatternU16IsrcLenU16+1mktempU16IBtempnamU16IrcIcprefixMAX_PREFIX_LNIBcdirIBMsetlocaleU16IBMc_inlocMAX_LOCALE_LNIBw_outlocIBMstrerrorU16werrorIMAX_ERROR_LNIBMCould not convert error no. %d3 to UTF-16 charactersIBMctimeU16IBMubufferasctimeU16Ictime_rU16Iasctime_rU16IBMunlinkU16IBstatvfsU16IrmdirU16IBMpopenU16IBMccommandIBMctypeIB: IcreatU16IBMutimeU16IBMmkfifoU16IBchownU16IBMreadlinkU16wbufIBMwsizeIBsymlinkU16Icpath1Icpath2IlinkU16rexecU16IBMccmdIBMchostIBMAX_HOSTNAME_LNMAX_USER_NAME_LNIBMcpassIBMAX_PASSWD_LNIB*ahostIgethostnameU16IwnameIBlengthIfreopenU16Ifopen64U164.0.1libicuuc40.alibicudata40.alibicui18n40.aIBNLSUI_INIT_TRACE_LEVELInoneIBMlowmediumIhighIBMNLSUI_INIT_TRACE_LEVEL set to 'high'IBM [%s %d] pid = %d Inlsui0.cIBMEnvironment variable reset: %sstrcat error: Source array %s has length %u. After concatenation ... IB... it would exceed the destination array %s (length %u). It will be truncated.Unnecessary call of nlsui_setPath(), LIBPATH will not be changed.IBLIBPATHCould not allocate space for %u bytesIBLIBPATH=I:Environment variable set: %sIBCould not open %s shared library %sError message: "%s"Library handle for %s: %pIBSearching for libicui18n in environment path LIBPATHIBMLIBPATH is set to %s IBICULoaded ICU i18n lib: %s from environment pathIBSearching for libicui18n in additional path %sILoaded ICU I18n lib: %sCould not open the ICU i18n librarydlsym %s failed with error: %sIFunction pointer for %s: %pucal_getAvailable_4_0IBsymbol load "%s" failedError Message: %sIBucal_countAvailable_4_0ucal_open_4_0IBucal_close_4_0Iucal_set_4_0IBMucal_setDate_4_0IBMucal_get_4_0IBMucal_getMillis_4_0Iucal_setMillis_4_0Iutrans_openU_4_0IBMutrans_openInverse_4_0Iutrans_close_4_0IBMutrans_getUnicodeID_4_0utrans_setFilter_4_0IBMutrans_countAvailableIDs_4_0IBMutrans_openIDs_4_0Iutrans_transUChars_4_0Iucol_open_4_0IBucol_strcoll_4_0IBMucol_close_4_0Iucol_setStrength_4_0IBMucol_getSortKey_4_0ucol_getLocaleByType_4_0IBMu_versionToString_4_0IBu_errorName_4_0u_getVersion_4_0IBMu_getUnicodeVersion_4_0u_charType_4_0Iu_getIntPropertyValue_4_0IBu_charDirection_4_0u_getPropertyEnum_4_0IBu_getPropertyValueName_4_0Iu_setMemoryFunctions_4_0IBMu_init_4_0Iu_cleanup_4_0IBuenum_unext_4_0uenum_count_4_0u_strToUpper_4_0IBMCould not close shared library handle %pIBMError message: %sIBlibicui18n40.a is closed againIProgram is compiled with ICU version %sRequired ICU library files: %s %s %sIBMSearching for libicuuc in environment path LIBPATHILoaded ICU common lib: %sIBSearching for libicuuc in additional path %sIBMCould not open the ICU common library. The following files must be in the path described by the environment variable "LIBPATH": %s, %s, %sLIBPATH is currently set to %s Set the environment variable NLSUI_INIT_TRACE_LEVEL to 'high' to see more details.ICheck also SAP note 519753.Compiled with ICU version %sIBMRunning with ICU version %sICU uses Unicode version %suidna_toASCII_4_0IBuidna_toUnicode_4_0uidna_IDNToASCII_4_0IBMuidna_IDNToUnicode_4_0Iuidna_compare_4_0IBubrk_open_4_0IBubrk_openRules_4_0Iubrk_safeClone_4_0Iubrk_close_4_0Iubrk_setText_4_0IBMubrk_current_4_0IBMubrk_next_4_0IBubrk_previous_4_0IBubrk_first_4_0Iubrk_last_4_0IBubrk_preceding_4_0Iubrk_following_4_0Iubrk_getAvailable_4_0IBubrk_countAvailable_4_0ubrk_isBoundary_4_0ubrk_getRuleStatus_4_0Iubrk_getLocaleByType_4_0IBMuloc_getDefault_4_0unorm_normalize_4_0unorm_quickCheck_4_0IBMunorm_quickCheckWithOptions_4_0unorm_isNormalized_4_0Iunorm_isNormalizedWithOptions_4_0IBunorm_next_4_0Iunorm_previous_4_0Iunorm_concatenate_4_0IBunorm_compare_4_0IBu_shapeArabic_4_0IBubidi_open_4_0Iubidi_close_4_0ubidi_setInverse_4_0IBMubidi_setPara_4_0IBubidi_writeReordered_4_0IBMubidi_getLogicalMap_4_0ubidi_getVisualMap_4_0Iubidi_getLevelAt_4_0IBMu_charMirror_4_0IBMICU data shared lib does not behave correctly.Iu_isalnum_4_0IBu_isalpha_4_0IBu_iscntrl_4_0IBu_islower_4_0IBu_isprint_4_0IBu_isspace_4_0IBu_isupper_4_0IBu_toupper_4_0IBu_tolower_4_0IBUnicode ctype functions are replaced with 7bit fallback functionsIBNLSUI_7BIT_FALLBACKTerminating. You may set the environment variable NLSUI_7BIT_FALLBACK to run the program without the ICU libraries in an emergency mode.IEnvironment variable NLSUI_7BIT_FALLBACK is set.IBMNLSUI_TRACE_LEVELIBloadIcuDo() is calledIBICU shared libraries are not loadednlsui_set7bitUnicode() is calledIBMIBM ERROR: Non 7-bit character U+%04X encountered in function toupperU This is not supported in 7-bit mode. IBERROR: Non 7-bit character U+%04X encountered in function tolowerU ERROR: Non 7-bit character U+%04X encountered in function isupperU ERROR: Non 7-bit character U+%04X encountered in function isspaceU ERROR: Non 7-bit character U+%04X encountered in function isprintU ERROR: Non 7-bit character U+%04X encountered in function islowerU ERROR: Non 7-bit character U+%04X encountered in function iscntrlU ERROR: Non 7-bit character U+%04X encountered in function isalphaU ERROR: Non 7-bit character U+%04X encountered in function isalnumU __SAPPROFILE_n_DEFAULT__SAPPROFILE_n_PF_FILE__SAPPROFILE_C__SAPPROFILE_CALLS__SAPPROFILE_CALL_LAST_NAME__SAPPROFILE_MALLOCSSAPonSAPUC2_ID1SAP universal character with wide rangeSAPUC2_ID2SAP universal character differs from wchar_tSAPUC2_ID3SAP universal character == UTF-16SAPUC2_ID4wchar_t uses proprietary codingSAPUC2_ID5wchar_t has 4 bytesSAPPROFILE_IN_EFFECTSAPPROFILE__SAPPROFILE_DEFAULTSAPSYSTEM$$SAPSYSTEMNAMESAPDBHOSTSAPMSHOST$(SAPDBHOST)SAPDIAHOSTINSTANCE_SRVTYPEDINSTANCE_NAME$(INSTANCE_SRVTYPE)$$PHYS_MEMSIZE64EXETYPErunSAPLOCALHOSTSAPLOCALHOSTFULLSAPGLOBALHOST$(SAPLOCALHOST)SAPARGCSAPARGVSAPTYPE_HFIBM RS/6000 with AIXDIR_SEP/FILE_SEP:DIR_INSTALL$(DIR_SEP)usr$(DIR_SEP)sap$(DIR_SEP)$(SAPSYSTEMNAME)$(DIR_SEP)SYSDIR_INSTANCE$(DIR_SEP)usr$(DIR_SEP)sap$(DIR_SEP)$(SAPSYSTEMNAME)$(DIR_SEP)$(INSTANCE_NAME)DIR_TEMP$(DIR_SEP)tmpDIR_ORAHOME%(ORACLE_HOME)DIR_CLIENT_ORAHOME%(CLIENT_ORACLE_HOME)DIR_SERVER_ORAHOMEDIR_SAPUSERS.DIR_TRANS$(DIR_SEP)usr$(DIR_SEP)sap$(DIR_SEP)transDIR_EPS_ROOT$(DIR_SEP)usr$(DIR_SEP)sap$(DIR_SEP)trans$(DIR_SEP)EPSDIR_PUT$(DIR_SEP)usr$(DIR_SEP)sap$(DIR_SEP)putDIR_PERF$(DIR_SEP)usr$(DIR_SEP)sap$(DIR_SEP)tmpDIR_CCMS$(DIR_SEP)usr$(DIR_SEP)sap$(DIR_SEP)ccmsDIR_EXE_ROOT__1_DIR_EXE_ROOT$(DIR_INSTALL)__2_DIR_EXE_ROOTexeDIR_GEN_ROOT__1_DIR_GEN_ROOT__2_DIR_GEN_ROOTgenDIR_EXECUTABLE$(DIR_INSTANCE)$(DIR_SEP)exeDIR_GEN$(DIR_GEN_ROOT)$(DIR_SEP)dbgDIR_CT_RUN$(DIR_EXE_ROOT)$(DIR_SEP)$(OS_UNICODE)$(DIR_SEP)rs6000_64DIR_CT_SAPJVM$(DIR_EXE_ROOT)$(DIR_SEP)jvm$(DIR_SEP)rs6000_64$(DIR_SEP)sapjvm_$(SAPJVM_VERSION)saphelpsaphelptypeDISKDIR_SOURCE__1_DIR_SOURCE__2_DIR_SOURCEsrcDIR_LIBRARY$(DIR_EXECUTABLE)DIR_BINARYDIR_RSYNDIR_GRAPH_EXEDIR_GRAPH_LIBDIR_VMC$(DIR_EXECUTABLE)$(DIR_SEP)cfwDIR_JKIT$(DIR_EXECUTABLE)$(DIR_SEP)jkitDIR_JKIT_JRE_BIN_VM$(DIR_JKIT)$(DIR_SEP)jre$(DIR_SEP)bin$(DIR_SEP)cvmDIR_SAPJVM$(DIR_EXECUTABLE)$(DIR_SEP)sapjvm_5SAPJVM_VERSIONDIR_PROFILE__1_DIR_PROFILE__2_DIR_PROFILEprofileDIR_GLOBAL__1_DIR_GLOBAL__2_DIR_GLOBALglobalDIR_SDM_HOME__1_DIR_SDM_HOME__2_DIR_SDM_HOMEsdmDIR_SETUPS$(DIR_PROFILE)DIR_CT_LOGGING$(DIR_GLOBAL)DIR_HOME__1_DIR_HOME$(DIR_INSTANCE)__2_DIR_HOMEworkDIR_AUDIT__1_DIR_AUDIT__2_DIR_AUDITlogDIR_LOGGING__1_DIR_LOGGING__2_DIR_LOGGINGDIR_PROTOKOLLS__1_DIR_PROTOKOLLS__2_DIR_PROTOKOLLSDIR_DATA__1_DIR_DATA__2_DIR_DATAdataDIR_ICMAN_ROOT__1_DIR_ICMAN_ROOT$(DIR_DATA)__2_DIR_ICMAN_ROOTicmandirDIR_ATRADIR_SORTTMPDIR_EXTRACTDIR_PAGINGDIR_ROLLDIR_MEMORY_INSPECTORDIR_DBMS__1_DIR_DBMS__2_DIR_DBMSSAPDBDIR_REORGFN_GEN_PRGM++++++++FN_DWdisp+work$(FT_EXE)FN_TEMUsaptemu$(FT_EXE)FN_ICMANicman$(FT_EXE)FN_ICMBNDicmbnd$(FT_EXE)FN_GWRDgwrd$(FT_EXE)FN_MSG_SERVERmsg_server$(FT_EXE)FN_CHECKsapcheck$(FT_EXE)FN_TPtp$(FT_EXE)FN_OSCOLsaposcol$(FT_EXE)FN_VMCEXTTIMERvmcexttimer$(FT_EXE)FN_VMCDEBUGPROXYjre$(DIR_SEP)bin$(DIR_SEP)java$(FT_EXE)FN_PAGEPAGFIL$$$(FT_DAT)FN_ROLLROLLFL$$$(FT_DAT)FN_ENQBCKENQBCK$(FT_DAT)FN_ENQRPVALENQRPVAL$(FT_DAT)FN_ENQRPTENQLIS$(FT_DAT)FN_ENQSTATENQSTAT$(FT_DAT)FN_ENQLOGENQLOG++$(FT_DAT)FN_AUDITaudit_++++++++$(FT_AUDIT)FN_SLOGSLOG$$$(FT_LOG)FN_SLOGOSLOGO$$$(FT_LOG)FN_SLOGJOISLOGJ$(FT_LOG)FN_SLOGJOIOSLOGJO$(FT_LOG)FN_TRACETRACE+$$$(FT_LOG)FN_TRACENTRACEFN_BATLOGJOBLOG$(FT_LOG)FN_BATALTLOGJOBLOG$$$(FT_LOG)FN_BDCLOGBI$(SAPLOCALHOST)$$$(FT_LOG)FN_BDCALTLOGRE$(SAPLOCALHOST)$$$(FT_LOG)FN_STATstat$(FT_DAT)FN_ASTATastat$(FT_DAT)FN_SEC_INFOsecinfo$(FT_DAT)FN_REG_INFOreginfo$(FT_DAT)FN_PRXY_INFOprxyinfo$(FT_DAT)FN_MS_ACL_INFOms_acl_info$(FT_DAT)FN_GWSTARTUPgwstartup$(FT_DAT)FN_SAPTRAPsaptrap$(FT_EXE)FN_SLFLMSGrslgmsgt$(FT_DAT)FN_SLSNDEXErslgsend$(FT_EXE)FN_SLSNDPIDrslgspid$(FT_DAT)FN_SLSNDSTATrslgssta$(FT_DAT)FN_SLCOLEXErslgcoll$(FT_EXE)FN_SLCOLPIDrslgcpid$(FT_DAT)FN_SLSWEXErslgswap$(FT_DAT)FN_SPOOLEXErspoget2$(FT_EXE)FN_SPOOLDTHFN_SPOOLDIHD+++++++$(FT_DAT)FN_MSCSAEXEsapmscsa$(FT_EXE)FN_GBUSGgbusg$(FT_EXE)FN_GHIERghier$(FT_EXE)FN_GBMATgbmat$(FT_EXE)FN_GHPGLghpgl$(FT_EXE)FN_GGANTggant$(FT_EXE)FN_GSCLDgscld$(FT_EXE)FN_GMENUgmenu$(FT_EXE)FN_SCSASHMscsashm$(FT_DAT)FN_DBMS$(dbms/id)DBE$(FT_DBE)FN_DBPASSWDDBPASSWD$(FT_DAT)FN_GLANG++++++++$(FT_DAT)FN_GHELPFN_GUCFGFN_ATRAPATHAT$$++++$(FT_DAT)FN_SORT_FILES+++++++$(FT_DAT)FN_EXTRACTE_$(rdisp/myname)_+++++++$(FT_DAT)FN_EUFILEEU++++++$(FT_DAT)FN_REORGR+++++++$(FT_DAT)FN_ABAPPROTABAPPROT$(FT_LOG)FN_EDITORFN_ALFILTERALFILTER$(FT_DAT)FN_ALPARAMSALPARAMS$(FT_DAT)FN_ALMTTREEALMTTREE$(FT_DAT)FN_ALALERTSALALERTS$(FT_DAT)FN_ALPERFHIALPERFHI$(FT_DAT)FN_JVM$(FT_DLL_PREFIX)jvm.soFN_DPLCOMdplcomlib$(FT_DLL)FN_LCOMlcomlib$(FT_DLL)FN_LCOMENVlcom_env$(FT_TXT)FN_JCONTROLjcontrol$(FT_EXE)FN_JLAUNCHjlaunch$(FT_EXE)FN_JSTARTjstart$(FT_EXE)FT_EXEFT_DATFT_AUDITFT_LOGFT_BINFT_STAFT_PIDFT_DBEFT_TXTFT_DLL_PREFIXlibFT_DLL.oFT_DLL_SHR.soGetDsSpecCtrlexe/centralprgmexe/localprgmexe/disp+workexe/work_processexe/tcp_serverexe/spool_serverexe/alpha_termexe/saptemuexe/icmanexe/icmbndexe/j2eeexe/gwrdexe/msg_serverexe/checkexe/saposcolexe/vmcexttimerexe/debug_proxyexe/tcp_clientexe/log_serverexe/clockexe/os_collectorexe/gbusgexe/ghierexe/gbmatexe/ghpglexe/ggantexe/gscldexe/gmenugraph/langgraph/helpinstall/uidsapsysinstall/umask007system/typeABAPsystem/uuidsystem/descriptioninstall/codepage/appl_server4102install/codepage/db/transpsapparam.c: Don't useinstall/codepage/db/non_transpabap/collation/strxfrm_min_factor2abap/collation/icu_sortkey_factor11abap/set_textenv/skip_all0abap/set_textenv/ignore_errorsrscp/mbc_in_sbcsrscp/mbc_copyrsts/ccc/cachesize6000000rsts/ccc/cache07rscp/ccc/protect1install/codepage/MNLS_CONVERSIONinstall/codepage/FRONT_CONVERSIONrscp/transcribe/1/codepagerscp/transcribe/2/codepagerscp/transcribe/list/reverserscp/transcribe/list/blinkingrscp/transcribe/list/underscorerscp/transcribe/dynp/matchcoderscp/transcribe/dynp/intensifyrscp/intui18n/bidi/logicUC2i18n/bidi/logical_number_printingi18n/export_to/code_page_attrnormalcodepage/R2hostIBM_EBCDICdir/temporary$(DIR_TEMP)dir/accountdir/installdir/protokolls$(DIR_PROTOKOLLS)dir/executablesdir/datafilesdir/libraries$(DIR_LIBRARY)dir/dbms$(DIR_DBMS)dir/arch/idrs6000scsa/shm/key589001$$scsa/shm/size4096scsa/shm/startscsa/shm/filescsa/create_daemon/exe_filescsa/autocreatestart_menuS000ztta/parameter_area32000ztta/hold_data_area4000dynpro_language_area150000ztta/cua_area500000ztta/dynpro_area800000dynpro/global_fieldsNOztta/diag_area250000ztta/roll_area3000000ztta/roll_firstztta/max_memreq_MB2047ztta/roll_extension2000000000ztta/roll_extension_dia$(ztta/roll_extension)ztta/roll_extension_nondiaztta/short_area3200000bdc_iob_size10240zcsa/presentation_buffer_area4400000zcsa/calendar_areazcsa/calendar_ids200zcsa/table_buffer_area30000000zcsa/db_max_buftab5000zcsa/exchange_modeonzcsa/reorg_modezcsa/request_unit2000zcsa/sync_reload_c5zcsa/inval_reload_crtbb/max_tables500rtbb/frame_length4rtbb/buffer_length10000zcsa/tablp_exchange_modezcsa/tablp_reorg_modezcsa/tablp_request_unitzcsa/system_languageEzcsa/second_languagezcsa/installed_languagesDEzcsa/moddatfmzcsa/moddcpfm zcsa/modtimefmrsau/max_diskspace/local100Mrsau/enablersau/selection_slotsrsau/user_selectionrsau/max_diskspace/per_filersau/max_diskspace/per_dayrsau/integrityrsau/log_peer_addressrsau/SQL-Audit/switchoffrsau/SQL-Audit/logdir$(DIR_LOGGING)rsau/SQL-Audit/filenameSQL_++++++++.AUDrsau/SQL-Audit/filesize645Mrslg/write_sync_diskrslg/messages/flat_filerslg/max_diskspace/local1000000rslg/max_diskspace/central4000000rslg/local/filerslg/local/old_filerslg/central/filerslg/central/old_filerslg/swap/lock589002$$rslg/append/lock589003$$rslg/swap_daemon/exe_filerslg/send_daemon/autostartrslg/send_daemon/listen_port12$$rslg/send_daemon/talk_port13$$rslg/collect_daemon/listen_port14$$rslg/collect_daemon/talk_port15$$rslg/collect_daemon/hostrslg/send_daemon/exe_filerslg/send_daemon/pid_filerslg/send_daemon/status_filerslg/collect_daemon/exe_filerslg/collect_daemon/pid_filerstr/buffer_size_kBrstr/max_files10rstr/max_filesize_MB16rstr/max_lock_tryrstr/stacksizerstr/accept_remote_traceFALSErstr/send_global_tracerstr/auth_delim_tabrstr/filenamedbms/idBINdbms/typecpuid/before_firstcpuid/behind_lastcpuid/trunc_leftcpuid/trunc_sizedta/mechanismftpdta/ftp/userSAPR3dta/ftp/passSAPdta/ftp/accountdta/allowC:\TMPdta/ftp/cmd/usr/bin/ftp -ndta/remsh/cmd/usr/bin/rshrsts/filename&c&5.5n/&4p&.15nrsts/files/root/L$(DIR_DATA)/$(rsts/filename)rsts/files/root/G$(DIR_GLOBAL)/$(rsts/filename)rsts/files/root/T$(DIR_TEMP)/$(rsts/filename)rsts/dd_mismatch/actioncontrspo/rspoget2_daemon/tcp_block_size1024rspo/rspoget2_daemon/saplpd_block_size32768rspo/store_locationdbrspo/rspoget2_daemon/exe_filerspo/to_host/datafilerspo/to_host/global_datafilerspo/devinit/datafilerspo/host_spool/print_methodfilerspo/AIX_a/printcd &p; qprt -dp -P&P -Bnn -N&C -c -R14 -X850 &f 2>&&1rspo/AIX_b/printcd &p; qprt -dp -P&P -Bnn -N&C -c -R14 &f 2>&&1rspo/AIX_c/printcd &p; /usr/bin/lp -d&P -n&C -c &f 2>&&1; /bin/rm &frspo/host_spool/print$(rspo/AIX_a/print)rspo/host_spool/print_answer&Jrspo/host_spool/print_answer_idrequest id isrspo/host_spool/print_answer_ignore1rspo/host_spool/print_answer_ignore2rspo/host_spool/print_answer_ignore3rspo/host_spool/print_answer_ignore4rspo/host_spool/query/usr/bin/lpstat -o&Prspo/host_spool/answer_formatlpstatrspo/default_archiverARCHrspo/archive_formatrspo/check_memoryrspo/global_shm/printer_list150rspo/global_shm/job_list300rspo/global_shm/server_list100rspo/global_shm/action_list20rspo/tcp/relay/enablerspo/tcp/relay/hostnamerspo/tcp/relay/portnumber1515rspo/tcp/timeout/connectrspo/tcp/timeout/read60rspo/tcp/timeout/writerspo/tcp/retries3rspo/tcp/retrytimerspo/log/maxerrorrspo/log/levelrspo/log/level_Arspo/host_spool/dfA_with_hostnamerspo/novell_modifier/noff/nbrspo/spool_id/loopbreak99000rspo/spool_id/max_numberrspo/spool_id/chunkrspo/req_lifetime8rspo/auth/pagelimitrspo/local_print/serverbackproc/steplevel_db_writegw/req_stack_size30gw/max_sys1000gw/max_sockets2048gw/max_overflow_size10000000gw/max_overflow_usagegw/max_conngw/rem_startREMOTE_SHELLgw/netstat_oncegw/remshgw/ssh/usr/bin/sshgw/conn_disconnect900gw/gw_disconnect1800gw/conn_pendinggw/max_sleepgw/stack_sizegw/keepalivegw/reg_keepalivegw/timeoutgw/internal_timeoutgw/cpic_timeoutgw/reg_timeoutgw/deallocate_timeout600gw/accept_timeoutgw/frag_timeout120gw/reg_error_timeoutgw/reg_lb_levelgw/reg_lb_defaultgw/reg_lb_ipgw/sec_infogw/reg_infogw/prxy_infogw/reg_no_conn_infogw/startupgw/autoreloadgw/statgw/compatibilitygw/monitorgw/close_routesgw/nitracegw/nibuf_maxgw/nibuf_retrygw/accept_remote_trace_levelgw/resolve_timeout$(gw/ni_dns_trc_limit)gw/resolve_phys_addrgw/use_udpgw/so_keepalivegw/export_trace_levelgw/export_trace_level_strictgw/external_trace_levelgw/ipv6_via_routergw/local_addr0.0.0.0gw/listen_queue_len512gw/loggingACTION= LOGFILE=gw_log-%y-%m-%d SWITCHTF=day MAXSIZEKB=100gw/ni_dns_trc_limitgw/start_in_homedirgw/acl_modegw/sim_modegw/acl_filegw/one_sided_frag_writeSAPCRYPTOLIB$(DIR_LIBRARY)$(DIR_SEP)$(FT_DLL_PREFIX)sapcrypto$(FT_DLL)SECUDIR$(DIR_INSTANCE)$(DIR_SEP)secccl/fips/enablesnc/enablesnc/identity/assnc/gssapi_libsnc/accept_insecure_guisnc/accept_insecure_rfcsnc/accept_insecure_cpicsnc/accept_insecure_r3int_rfcsnc/r3int_rfc_securesnc/r3int_rfc_qopsnc/permit_insecure_startsnc/data_protection/minsnc/data_protection/maxsnc/data_protection/use9snc/force_login_screensnc/extid_login_diagsnc/extid_login_rfcsnc/only_encrypted_guisnc/only_encrypted_rfcsnc/log_unencrypted_rfcssf/nameSAPSECULIBssf/ssfapi_lib$(SAPCRYPTOLIB)ssf/ssf_md_algSHA1ssf/ssf_symencr_algDES-CBCssf2/namessf2/ssfapi_libssf2/ssf_md_algssf2/ssf_symencr_algssf3/namessf3/ssfapi_libssf3/ssf_md_algssf3/ssf_symencr_algsec/libsapsecusec/rsakeylengthdefaultsec/dsakeylengthdefaultssl/ssl_libssl/pse_provider[]ssl/pse_provider[ABAP]ssl/pse_provider[DS]ssl/pse_provider[J2EE]JAVAssl/pse_provider[SMDA]ssl/pse_provider$(ssl/pse_provider[$(system/type)])spnego/enablespnego/krbspnego_libspnego/construct_SNC_name111sapgui/themeTRADESHOWsapgui/signature_colorsapgui/system_colorDefaultsapgui/user_scriptingsapgui/user_scripting_set_readonlysapgui/user_scripting_disable_recordingsapgui/user_scripting_force_notificationsapgui/user_scripting_per_usersapgui/nwbc_scriptingsapgui/personas_ignore_update_modeservice/umaskms/max_clientsms/ext_client_quota50ms/max_sleepms/conn_timeoutms/keepalivems/auditms/monitorms/max_open_requestsms/max_vhostms/http_portms/https_portms/admin_portms/extbnd_portms/http_timeoutms/http_proctimems/http_bufferln65536ms/http_lookupms/http_loggingms/http_max_clientsms/http_max_portsms/http_domainms/http_enable_handlerms/http_handler_timeoutms/http_handler_retryms/http_was_requiredms/commentmessage server $(SAPSYSTEMNAME)ms/acl_infoms/icf_info_serverms/urlmap_securems/urlprefix_securems/redirect_versionms/listen_queue_lenms/sapevt_lbms/j2ee_reconnect_typems/j2ee_reconnect_timeout_p1ms/j2ee_reconnect_timeout_p2ms/acl_file_extms/acl_file_intms/acl_file_adminms/acl_file_extbndms/nitracerdisp/workdir$(DIR_HOME)rdisp/wp_no_diardisp/wp_no_vbrdisp/wp_no_vb2rdisp/wp_no_enqrdisp/wp_no_btcrdisp/wp_no_spordisp/wp_no_spo_Fro_maxrdisp/wp_no_restrictedrdisp/wp_max_noDEFAULTrdisp/configurable_wp_nordisp/tm_max_nordisp/msg_flow_dumprdisp/rq_flow_dumprdisp/rq_time_high_resrdisp/rq_qt_thresholdrdisp/wp_ca_blk_nordisp/appc_ca_blk_nordisp/maxWpBlocksInQueue80rdisp/maxAppcBlocksInQueuerdisp/max_sleeprdisp/TRACErdisp/TRACE_COMPSall, FJMrdisp/TRACE_LOGGINGon, 50 mrdisp/TRACE_PATTERN_0rdisp/TRACE_PATTERN_1rdisp/TRACE_PATTERN_2rdisp/TRACE_SEARCH_LISTallrdisp/TRACE_RESOLUTIONrdisp/TRACE_HIDE_SEC_DATArdisp/sna_gatewayrdisp/sna_gw_servicerdisp/max_mbuf_entriesrdisp/max_comm_entriesrdisp/max_slock_entriesrdisp/max_file_entriesrdisp/max_gatewaysrdisp/mshost$(SAPMSHOST)rdisp/msservsapms$(SAPSYSTEMNAME)rdisp/msserv_internalrdisp/ms_param_refreshrdisp/max_alt_modes6rdisp/rfc_checkrdisp/use_rfc_dest_lookupOFFrdisp/invalidate_memory00rdisp/wall_entry_max_nordisp/max_priv_timerdisp/max_debug_lazy_timerdisp/max_snc_hold_timerdisp/test_rollNORMAL_ROLLrdisp/verbose_levelfullrdisp/wppriv_max_nordisp/dev_looprdisp/sys_infoABAP, JAVArdisp/use_sqlbreakONrdisp/calculateLoadAveragerdisp/shutdown/load_balance_wait_time180rdisp/shutdown/message_frequencyrdisp/shutdown/disable_gui_loginrdisp/shutdown/gui_auto_logoutrdisp/shutdown/j2ee_timeoutrdisp/shutdown/abap_trigger_timeoutrdisp/shutdown/idle_wp_timeout$(rdisp/max_wprun_time)rdisp/attach_disp_to_all_shm_segrdisp/acl_filerdisp/traffic_controlrdisp/j2ee_startrdisp/j2ee_start_lazyrdisp/j2ee_start_controlrdisp/j2ee_oprdisp/j2ee_timeoutrdisp/j2ee_errorrdisp/j2ee_libpath$(DIR_INSTANCE)$(DIR_SEP)j2ee$(DIR_SEP)os_libsrdisp/j2ee_profile$(SAPPROFILE_IN_EFFECT)rdisp/core_file_size$(rdisp/limit_core_file_size)rdisp/limit_core_file_sizerdisp/rfc_use_quotasrdisp/rfc_max_queuerdisp/rfc_max_login90rdisp/rfc_max_own_login25rdisp/rfc_min_wait_dia_wprdisp/rfc_max_own_used_wp75rdisp/rfc_max_comm_entriesrdisp/rfc_max_wait_time15rdisp/build_tid_millisec_basedrfc/trfc_use_new_tid_generatorrdisp/http_checkrdisp/http_min_wait_dia_wprdisp/frfc_fallbackrdisp/convert_old_epp_recsrdisp/dp_check_logoff_flagsrdisp/start_icmantruerdisp/icm_startup_argsrdisp/check_master_slave_activerdisp/os_heap_for_restart1Gmpi/total_size_MBmpi/buffer_sizerdisp/jvm_poolSERVLET=on, RFC=onrdisp/jvm_max_nordisp/min_jvmSERVLET=DEFAULT, RFC=DEFAULTrdisp/max_jvmrdisp/jvm_pool_timeoutSERVLET=1800, RFC=1800rdisp/debug_jvm_startuprdisp/ses_tab_max_no$(rdisp/tm_max_no)rdisp/max_vm_priv_timeSERVLET=300, RFC=300rdisp/max_vm_priv_noSERVLET=0, RFC=0rdisp/ext_timer_stop_delayrdisp/vmcRollOutCheckrdisp/vmc_timeout_prioHIGHrdisp/fileTableCheckrdisp/commTableCheckrdisp/sessionTableCheckrdisp/tableCheckSESSIONrdisp/tableCheckModeALLOCATEDrdisp/no_rfc_commit_in_update_taskrdisp/arfc_prior_to_srfcrdisp/rfc_snc_recover_cpic_rcTRUErdisp/early_snc_handshakerdisp/async_dialog_timeout120000rdisp/no_core_infordisp/no_hooks_for_sqlbreakrdisp/max_cs_delaysrdisp/max_child_procsrdisp/call_systemrdisp/accept_remote_trace_levelrdisp/reinitialize_code_pagerdisp/keepalive1200rdisp/keepalive_timeoutrdisp/ms_keepaliverdisp/ms_keepalive_timeoutrdisp/gui_auto_logoutrdisp/addump_periodrdisp/gui_cleanup_delayrdisp/plugin_auto_logouthttp/security_session_timeoutrdisp/reverse_name_lookuprdisp/lcom_env_pathrdisp/dplcomlib_pathrdisp/lcomlib_pathrdisp/rm_max_tbl_sizerdisp/max_hold_timerdisp/max_arqrdisp/wp_auto_restartrdisp/wp_abap_restartrdisp/restartable_wpDIA, BTC, UPD, UP2, SPOrdisp/allow_block_softcancelrdisp/wait_after_deadlockrdisp/myname$(SAPLOCALHOST)_$(SAPSYSTEMNAME)_$$rdisp/atp_serverrdisp/vbnamerdisp/vb_dispatchingrdisp/vb_factorrdisp/vb_refresh_info3600rdisp/max_vb_serverrdisp/vb_included_serverrdisp/vb_contextrdisp/vb2_contextrdisp/update_max_attempt_nordisp/vb_stop_activerdisp/vb_auto_syncrdisp/vb_v2_auto_syncfalserdisp/auto_vb_stoprdisp/vb_lock_modereleaserdisp/vb_v2_startrdisp/vb_delete_after_executionrdisp/vb_key_comp/HOST/SYNR/WPNR/DATE/TIME/STMP/rdisp/vb_hold_when_inactiverdisp/vb_inline_wait_when_inactiverdisp/vb_async_redispatchrdisp/enqnamerdisp/btcnamerdisp/autoabaptimerdisp/autoabapuserrdisp/autojavauser$(rdisp/autoabapuser)rdisp/autothtimerdisp/autojavatimerdisp/autoccmstimerdisp/vm_alarm_timerdisp/max_dynamic_wp_alive_timerdisp/startup_timerdisp/delayed_call_intervalrdisp/noptimerdisp/nop_methodrdisp/nop_periodrdisp/max_listenerlcom/max_connrdisp/vbstartrdisp/vbdeleterdisp/vbreorgrdisp/vbmailrdisp/vb_mail_user_list$ACTUSERrdisp/vb_key_use_hostnamerdisp/vb_dequeue_after_commit_errorrdisp/max_wprun_timerdisp/max_cmdrun_timerdisp/max_vm_debug_attach_timerdisp/max_vm_sgc_lazy_timerdisp/max_vm_forced_sgc_timerdisp/no_statisticrdisp/time_intervalsrdisp/softcancel_notracerdisp/btc_bad_out_rqrdisp/softcancel_timeoutrdisp/softcancel_sequence10,15,-1rdisp/queue_size_check_valueon,50,30,40,500,50,500,80rdisp/wp_restart_interval5 mrdisp/dynamic_wp_checkrdisp/bufrefmodesendonrdisp/bufreftimerdisp/delete_ddlogrdisp/btctimerdisp/wpdbug_max_nodefaultrdisp/elem_per_queuerdisp/avoidTraceInSigHandlerrdisp/umaskrdisp/sem_recover_levelrdisp/logoff_checkrdisp/reqCheckUseridrdisp/apply_note_1954214rdisp/apply_note_1987707rdisp/apply_note_1913285rdisp/PG_LOCALrdisp/PG_KEEPrdisp/PG_FAST_RELrdisp/rpag_filerdisp/rrol_filerdisp/ROLL_SHM16384rdisp/ROLL_MAXFSrdisp/PG_SHM8192rdisp/PG_MAXFSrdisp/rollin_lockingrdisp/thsend_orderrdisp/system_user_handshakerdisp/remind_force_restartrdisp/suppress_R47_from_icmanrdisp/suppress_R47rdisp/asyncTraceThresholdrdisp/security_context_array_terminationrdisp/security_context_enhanced_tracerdisp/tm_array_traversalrdisp/writeAbapStackOnAdmrdisp/db_reconnect_in_holdvmc/max_stacksvmcj/enablevmcj/max_error_countvmcj/max_inline_sleepsNORMAL=120,ROLL_OUT=10vmcj/cloningvmcj/vm_auto_restartvmcj/sgc_optionsTEMPLATE_CLEANUPvmcj/jni_strategyUSE_MARKUPvmcj/vm_libvmcj/vm_lib_pathvmcj/max_vm_heap_MBvmcj/max_admin_heap_MBvmcj/max_admin_heap_per_vm_KBvmcj/guard_page_numvmcj/vmcContainerClasscom.sap.vmc.bootstrap.Bootstrapvmcj/vmcContainerStartMethodmainvmcj/TRACE_10x0, 0x0L, 0x0vmcj/TRACE_2vmcj/TRACE_3vmcj/poolRfcVmBeforeRollvmcj/vm_shared_lock_statisticsvmcj/nested_lock_loops-1vmcj/max_sgc_exceed_countvmcj/keepAutoJavaVmvmcj/waitForVmTimevmcj/asyncCompilationvmcj/write_corevmcj/sgc_after_importvmcj/deleteVmIfSoftCancelvmcj/dynamic_options vmcj/option/cp/ad$(DIR_VMC)/lib$(FILE_SEP)$(DIR_JKIT)/libvmcj/option/traceThreadIdvmcj/option/traceVmIdvmcj/option/percentageYoungGenvmcj/option/percentageMinOldGenvmcj/option/ss256kvmcj/option/ps512Mvmcj/option/maxJavaHeap200Mvmcj/option/jit/sharedCodeCacheSize32Mvmcj/option/gc/sharedWaterMark0.0vmcj/option/percentageSharedClassesvmcj/option/percentageCopyOnlySCvmcj/option/debugPortRange8000-8100vmcj/property/SAPVMvmcj/property/CLASSES.BASE$(DIR_VMC)/libvmcj/property/APP.REPOSITORIESvmcdb:vmcj/property/vmc.config.file$(DIR_VMC)/config.propertiesvmcj/property/java.protocol.handler.pkgscom.sap.vmc.classload.impl.protocolvmcj/property/java.io.tmpdir$(rdisp/workdir)$(DIR_SEP)jtmpvmcj/restrictedPackage_0com.sap.vmcvmcj/restrictedPackage_1vmcj/restrictedPackage_2vmcj/restrictedPackage_3vmcj/restrictedPackage_4vmcj/restrictedPackage_5vmcj/restrictedPackage_6vmcj/restrictedPackage_7vmcj/restrictedPackage_8vmcj/restrictedPackage_9vmcj/start_debug_proxyvmcj/debug_proxy/port55555vmcj/debug_proxy/param_0-Xcp:$(DIR_VMC)/tools/debug_proxy/debug_proxy.jar$(FILE_SEP)$(DIR_VMC)/tools/debug_proxy/sap.com~tc~logging~java.jarvmcj/debug_proxy/param_1com.sap.rdebug.proxy.BackendJ2EEvmcj/debug_proxy/param_2-kernelPropertiesvmcj/debug_proxy/param_3$(vmcj/debug_proxy/cfg/fileName)vmcj/debug_proxy/param_4-logConfigvmcj/debug_proxy/param_5$(DIR_VMC)$(DIR_SEP)tools$(DIR_SEP)debug_proxy$(DIR_SEP)logging.propertiesvmcj/debug_proxy/param_6 vmcj/debug_proxy/param_7vmcj/debug_proxy/param_8vmcj/debug_proxy/param_9vmcj/debug_proxy/cfg/generatevmcj/debug_proxy/cfg/fileName$(vmcj/property/java.io.tmpdir)$(DIR_SEP)backend.propertiesvmcj/debug_proxy/cfg/listenportdebugproxy.listenport = %dvmcj/debug_proxy/cfg/logleveldebugproxy.loglevel = INFOvmcj/debug_proxy/cfg/allowedPortsdebugproxy.allowedPorts = 8000, 8001, 8002, 8003, 8004vmcj/debug_proxy/cfg/defaultPortdebugproxy.defaultPort = 8000vmcj/debug_proxy/cfg/waitTimeoutdebugproxy.waitTimeout = 30000vmcj/debug_proxy/cfg/strategy_jarsdebugproxy.strategies.jars = $(DIR_VMC)/tools/debug_proxy/debug_proxy_strat_eclipse30.jar , $(DIR_VMC)/tools/debug_proxy/debug_proxy_strat_eclipse31.jarvmcj/debug_proxy/cfg/msHostms.host = $(rdisp/mshost)vmcj/debug_proxy/cfg/msPortms.port = $(rdisp/msserv)vmcj/prof/directory$(DIR_DATA)$(DIR_SEP)profilingvmcj/prof/maxAgevmcj/availability/file$(DIR_HOME)$(DIR_SEP)VMCavailable.logvmcj/availability/interval1Hvmcj/availability/enablevmcj/recenterrors/file$(DIR_HOME)$(DIR_SEP)VMCrecenterrors.logvmcj/recenterrors/enabledynp/luw_id_formatslic/use_bufferslic/high_availableslic/activate_serverslic/buffer_entries_dig_sigslic/netid_serversslic/serverhostslic/serverportslic/server/reconnect_intervalslic/server/keepalive_intervalslic/server/request_timeoutas4/dbmon/enableas4/dbmon/classicas4/dbmon/memory_sizeas4/dbmon/central_collectoras4/dbmon/output_schematerm/tm_classTERMnobuf/max_no_buffer_entriesnobuf/max_attemptsnobuf/max_attempts_mtxnobuf/servernobuf/trc_objipc/shm_os_key_bottomipc/shm_os_key_top20999ipc/shm_malloc_reserveipc/shm_psize_10200000000ipc/shm_psize_20ipc/shm_psize_40110000000ipc/shm_psize_501048576ipc/sem_os_key_bottom20000ipc/sem_os_key_top29999ipc/sem_pr_count78ipc/sem_vr_count19ipc/sem_gl_countipc/sem_mon_recipc/sem_mon_levelipc/evt_os_key_bottomipc/evt_os_key_top3999999ipc/evt_pr_countipc/evt_pr_set_countipc/evt_vr_count79ipc/evt_gl_countipc/msq_os_key_bottom40000em/blocksize_KBem/global_area_MB96em/initial_size_MB4092em/max_size_MBem/address_space_MBem/use_emode_mappingem/address_space_emode_MBem/stat_log_size_MBem/stat_log_timeoutem/as4/max_free_listem/execute_protectionem/mm_diagmodeeg/mm_diagmodeem/max_dump_lines6291456em2/implementationmapeg/max_pointers_registeredeg2/max_extend_size_MBeg2/small_object_sizejvmx/blocksize_KB$(es2/blocksize_KB)jvmx/max_global_heap_extend_size_MB$(eg2/max_extend_size_MB)jvmx/mtx_yield_countjvmx/mtx_spin_countes/filename_prefixes2/filename_prefix$(es/filename_prefix)es2/blocksize_KBes2/initial_size_MB256es2/disclaimLeveles2/use_external_file_mappingES/TABLEUNIX_STDEM/TOTAL_SIZE_MB262144ES/SHM_SEG_COUNTES/SHM_SEG_SIZEES/SHM_PROC_SEG_COUNTES/SHM_USER_COUNTES/SHM_BASE_ADDRES/SHM_SYS_FREE_MAXES/SHM_SYS_INIT_SEGSES/SHM_FLAGS3620866ES/SHM_DISC_BLOCK_PER_SEGES/SHM_DISC_SEGMENTSES/SHM_DISC_SEG_INIT_CNTES/SHM_DISC_SEG_MAXES/SHM_DISC_SEG_MINES/SHM_DISC_BLK_MAXES/SHM_DISC_BLK_MINES/SHM_IDLE_SEGMENTES/SHM_MAX_PRIV_SEGSES/SHM_MAX_SHARED_SEGSenque/process_locationOPTIMIZEENHA_Identifiernoneenque/table_sizeenque/fast_tableenque/deque_wait_answerenque/backup_fileenque/report_fileenque/statistics_fileenque/log_fileenque/loggingenque/delay_maxenque/server/acl_filerdisp/enq_serv_resetenque/disable_replicationenque/replication_failed_cmdenque/replication_dllenque/repl_val_fileenque/async_req_maxenque/top_list_lengthenque/use_pfclock2enque/delay_jitter400enque/delay_log_levelenque/delay_log_timeenque/delay_max_refineenque/query_condenseenque/lock_owner/checkenque/lock_owner/rabaxenque/serverhostenque/serverinst$(SAPSYSTEM)enque/server/threadcountenque/server/replicationenque/server/replication_localenque/server/replication_dllenque/server/replication_thread_countenque/server/replication_multi_threadenque/server/max_request_sizeenque/server/max_requestsenque/server/max_clientsenque/server/max_query_size131072enque/server/max_query_requestsenque/server/response_reduce_percentage85enque/server/use_spinningenque/server/exit_on_cleanup_failenque/server/codepage$(install/codepage/appl_server)enque/con_retriesenque/con_timeoutenque/server/req_block_size$(enque/server/max_request_size)enque/server/req_block_count$(enque/server/max_requests)enque/server/query_block_size$(enque/server/max_query_size)enque/server/query_block_count$(enque/server/max_query_requests)enque/server/internal_replication$(enque/server/replication)enque/encni/max_fragment_countenque/encni/hostname$(enque/serverhost)enque/encni/bindhostenque/encni/portsapdp$(enque/serverinst)enque/encni/threadcount$(enque/server/threadcount)enque/encni/max_clients$(enque/server/max_clients)enque/encni/select_timeenque/encni/timeoutenque/encni/repl_port5$(enque/serverinst)16enque/enq-queue/use_spinning$(enque/server/use_spinning)enque/enq-queue/spincountenque/enq-queue/sizeenque/repl-queue/use_spinningenque/repl-queue/spincountenque/repl-queue/sizeenque/adm-queue/use_spinningenque/adm-queue/spincountenque/adm-queue/sizeenque/enrep/keepalive_countenque/enrep/keepalive_timeoutenque/enrep/store_sizeenque/enrep/req_block_countenque/enrep/poll_intervalenque/enrep/poll_timeoutenque/enrep/poll_timeout_maxenque/enrep/inactive_actionsleepenque/enrep/stop_timeout_senque/enrep/stop_retriessapstart/lockfilerslg/alert_filter_paramsalert/MONI_SEGM_SIZE60000000alert/TRACEalert/MTELOGLEVELalert/MTELOGFILTERalert/MTTREEalert/ALERTSalert/PERFHISTalert/cache/size_MBalert/max_mtes_per_autoabap_runalert/GREEN_ALERTSalert/RESCALE_PERF_MTE_UNIT_0alert/RESCALE_PERF_MTE_CLASS_0alert/RESCALE_PERF_MTE_UNIT_1alert/RESCALE_PERF_MTE_CLASS_1alert/RESCALE_PERF_MTE_UNIT_2alert/RESCALE_PERF_MTE_CLASS_2alert/RESCALE_PERF_MTE_UNIT_3alert/RESCALE_PERF_MTE_CLASS_3alert/RESCALE_PERF_MTE_UNIT_4alert/RESCALE_PERF_MTE_CLASS_4sap/bufdir_entriessap/bufdir_count_limitsap/buf_sharednobatch/logfilebatch/altlogfilebdc/protocol/errorforceendbdc/bdel_auth_checkabap/slin_intcheckabap/table_sharingabap/warn2error_release700abap/test_generationabap/deferred_generationabap/string_sharingabap/activate_precompiled_headersyntax-checkabap/comp_diagnosticabap/compile_mult_passon,demandabap/pxasharedabap/unicode_checkabap/extrsynabap/pxaclients32abap/rsyntextln180000abap/buffersize300000abap/programsabap/check_program_buffer_consistencyabap/objmgr/tracelevelabap/shared_objects_size_MBabap/string_cache_size5839abap/functiontraceabap/formatabap/dumponerrorabap/use_max_bcdabap/no_sapgui_rfcabap/hostname_for_sapguiabap/timeoutabap/ignore_iccabap/message_outputabap/sourcedir$(DIR_SOURCE)abap/saptrapabap/editor_fileabap/warningsabap/superopenabap/timedatabaseabap/protfileabap/p_a_typeabap/package_checkabap/package_check_exceptionsabap/package_check_versionabap/maximal_defenv_sizeabap/parallelismabap/hotspot_traceabap/aciinternalabap/apg_settingsabap/force_local_update_taskabap/rabax_no_debugabap/dyn_abap_logabap/dyn_abap_log_storage_days27abap/dyn_abap_log_deletion_rowsabap/import_char_conversionabap/use_pagingabap/use_mmabap/cache_areaabap/no_dsql95ADA ALL DB4 DB6 INF MSS ORA SQL SYBabap/initrc_degreeabap/atrapathabap/atrasizequota30000abap/atra_split_trace_fileabap/memory_inspector_fileabDbgMemoryabap/memory_inspector_files_limit_MBabap/fieldexitabap/heaplimit40000000abap/aab_log_field_size_limitabap/heap_area_diaabap/heap_area_nondiaabap/heap_area_totalabap/nondia_allocation_sequenceabap/swap_reserve20000000abap/locale_ctypeCabap/SIGCHILD_defaultabap/pclose_at_rolloutno_waitabap/path_normalizationabap/path_norm_Windows255abap/rtm_high_water100000000abap/scmon/request_entry_pointabap/rtm_memory1_size160000abap/rtm_memory2_sizeabap/rtm_memory3_entriesabap/sqlm/main_switchabap/sqlm/roll_memory_size100000abap/sqlm/replace_request_n0REQ=URL,PATT="/\~[^/]*",REPL="/\~[..]"abap/sqlm/replace_request_n1REQ=URL,PATT="([0-9]|[A-F]){32}",REPL="[..]"abap/sqlm/replace_request_n2REQ=URL,PATT="(19|20)\d\d[- ]?\d\d[- ]?\d\d[ ]?\d\d[: ]?\d\d[: ]?\d\d([,.]\d{7})?",REPL="[..]"abap/sqlm/replace_request_n3abap/sqlm/replace_request_n4abap/sqlm/replace_request_n5abap/sqlm/replace_request_n6abap/sdf_sblm/main_switchabap/restricted_dset_openyesabap/list/listparserabap/list/printQuickInfosabap/authority_to_catch_for_debuggingdebug_changeabap/allow_tabhid2_ovflzdate/DSTswitch_contloctimezdate/contloctime_tracerfc/wait_rolloutrfc/signon_error_logrfc/reject_expired_passwdrfc/dump_connection_inforfc/dump_client_inforfc/cp_convert/ignore_errorrfc/cp_convert/conversion_char0023rfc/wan_compress/threshold251rfc/option_listrfc/reduce_tracelevelrfc/disable_debugger_command_fieldrfc/prefer_rfcdesrfc/set_standard_destinationrfc/enable_trfc_dbg_user_switchrfc/inb_sched_resource_thresholdrfc/callback_security_methodrfc/disable_gui_for_external_rfcrfc/use_gwstartrfc/selftrustrfc/mdmp_activerfc/allow_internal_dest_patternucon/rfc/activerfc/apcrfc_rabax_errorrfc/apcrfc_emergency_mode_andFFFFrfc/apcrfc_emergency_mode_or0000rfc/apcrfc_min_versionrfc/xrfc_conv_error_replacerfc/intticket/modehttp/intticket/moderfc/intticket/validityhttp/intticket/validitybgrfc/loadbalancing/auth_checkbgrfc/context_check/auth_checkbgrfc/supportability/auth_checkbgrfc/extern/auth_checkbgrfc/disable_integrity_checksec/ral_enabled_for_rfcicf/max_handle_keyhttp/systemcallicf/accept_remote_profile_levelicf/dump_connection_infoicf/option_listicf/reject_expired_passwdicf/accept_remote_recorder_levelicf/accept_client_recorder_levelicf/accept_client_profile_levelabap/ext_debugging_possibleicf/shared_memory_cache_officf/set_HTTPonly_flag_on_cookiesicf/user_recheckicf/ssocookie_mandatorystat/filestat/levelstat/indexstat/bufsizestat/compressionstat/checksstat/tabrecstat/tabrec_tcode_0stat/tabrec_tcode_1stat/tabrec_tcode_2stat/tabrec_tcode_3stat/tabrec_tcode_4stat/rfcrecstat/sporecstat/tiintrecstat/btcrecstat/adrecstat/dbprocrecstat/httprecstat/smtprecstat/vmcrecstat/esirecstat/dbconrecstat/eppitemrecstat/versionstat/as_filestat/as_levelstat/as_bufsizestat/as_max_initstat/as_collectstat/as_max_files48stat/as_use_hypind_lockingstat/correct_processing_timestat/recex/memory_checkstat/rfc/distinctstat/rfc/distinct_depth$(stat/rfcrec)stat/webservicerecstat/trexrecstat/plausi_overdrawn_resptimestat/clocksap_clockstat/normal_clockstat/runtime_clockstat/max_filesstat/round_factorstat/umask022stat/externalize/enabledstat/externalize/regdir/usr/sap/tmp/extstateu/filenameeu/controlled_modificationeu/iwb/help_typeeu/iwb/installed_languageseu/iwb/path_maceu/iwb/path_os2eu/iwb/path_unixeu/iwb/path_win16eu/iwb/path_win32eu/iwb/server_maceu/iwb/server_os2eu/iwb/server_unixeu/iwb/server_win16eu/iwb/server_win32reorg/filelogin/system_client000login/fails_to_user_locklogin/fails_to_session_endlogin/password_expiration_timelogin/password_history_sizelogin/password_change_waittimelogin/password_change_for_SSOlogin/min_password_lnglogin/min_password_difflogin/min_password_digitslogin/min_password_letterslogin/min_password_uppercaselogin/min_password_lowercaselogin/min_password_specialslogin/password_charsetlogin/password_hash_algorithmencoding=RFC2307, algorithm=iSSHA-1, iterations=1024, saltsize=96login/password_compliance_to_current_policylogin/password_downwards_compatibilitylogin/no_automatic_user_sapstarlogin/failed_user_auto_unlocklogin/disable_cpicauth/rfc_authority_checkauth/trfc_no_authority_checkauth/no_check_in_some_casesYauth/authorization_traceauth/tcodes_not_checkedauth/object_disabling_activeauth/new_bufferingauth/check/calltransactionauth/shadow_upgradeauth/su53_buffer_entrieslogin/create_sso2_ticketlogin/accept_sso2_ticketlogin/ticket_expiration_time8:00login/ticket_only_by_httpslogin/ticket_only_to_hostlogin/ticketcache_offlogin/ticketcache_entries_maxhttp/security_context_cache_size2500http/orphaned_sec_context_copy_cleanuplogin/disable_password_logonlogin/update_logon_timestampmlogin/password_max_idle_initiallogin/password_max_idle_productivelogin/password_logon_usergrouplogin/disable_multi_gui_loginlogin/multi_login_userslogin/isolate_rfc_system_callslogin/certificate_request_ca_urlhttps://tcs.mySAP.com/invoke/tc/usercertlogin/certificate_request_subjectCN=&UNAME, OU=&WPOU, O=mySAP.com User, C=DElogin/certificate_mapping_rulebasedlogin/show_detailed_errorslogin/server_logon_restrictionlogin/quiet_modersec/securestorage/keyfile$(DIR_GLOBAL)$(DIR_SEP)security$(DIR_SEP)data$(DIR_SEP)SecStoreDBKey.psersec/ssfs_datapath$(DIR_GLOBAL)$(DIR_SEP)security$(DIR_SEP)rsecssfs$(DIR_SEP)datarsec/ssfs_keypath$(DIR_GLOBAL)$(DIR_SEP)security$(DIR_SEP)rsecssfs$(DIR_SEP)keyrsdb/trace_modulesrsdb/rdarsdb/ssfs_connectrsdb/ntab/entrycount200000rsdb/ntab/ftabsizersdb/ntab/irbdsizersdb/ntab/sntabsize15000rsdb/statonrsdb/stattimersdb/rclu/opt_levelrsdb/max_blocking_factorrsdb/min_blocking_factorrsdb/max_in_blocking_factorrsdb/min_in_blocking_factorrsdb/max_union_blocking_factorrsdb/min_union_blocking_factorrsdb/prefer_joinrsdb/prefer_union_allrsdb/prefer_fix_blockingrsdb/prefer_in_itab_optrsdb/tb/preloadrsdb/cua/buffersize3000rsdb/cua/mutex_nrsdb/obj/buffersizersdb/obj/max_objectsrsdb/obj/large_object_size512000rsdb/obj/mutex_nrsdb/esm/buffersize_kbrsdb/esm/max_objectsrsdb/esm/large_object_sizersdb/esm/mutex_nrsdb/otr/buffersize_kbrsdb/otr/max_objectsrsdb/otr/mutex_nsmc/mconrec/clientrec/empty_stxx_as_white_listdiag/tc_column_checkdynp/checkskip1screendynp/confirmskip1screendynp/usrmaskingabap/advanced_listmaskingdynp/xsrf_testerrsdb/rep/fast_touchrsdb/reco_trialsrsdb/reco_sleep_timersdb/reco_add_error_codesrsdb/reco_max_refusedrsdb/oracle_sid_standbyrsdb/oracle_host_standbyrsdb/reco_ping_cmd/etc/ping hostname 64 2rsdb/reco_tcp_serviceloginrsdb/reco_sosw_for_dbrsdb/reco_sync_all_serverrsdb/vmcj/codepage_compatibilitydbs/ora/tnsname$(SAPSYSTEMNAME)dbs/ora/tnsname_standbydbs/ora/schemadbs/ora/array_buf_sizedbs/ora/use_hintsdbs/ora/stmt_cache_sizedbs/ora/register_appl_infodbs/ora/close_stmt_after_execdbs/ora/_retry_on_sql_errordbs/ora/_retry_sql_timedbs/ora/substitute_literalsdbs/ora/dbsl_iuuc_end_transaction_hookdbs/ora/trace_tablersdb/MB_CUR_MAXrsdb/dbhostrsdb/dbiddbs/inf/stmt_cache_size225dbs/inf/array_fetch_offdbs/inf/select_buffer_size67584dbs/inf/cursor_insert_offdbs/inf/insert_buffer_sizedbs/inf/free_cursor_offdbs/inf/blob_truncation_offdbs/inf/optmsg_leveldbs/inf/optofc_offdbs/inf/stmt_cache_reset_timedbs/inf/stmt_cache_reset_sizedbs/inf/schemadbs/ada/dbrootdbs/ada/dbservicesql6dbs/ada/maxlocksdbs/ada/logsegmentsize49990dbs/ada/schemadbs/ada/dbsl_iuuc_end_transaction_hookdbs/hdb/stmt_cache_sizedbs/hdb/input_parametersdbs/hdb/cmd_buffersizedbs/hdb/stmtlngdbs/hdb/max_arraydbs/hdb/dbsl_iuuc_end_transaction_hookrsdb/dbhomersdb/as4/db_connect_typeSOCKrsdb/as4/keep_dbperf_datadbs/db4/opticonnectdbs/db4/install_no_cmtctldbs/db4/max_hostvarsdbs/db4/dbsl_buffersizedbs/db4/dbsl_iuuc_end_transaction_hookdbs/db4/dbsl_tracedbs/db4/allow_canceldbs/db4/rdbnamedbs/db4/dbsl_alternate_packagedbs/db4/parallel_alter_tablesdbs/db4/parallel_alter_instancedbs/db4/driver_typedbs/db4/xdn_portdbs/db4/xdn_trace_filedbs/db4/dbcurs_dump_cursdbs/db4/dbcurs_dump_tabQDB4CURSORdbs/db4/dbcurs_keep_time14dbs/db4/concurrent_accessdbs/db4/sql_deflate_tabledbs/db4/use_lock_queueDIR_LIBRARY_RMT$(DIR_CT_RUN)dbs/db2/plannamedbs/db2/ssid_standbydbs/db2/ssiddbs/db2/icli_trusted_connectionsdbs/db2/hosttcpdbs/db2/con_profile$(DIR_GLOBAL)/connect.inirsdb/db2jcl_libraryrsdb/icli_librarydbs/db2/use_hintsabap->1dbs/db2/sql_trace0,ALLdbs/db2/cli_tracedbs/db2/cli_trace_dirdbs/db2/net_statsdbs/db2/usersapr3dbs/db2/schemadbs/db2/use_wlmdbs/db2/use_accountingdbs/db2/use_define_nodbs/db2/genericdbs/db2/applcompatdbs/db2/dbsl_iuuc_end_transaction_hookdbs/db6/optleveldbs/db6/dbsl_cstracedbs/db6/dbsl_cli_tracedbs/db6/dbsl_tracedbs/db6/dbsl_trace_dirdbs/db6/dbsl_trace_stringdbs/db6/dbsl_trace_iocountdbs/db6/dbsl_trace_str_lendbs/db6/dbsl_trace_timedbs/db6/dbsl_trace_deadlock_timedbs/db6/dbsl_dyn_notificationdbs/db6/schemadbs/db6/bw_stats_on_tmp_tablesNdbs/db6/bw_keep_hierarchy_viewsdbs/db6/ccms_maintenancedbs/db6/dbsl_iuuc_end_transaction_hookdbs/mss/serverdbs/mss/dbnamedbs/mss/schemadbodbs/mss/packet_sizedbs/mss/conn_optsdbs/mss/client_awaredbs/mss/select_asteriskdbs/mss/dbsl_profiledbs/mss/update_with_updlockdbs/mss/par_stmt_preparedbs/mss/dbsl_iuuc_end_transaction_hookdbs/syb/serverdbs/syb/dbnamedbs/syb/portdbs/syb/schemadbs/syb/packet_sizedbs/syb/sql_tracedbs/syb/par_stmt_preparedbs/syb/odbc_tracedbs/syb/tds_capdbs/syb/dbsl_iuuc_end_transaction_hookdbosc/cm/sap_signature_verifytransport/tp_loggingtransport/systemtypeCUSTOMERtransport/during_upgradeSDM_HOSTSDM_SYSNRSDM_HTTP_PORTSDM_ADMIN_PORTSDM_GUI_PORTWP_IDldap/autoregisterldap/optionsDirType=NT5ADSldap/serversldap/saprdnldap/namingcontextict/odata_compatible_urlsict/exclude_compression*.zip,*.rar,*.arj,*.z,*.gz,*.tar,*.lzh,*.cab,*.hqx,*.ace,*.jar,*.ear,*.war,*.jpg,*.pdf,*.gzip,*.uue,*.bz2,*.iso,*.sda,*.sar,*.gif,*.png,*.swc,*.swfict/min_compression_sizeict/max_form_fieldsict/disable_cookie_urlencodingict/allow_space_before_colonis/HTTP/virt_host_0*:*;is/HTTP/virt_host_1is/HTTP/virt_host_2is/HTTP/virt_host_3is/HTTP/virt_host_4is/HTTP/virt_host_5is/HTTP/virt_host_6is/HTTP/virt_host_7is/HTTP/virt_host_8is/HTTP/virt_host_9is/SMTP/virt_host_0is/SMTP/virt_host_1is/SMTP/virt_host_2is/SMTP/virt_host_3is/SMTP/virt_host_4is/SMTP/virt_host_5is/SMTP/virt_host_6is/SMTP/virt_host_7is/SMTP/virt_host_8is/SMTP/virt_host_9is/HTTP/default_root_hdlj2eeis/HTTP/lb_capacityis/server_nameSAP NetWeaver Application Serveris/server_version7.22icm/HTTPS/client_certificate_chain_header_prefixSSL_CLIENT_CERT_CHAIN_icm/HTTPS/client_certificate_header_nameSSL_CLIENT_CERTicm/HTTPS/client_cipher_suite_header_nameSSL_CIPHER_SUITEicm/HTTPS/client_key_size_header_nameSSL_CIPHER_USEKEYSIZEis/HTTP/show_detailed_errorsis/HTTP/show_server_headeris/HTTP/server_headeris/instname_encodingis/use_udsis/use_IPv6is/hostbuffer_timeout_valid_entryis/hostbuffer_timeout_invalid_entryis/socket_buffer_sizeicm/min_threadsicm/max_threads250icm/min_spare_threadsicm/listen_queue_lenicm/req_queue_lenicm/max_socketsicm/max_connicm/log_levelicm/accept_remote_trace_levelicm/wp_roll_timeouticm/wp_mpi_availableicm/max_servicesicm/max_pluginsicm/keep_alive_timeouticm/HTTP/client/keep_alive_timeouticm/conn_timeouticm/failover_timeouticm/ccms_refresh_rateicm/ccms_monitoringicm/host_name_fullicm/trace_secured_dataicm/cancel_strategyicm/security_logLOGFILE=dev_icm_sec,MAXSIZEKB=10000icm/max_timeout_wpicm/stacksize_KBicm/no_keepalive_rollouticm/plugin_0icm/plugin_1icm/plugin_2icm/plugin_3icm/plugin_4icm/plugin_5icm/plugin_6icm/plugin_7icm/plugin_8icm/plugin_9icm/authfile$(DIR_GLOBAL)$(DIR_SEP)security$(DIR_SEP)data$(DIR_SEP)icmauth.txticm[ABAP]/HTTP/file_access_0PREFIX=/sap/public/icmandir/,DOCROOT=$(DIR_ICMAN_ROOT),ARCHIVE=$(DIR_EXECUTABLE)/ITS.SAR,CACHECTRL=+28800,MAXAGE=+28800icm[DS]/HTTP/file_access_0PREFIX=/sap/public/icmandir/,DOCROOT=$(DIR_ICMAN_ROOT),ARCHIVE=$(DIR_EXECUTABLE)/ITS.SAR,CACHECTRL=+28800icm[J2EE]/HTTP/file_access_0icm[SMDA]/HTTP/file_access_0icm[]/HTTP/file_access_0icm[ABAP]/server_port_0PROT=HTTP,PORT=0,TIMEOUT=60,PROCTIMEOUT=60icm[J2EE]/server_port_0PROT=HTTP,PORT=5$(SAPSYSTEM)00,TIMEOUT=60,PROCTIMEOUT=600icm[DS]/server_port_0icm[SMDA]/server_port_0icm[]/server_port_0icm[ABAP]/server_port_1PROT=SMTP,PORT=0,TIMEOUT=120,PROCTIMEOUT=120icm[J2EE]/server_port_1PROT=P4,PORT=5$(SAPSYSTEM)04icm[DS]/server_port_1icm[SMDA]/server_port_1icm[]/server_port_1icm[ABAP]/server_port_2icm[J2EE]/server_port_2PROT=IIOP, PORT=5$(SAPSYSTEM)07icm[DS]/server_port_2icm[SMDA]/server_port_2icm[]/server_port_2icm[ABAP]/server_port_3icm[J2EE]/server_port_3PROT=TELNET,PORT=5$(SAPSYSTEM)08,HOST=localhosticm[DS]/server_port_3icm[SMDA]/server_port_3icm[]/server_port_3icm[ABAP]/server_port_4icm[J2EE]/server_port_4icm[DS]/server_port_4icm[SMDA]/server_port_4icm[]/server_port_4icm[ABAP]/server_port_5icm[J2EE]/server_port_5icm[DS]/server_port_5icm[SMDA]/server_port_5icm[]/server_port_5icm[ABAP]/server_port_6icm[J2EE]/server_port_6icm[DS]/server_port_6icm[SMDA]/server_port_6icm[]/server_port_6icm[ABAP]/server_port_7icm[J2EE]/server_port_7icm[DS]/server_port_7icm[SMDA]/server_port_7icm[]/server_port_7icm[ABAP]/server_port_8icm[J2EE]/server_port_8icm[DS]/server_port_8icm[SMDA]/server_port_8icm[]/server_port_8icm[ABAP]/server_port_9icm[J2EE]/server_port_9icm[DS]/server_port_9icm[SMDA]/server_port_9icm[]/server_port_9icm/server_port_0$(icm[$(system/type)]/server_port_0)icm/server_port_1$(icm[$(system/type)]/server_port_1)icm/server_port_2$(icm[$(system/type)]/server_port_2)icm/server_port_3$(icm[$(system/type)]/server_port_3)icm/server_port_4$(icm[$(system/type)]/server_port_4)icm/server_port_5$(icm[$(system/type)]/server_port_5)icm/server_port_6$(icm[$(system/type)]/server_port_6)icm/server_port_7$(icm[$(system/type)]/server_port_7)icm/server_port_8$(icm[$(system/type)]/server_port_8)icm/server_port_9$(icm[$(system/type)]/server_port_9)icm/HTTP/j2ee_0icm/HTTP/logging_0icm/HTTP/admin_0PREFIX=/sap/admin,DOCROOT=$(DIR_ICMAN_ROOT)/admin,AUTHFILE=$(icm/authfile)icm/HTTP/file_access_0$(icm[$(system/type)]/HTTP/file_access_0)icm/HTTP/redirect_0icm/HTTP/auth_0PREFIX=/,FILTER=SAPicm/HTTP/mod_0PREFIX=/icm/ms_keepalive_sicm/HTTP/ASJava/disable_url_session_trackingicm/HTTP/server_cache_0PREFIX=/, CACHEDIR=$(DIR_DATA)/cacheicm/HTTP/server_cache_0/size_MBicm/HTTP/server_cache_0/memory_size_MBicm/HTTP/server_cache_0/clearicm/HTTP/server_cache_0/ufo_Listicm/HTTP/server_cache_0/max_entriesicm/HTTP/server_cache_0/max_ufo_entriesicm/HTTP/server_cache_0/max_name_lenicm/HTTP/server_cache_0/ufo_expirationicm/HTTP/server_cache_0/expiration86400icm/HTTP/server_cache_0/ufo_codelist404icm/HTTP/server_cache_0/max_obj_size_MBicm/HTTP/server_cache_0/max_net_frag_sizeicm/HTTP/show_server_headericm/HTTP/max_request_size_KB102400icm/HTTP/error_templ_path$(DIR_ICMAN_ROOT)/error_templicm/HTTP/allow_invalid_host_headericm/HTTP/user_agent_is_browser^(Mozilla|Opera|Eclipse|SAP Web Dispatcher)icm/HTTP/request_timericm/HTTP/context_quotaicm/HTTPS/context_quotaicm/SMTP/context_quotaicm/HTTPS/verify_clienticm/HTTPS/trust_client_with_issuericm/HTTPS/trust_client_with_subjecticm/accept_forwarded_cert_via_httpicm/trusted_reverse_proxy_0icm/P4/max_request_size_KB12288icm/IIOP/max_request_size_KBjavascript/DumpProp__abjsScriptsjavascript/FrameStackjavascript/Optionsjavascript/RuntimeHeap600000javascript/TraceLeveljavascript/TraceSizeitsp/enableitsp/memory_checkitsp/max_eg_mem_percentitsp/MaxFramesitsp/MaxStatesitsp/MaxSubscreenNamesitsp/MaxSubscreensitsp/SearchhelpResultPerPageitsp/TreeNodesPerPageitsp/LocalRepositoryitsp/SAPjulep/MaxExModulesitsp/SAPjulep/MaxHtmlPPsitsp/SAPjulep/MaxExFunctions81itsp/SAPjulep/AutoPreProcinclude("system","","sapxjutil.html");include("system","","sapdiag.html");itsp/SAPjulep/Profilingitsp/Security/allow_designs_fromitsp/Traces/SAPplugin/TraceLevelitsp/Traces/SAPxgdk/TraceLevelitsp/Traces/SAPjulep/TraceLevelitsp/Traces/SAPdiag/TraceLevelitsp/Traces/SAPagi/TraceLevelitsp/Traces/SAPdp/TraceLevelitsp/Traces/SAPalvgrid/TraceLevelitsp/Traces/SAPautom/TraceLevelitsp/Traces/render/TraceLevelitsp/devmode/contextdumpitsp/startokcodeitsp/cachecontrol/maxage43200itsp/ignorefromurlitsp/sessionid_path_positionitsp/Security/ITSAppletPSEjstartup/DIR_CLUSTER$(DIR_INSTANCE)$(DIR_SEP)j2ee$(DIR_SEP)clusterjstartup/DIR_SDM_PROGRAM$(DIR_INSTANCE)$(DIR_SEP)SDM$(DIR_SEP)programjstartup/DIR_SDM_CONFIG$(DIR_INSTANCE)$(DIR_SEP)SDM$(DIR_SEP)program$(DIR_SEP)configjstartup/j2ee_properties$(jstartup/DIR_CLUSTER)$(DIR_SEP)instance.propertiesjstartup/sdm_properties$(jstartup/DIR_SDM_CONFIG)$(DIR_SEP)sdm_jstartup.propertiesjstartup/icm_propertiesjstartup/gw_properties$(DIR_EXECUTABLE)$(DIR_SEP)gw.propertiesjstartup/startup_properties$(DIR_EXECUTABLE)$(DIR_SEP)startup.propertiesjstartup/instance_properties$(jstartup/icm_properties)$(FILE_SEP)$(jstartup/j2ee_properties)jstartup/releasenewjstartup/trimming_propertiesjstartup/trimming_intervaljstartup/security_leveljstartup/protocoljstartup/bootstrapjstartup/bootstrap_on_restartjstartup/debug_modejstartup/start_modeprocessjstartup/environmentjstartup/max_heap_sizejstartup/shutdown_timeoutjstartup/max_errorsjstartup/numProcessesjstartup/numThreadsjstartup/numCachesjstartup/numEntryPointsjstartup/numApplicationsjstartup/numEjbsjstartup/numEjbSessionsjstartup/numRoConnectionsjstartup/numAliasesjstartup/numBrSessionsjstartup/numWebSessionsjstartup/numDebugRecs50000jstartup/numFcaQueuesjstartup/numFcaConnections$(icm/max_conn)jstartup/max_processesjstartup/ignore_console_shutdownjstartup/keep_old_logfilesjstartup/framework_jarsjstartup.jar$(FILE_SEP)jvmx.jarjstartup/wait_for_reconnectjstartup/wait_for_clusterjstartup/native_stack_sizejstartup/vm/debug_params-Xdebug -Xnoagent -Xrunjdwp:transport=dt_socket,server=y,suspend=n,address=%sjstartup/vm/monitor_params-Xdebug -Xnoagent -Djava.compiler=NONE -Xrunsherlok:ConfigPath=sherlok,TelnetPort=%s,TelnetHost=localhostjstartup/vm/ignore_unrecognizedjstartup/vm/trace_atjstartup/vm/home$(DIR_SAPJVM)jstartup/vm/monitoringjstartup/recorder%javaPath%$(DIR_SEP)bin$(DIR_SEP)java -classpath ../j2ee/cluster/bootstrap/sap.com~tc~bl~offline_launcher~impl.jar com.sap.engine.offline.OfflineToolStart com.sap.engine.flightrecorder.core.Collector ../j2ee/cluster/bootstrap -node %nodeID% %startTime% -bz $(DIR_GLOBAL)http/zone_separator~j2ee/instance_idj2ee/scs/hostj2ee/scs/systemj2ee/phys_memsizej2ee/cpu_countj2ee/phys_memsize_percentagej2ee/cpu_count_percentagej2ee/ms/host$(j2ee/scs/host)j2ee/ms/port36$(j2ee/scs/system)j2ee/gw/hostj2ee/gw/port33$(j2ee/scs/system)j2ee/gw/snc/port48$(j2ee/scs/system)j2ee/enq/hostj2ee/enq/port32$(j2ee/scs/system)j2ee/dbdriverj2ee/HTTP/session_DEFAULT_00,7,2,0,1,0j2ee/HTTP/session_DEFAULT_11,4,1,0,1,1j2ee/HTTP/session_DEFAULT_21,4,3,0,0.0001,0.0001j2ee/HTTP/request_DEFAULT_0j2ee/HTTP/request_DEFAULT_10,3,3,0.9,0.01,1j2ee/HTTP/request_DEFAULT_20,2,6,1,1,0.01j2ee/HTTP/request_DEFAULT_30,5,2,0,0.01,1j2ee/HTTP/request_DEFAULT_41,4,1,0,1,0.8j2ee/HTTP/request_DEFAULT_51,3,1,0,1,0.2j2ee/HTTP/request_DEFAULT_61,6,1,0,20,0.5j2ee/HTTP/request_DEFAULT_7j2ee/P4/request_DEFAULT_00,10,2,0,1,0j2ee/P4/request_DEFAULT_11, 1,1,0,1,1j2ee/IIOP/request_DEFAULT_00,11,2,0,1,0j2ee/IIOP/request_DEFAULT_1j2ee/Telnet/request_DEFAULT_00,12,2,0,1,0j2ee/Telnet/request_DEFAULT_1OS_PLATFORMrs6000_64OS_BITLENGTHOS_UNICODEucsecstorefs/DIR_LIB$(DIR_GLOBAL)$(DIR_SEP)security$(DIR_SEP)libsecstorefs/keyfile$(DIR_GLOBAL)$(DIR_SEP)security$(DIR_SEP)data$(DIR_SEP)SecStore.keysecstorefs/secfile$(DIR_GLOBAL)$(DIR_SEP)security$(DIR_SEP)data$(DIR_SEP)SecStore.propertiescsi/enablecsi/SAP/csa_lib$(DIR_EXECUTABLE)$(DIR_SEP)$(FT_DLL_PREFIX)sapcsa$(FT_DLL)csi/exceptionvsi/enablevsi/disablevsi/reloadvsi/cache/size_MB128igs/traceleveligs/listener/rfcIGS.$(SAPSYSTEMNAME),$(SAPLOCALHOST),sapgw$(SAPSYSTEM),60igs/listener/http4$(SAPSYSTEM)80igs/mux/ipigs/mux/port4$(SAPSYSTEM)00igs/pw/1/port4$(SAPSYSTEM)01igs/pw/1/lfigs/pw/2/port4$(SAPSYSTEM)02igs/pw/2/lfigs/ip/chartgfwchart$(FT_DLL_SHR)igs/ip/xmlchartxmlchart$(FT_DLL_SHR)igs/ip/bwgisbwgis$(FT_DLL_SHR)igs/ip/imgconvimgconv$(FT_DLL_SHR)igs/ip/zipperzipper$(FT_DLL_SHR)igs/ip/rspoconnectorrspoconnector$(FT_DLL_SHR)ApplianceTypemdm/network_timeoutixml/dtd_restrictionixml/xml_expansion_factor$(DIR_EXE_ROOT)$(DIR_SEP)$(EXETYPE)__1_DIR_EXECUTABLE__2_DIR_EXECUTABLE__1_DIR_SETUPS__2_DIR_SETUPS__1_DIR_BINARY__2_DIR_BINARY__1_DIR_LIBRARY__2_DIR_LIBRARY__1_DIR_CT_LOGGING__2_DIR_CT_LOGGING__1_DIR_ATRA__2_DIR_ATRA__1_DIR_SORTTMP__2_DIR_SORTTMP__1_DIR_EXTRACT__2_DIR_EXTRACT__1_DIR_PAGING__2_DIR_PAGING__1_DIR_ROLL__2_DIR_ROLL__1_DIR_RSYN__2_DIR_RSYN__1_DIR_GRAPH_EXE__1_DIR_GRAPH_LIB__1_DIR_SAPUSERS__2_DIR_SAPUSERSdbms/namersdb/passwd_fileFN_WORKPRCFN_TERMAFN_SPFN_LOGFN_COLLECTORgraph/ucfgSAPSYSTEMNRSYSNRNRSYSNAMENAMESYSCODEPAGESYSSEPARATORDBHOSTSAPHOSTHOSTMSHOSTDIAHOSTPROFILEPFSAPTRACETRSAPTRACE_COMPSTRACE_COMPSTR_COMPSSAPEXETYPEEXEWORKPROCESSESWPWPDIAWPBTCWPVBWPVB2WPENQWPSPOWPRESTRICTEDINSTANCEICERDISP/BUFREFMODEBUFREFMODEBUFJ2EE_INSTANCE_IDJ2EE_MSHOSTJ2EE_MSPORTJ2EE_ENQHOSTJ2EE_ENQPORTIBYESKBIBkbIBKkMBIBmbIBMGBIBgbIBGgSAPPARAM700SAPPARAMMSIDIB%5.5d%ssapparam: "%s": must not be in "%s" IB%ssapparam: parameter "%s" not found. IB%ssapparam: parameter "%s" empty. IB%ssapparam: "%s": "%s" <--> "%s" %ssapparam: Duplicate Profile Parameter "%s" %ld%ssapparam(10): line or value too long sapparam(11): mallocIBIBM $(DIR_EXECUTABLE)$(DIR_SEP)icm.properties =%ssapparam(12): %s = %s recursive. %ssapparam(14): %s (ref.by %s) missing. IB%ssapparam(13): %s = %s recursive. %ssapparam(15): %s: '%c' missing. IB GetDsSpec.: %s %s %s IB%ssapparam(?): %s = %s recursive. IBGetDsCtrlSAPonUNIXSAPonNT\SAPonOS2xSAPonOS400IBsapparam: target not implemented in Function GetDsSpecIB%s%s DatasetSpec...: %s $(%s)/$(%s)DEFAULT.PFLr%ssapparam(9): environment variable $%s format error. IB%ssapparam(1c): No Profile used. %ssapparam(2): fopenU("%s","r")%sNo Profile used. %ssapparam(18): %s: line %d starts with illegal byte sequence IB%ssapparam(17): %s: line %d illegal byte sequence in name IB%ssapparam(6): %s: missing '=' in line %d IB%ssapparam(16): %s: line %d illegal byte sequence in value %ssapparam(7): %s: line %d is too long sapparam(5): reallocIB%ssapparam(18): %s: reading canceld after %d illegal bytes %ssapparam: SAPSYSTEMNAME neither in Profile nor in Commandline IBsapparam(3): malloc%ssapparam: sapargv(argc, argv) has not been called! sapparam: gethostname() failedIBsapparam: malloc for cmdline-parameters=>IB%ssapparam: commandline argument too large =IB"" IB%dIB%ssapparam: too many commandline arguments %ssapparam: too much commandline arguments. IBpf=START_IB%s/%s/tmp/rbIB%s%d_%d_%d.pflIBwbIB @(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_get.c#1 $ SAP@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_get.c#1 $ SAPIBInvalid UTF-8 encountered by freadU16 (fileno 0x%x)u16_get.cIBInvalid UTF-8 encountered by getsU16IBM IBMInvalid UTF-8 encountered by getInvalid UTF-8 encountered by fgetsU16 (fileno 0x%x)Invalid UTF-8 encountered by fgetcU16 (fileno 0x%x)Too many invalid UTF-8 in fgetcU16, no more error message will be written for %d secondsIBMfgetcU16 error counter resetnlsui3.cIBMunameU16IBMwname->sysnameISAP_SYS_NMLNIBMwname->nodenamewname->releaseIwname->versionIwname->machineIreaddir_rU16IBMentry->d_nameIBMAX_PATH_LNreaddirU16Iw_rc.d_nameopendirU16Icdir_nameIB--IB%s: option requires an argument -- %c IB%s: illegal option -- %c getpassU16IpassUIBMAX_PASSWD_LNIBpromptCMAX_PROMPT_LNIBgetgrgidU16gr_name_bufMAX_GRNAME_LNIBgr_passwd_bufIBMAX_GRPASSWD_LN&gr_mem_buf[i * MAX_GRMEM_LN]IBMAX_GRMEM_LNIBMMAX_GRMEMBERSIBgr_mem_buf@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_cty.c#1 $ SAP@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_cty.c#1 $ SAPv,?@@??/`?#m^##=@/ % 3_??======?????_>/P>`w<???_? ?@@??/`?#m^##=@/ % 0_??======?????_>/P`>`w???_? UUԪN$1)Q-*UR@) ?/*ꪪ???@?D0???????9m^9;9=ÿ=`=@`==/_%;3?_?======???????G?~???]?_0UUUUUUUUUT+UUUJUUUUUUUUT@TUUUUUUUUPUUUUUUUU?UUUUUUUUUUUUUUUUUUUUUUUUUUUUU??>'8 =P@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_tol.c#1 $ SAP@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_tol.c#1 $ SAPIBIllegal base %d in strtolU16IBMu16_tol.hIBE07%5.5d000SAPPARAM(rslg/local/file)_or_rslginit_missingSAPPARAM(rslg/send_daemon/pid_file)_or_rslginit_missing0000010100000000IBrslgwr1(27): wrapping SysLog file does not end. IBrslgwr1(15): Cannot get access to SCSA. IBrslgascs(25): SysLog block in SCSA already exists. <init>IBrslg/max_diskspace/localIBirIBrslgwr1(20): rstrbopen cannot open pre-existing SysLog file. rslgwr1(21): Searching for overlap point in pre-existing SysLog file... IBrslgwr1(22): rstrbseek cannot seek pre-existing SysLog file. ---rslgwr1(23): rstrbseek cannot seek pre-existing SysLog file. rslgwr1(28): Scan did not find anything. 00000101%10.10drslgwr1(16): I cannot get addr of SCSA. IBrslgwr1(17): There is no SysLog block in SCSA. rslgwr1(24): invalid SysLog block offset in SCSA. IBrslgwr1(26): Version of SysLog block in SCSA still zero. I'll wait rslgwr1(18): Version of SysLog block in SCSA should be %d but is %d ! IBRSLGSHM too oldrslg/local/fileE002711IBrslg/new_layoutisuaIBrslgwr1(11): rstrbopen cannot open SysLog file. IBrslg/send_daemon/pid_filerslgwr1rslg/send_daemon/autostartIBrslg/send_daemon/exe_fileSAPPARAM()missingIBSysLog: IB :rslgwr1(19): rstrbseek I/O error. IBrslgwr1(14): rstrbfl_flush I/O error. IBrslgsendrstrcc(1) ALARM: monitored SAP_INT at %08lx IBrstrcc(1) is %08lx(=%ld) IBrstrcc(1) but should be %08lx(=%ld) rstrcc(2) ALARM: monitored SAP_RAW at %08lx IBrstrcc(2) is %02x (=%d) IBST01IBrstr????IBRSTRAC?? rstrw1bufrstrw1rfcrstrw2rfcwriteStatisticIBReturncode: %d (%*.*s)IBReturncode: %dIB Contents of corrupt recordIBContents of wrong recordIBContents of corrupt record unknown record typeunknown error***IBM IB)k -.%01ld4m8YK-.%02ld ěS-.%03ld =p -.%04ldfffffffg-.%05ld-.%06ld-0.%06ldIB0.%*ld%ld %ldIB%ld.%*ldIB%ld.%06ld%2d.%02d.%04d IB%2d:%02d:%02d.%0*ldIB%2d:%02d:%02d.%06dContLoctLocaltimeCont_Rdst not defdstnon dstonIBoffoldutczdate/DSTswitch_contloctimeNULLIB%02d.%02d.%4d %02d:%02d:%02d %sIBContLoctGetTimezoneIndex: check index %d, bottom=%d, top=%d, count=%d IBContLoctGetTimezoneIndex: Got Index %d: start %ld end %ld %s ContLoctGetNextSwitch: no time stamps before 1.1.1970 possible ContLoctGetNextSwitch: isDst = %d IBContLoctGetNextSwitch: did not find next DST switch IBContLoctGetNextSwitch: next switch: %s, isDst=%d, offset=%ld, time table index %d IBUTF %s - local %s, time offset %d IBtime Map [%d]: %ld - %ld , offset = %d %s IBlocaltime_cont: error creating time table. |klocaltime_cont: no time stamps before 1.1.1970 possible IB%s: result pointer is NULLIBContLoctLocaltimeCont_R: No time zone information, switch to UTC Time: %ld, UTC %s - local continous %s - local native %s IBM Recursive call of localtime_cont at %lu IBContLoctMktime: No time zone information mktime: %ld, input %s - reverse check %s IBmktime_cont: got NULL from localtime(&t) gettimeofdayIBsap_clock*** ERROR => bad %s variable >%s< IBPFCLOCKFunction pfclock uses: %s IBfffffffgྂmiK/Function PfRuntimeClock uses: %s Function PfSetRuntimeClock uses: %s IBFunction PfSetStatisticClock uses: %s IBPFSTATCLOCKFunction PfStatisticClock uses: %s Function PfSetClock uses: %s LC_ALLLC_CTYPELC_NUMERICLC_TIMELC_COLLATELC_MESSAGESLC_MONETARY<environment><query>**ERROR**%lu sec%dIB%s,%ssetlocalenlsui6.cIBMvexeclU16IBcpathIBMAX_PATH_LNargs[argno]clenMaxMAX_PARAM_NUMBERIBMargsIBMexecvpU16IBcfileIBexecveU16IBexecvU16IBMvexeclpU16IvexecleU16SAPARGCSAPARGVsapsbgp(5): Strange %d parameters: "%s" IBsapsbgp(1): Cannot start background process IBsapsbgp(2): waitpidsapsbgp(3): waitpid --> %d 0640SAPPARAM(scsa/create_daemon/exe_file)missingIBscsa/shm/keyIBscsa/shm/size%04oIBscsa/shm/permsapscsa(1): shmget(SCSA)IBsapscsa(3): shmdtscsa/autocreateinstall/uidsapscsa(5):%d: I am "%*.*s", but should be "%*.*s". IBsapscsa(6):%d: But that will be ignored. scsa/create_daemon/exe_fileSAPARGCSAPARGVsapscsa: system(%s); sapscsa(4): sapgparam("SAPARGV") too long IBsapscsa(10): SCSA not useable. scsa/shm/startIBsapscsa(2): shmatsapscsa(7): magic is 0x%08lx but should be 0x%08lx sapscsa(8): version is %08ld but should be %08ld (non-Unicode exe running against Unicode SCSA?) IB (Unicode exe running against non-Unicode SCSA?) @(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_InStrm.c#1 $ SAP@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_InStrm.c#1 $ SAPIBM @(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_InCon.c#1 $ SAP@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_InCon.c#1 $ SAPIBu16_InCon.c0640E12sapcscsa(5): recursive call IBscsa/shm/keyIBscsa/shm/sizescsa/shm/startIB%04oIBscsa/shm/permsapcscsa(1): shmget(SCSA)sapcscsa(2): shmgetsapcscsa: SCSA defined. sapscsaId == %ld == %08lx perm == %d IBsapcscsa(3): shmatIBsapcscsa: SCSA attached at address %08lx sapcscsa: SCSA initialized. IB%*ldIBSCSAIB?E15E11E10 ?IBnot accessibleIBsapcscsa(4): shmctl(%ld,IPC_RMID,) =p TRUEFALSEError detected in file info blockfi_magic != RSTRBMAGICIBinstall/umask________ Info about open buffered file __________ IBAddress of controll block itself...... 0x%08lx Just for safety....................... %10ld .................. Contolling the file .......... IBHow to cut the file in slices......... %10ld Byte offset within file, where the IB operating system_s cursor is........ %10ld UNIX error code of last operating IB system action....................... %10d IBDo a direct location. (else seq.)..... %10.10s End of file flag...................... %10.10s This file may be written to........... %10.10s This file may be read from............ %10.10s This file is used Trace internal. IB So dont trace its accesses.......... %10.10s Controll block was alloc.by RSTRB..... %10.10s UNIX file descriptor.................. %10d IB................ Contolling the buffer .......... IBAddress of internal buffer............ 0x%08lx Address where data starts in that..... 0x%08lx Address of next byte to access IB within buffer....................... 0x%08lx Length of allocated buffer............ %10ld Number of data bytes currently IB stored in buffer.................... %10ld Byte offset within file corresponding IB to byte 0 in internal buffer........ %10ld Buffer is filled with valid data...... %10.10s Buffer contents was modified.......... %10.10s Buffer was allocated by RSTRB......... %10.10s ------------------------------------------------- rstr bin. dump : %s %s (addr.: %p) IB%6.6d|IB%2.2x%s IBError detected in file info blockfi_magic != RSTRBMAGICE00%*ldIB7222711IB20.18 IB%ldSAPUSERnoTCIBTTIBDISPLAY IBsanlsui2.cIBMgetpwnamU16c_nameIMAX_PWNAME_LNIBpw_name_bufpw_passwd_bufIBMAX_PWPASSWD_LNpw_gecos_bufIBMMAX_PWGECOS_LNIpw_dir_bufIMAX_PWDIR_LNIBMpw_shell_bufIBMMAX_PWSHELL_LNIxdr_stringU16IBchbufferIBMstr_sz1+1IBwch_bufferIstr_sz2+1IB*spgetservbyportU16IBMs_proto_charIBMMAX_SERVPROTONAME_LNIBMs_name_bufIMAX_SERVNAME_LN&s_aliases_buf[i * MAX_SERVNAME_LN]s_proto_bufMAX_ALIASESs_aliases_bufIBgetservbynameU16IBMcnameIBcprotoIgethostbynameU16IBMh_name_bufIMAX_HOSTNAME_LN&h_aliases_buf[i*MAX_HOSTNAME_LN]IBMAX_IPADDR_LNIBh_lengthIBMMAX_ADDRESSESIBh_addr_list_bufh_aliases_bufIBgetpwuidU16 no TTY IB/dev/E01E02E03fffffffg00000%c%05ld%c%05ld%02d%02d%02dR/3ALLCCMS: SAPHOSTAGENT does not send communication status to CENQU: enqueue log 2.0, (1) base functionalityEasier the usage of certificates with non-ASCII 7bit charsMODIFY SCREEN : check load idPDF converter: Mixed endians for listsProblems with sapstartsrv from Release 7.00 and 6.40 patchRESTGUI: Drag and dropRESTGUI: Last character is truncated from session identifiRESTGUI: Slim State implementationST: forgotten tracesDB400DB4: Incomplete implementation for higher isolation levelIBM i: SQL0502 when using hint single_execution_reuseMSSQLNTSAP's Simple Database Monitor for Microsoft SQL ServerORACLEUndefined values for NULL string (LOB), corr. (2)Undefined values for NULL string (LOB), corr. (3)HDBDownport 7.4x featuresABAP password hash: supporting salt sizes up to 256 bitsABAP-SYCH: Local type in classpool erroneously not foundABAP-SYCH: Wrong evaluation of type compositionABAP-XREF: Wrongly created structure componentArray modifications and table buffer invalidationCPIC: remove forbidden system call popen in HANA environmeCore dump due to signal 11 at RFC layerCrash in logging handlerDB2DB2 z/OS: R3szchk, table size 0 in EXT filesDB2 z/OS: SWPM: SQLCODE -913: ALTER TABLE SVERS ADD PRIMDB2 z/OS: db2radm: Support for lowercase userids sapclinstDB6DB6: db6util -lock2key returns SQL0104DIAG GROUPBOX enhancementDP: SNC active and Syslog R11,R5A, R64DP: initial call to rdisp/early_snc_handshake doesnt workDetermine ADS file extension from TSP0BENQU: enqueue log 2.0, (3) remote nameEXPORT_BUFFER_NO_MEMORY: more infoGW: dynamic profile parameters and gwmonGW: gw/reg_no_conn_info, value 16 during dynamic changeITS Up/Down: js error, when webgui is called in portalITS: 722 WebGUI UpdateIncorrect Average RFC Interface Time in ST03N WJava services are not registered with Java message serverLogon screen and SAPLOGON language: SwitchableMODIFY SCREEN : Check current screenMissing authorization check in BC-VMCPerformance improvement for parallel buffer accessPotential remote termination of running processes in BC-CCPotential remote termination of running processes in [COMPProfile parameter rsts/enqueue/enabled is deletedQR Code: Last characters incorrectR3load improved tracing for SQL statement substitutionsRfcGetData ends up in segmentation faultSHO: free shortly before entering critical sectionSYBASESYB: Database Fault ManagementShortdump RPERF_ILLEGAL_LENG at server side of RFC callbacTH: deeper error handling in batch after ThRqOutCheckTH: sessions stay logged on (master/slave)Terminal leak after error in error handlingUI Masking for printing listsUPE: Bold output of CJK textsUPE: OS/2 table too large in embedded fontUnnecessary Trace Messages in Spool TraceWarning for READ TEXTPOOL INTO readonly-itabAgi personas groupbox, uniqueid, palex et alAvoid DIAG_RFC_EXCEPTION in RSTPDAMAINCore dump in dyResizeSplitter()SAP HA Script Connector LibrarySapcontrol: New timeout optionsSapstartsrv: ReadDeveloperTrace fixSapstartsrv: Reject Start request if already startedSapstartsrv: Used delayed Windows service startup typeSapxpg causes protection errorDB6: patch collection 03/2015Fix wrongly overwritten error message in RfcOpenExOS/400: ExecPWaitForProcess: ignore ECHILDSecurity Audit Log event for unencrypted GUI/RFC connectsMaxUsedLinsz of spool request too bigSapstartsrv: Enhance DIR_GLOBAL registrationSYB: Dump/signal 11 in sybctrl on HPABAP-PH: Fix wrong inheritance of CONSTRUCTORAn improved prefer_join method for FOR ALL ENTRIESCCMS: Monitoring pause or downtime cannot be set or unsetCCMS: Severe logging of NiPConnect errorsFixes in CommonCryptoLib 8.4.35Heap use after free in likey libsST: pftestAvoid erroneous trace entry in ThVBSParamEmmon crashesLocking changeover in ESENQU: minor correctionsEXPORT/IMPORT: always close compression handleError in DBACOCKPIT when statements contain comments withGW: Display of parameter max sleep in wrong formatHandle overflow of tabhStore CounterParallel R3Trans Fix for REPOSRC Loss (Hot News 2147596)Saprouter crashes with active SNC trace when the saprouterTable access to TFO11 and TFO12Wrong User-Generated Stack After a Tolerated Datatype MisaNo Font Embedding into Spool RequestGW: parameter values for name greater 16 chars dont workWrong expansion of generic LANG entries (e.g. LANG CLAS *)Improve debugging with watchpoints (TPDA)Saphttp should support filenames with leading spaceADABASADBC single record insert doesn't return duplicate keyENER: Assure sync is called even if time is fluctuatingError codes for SAP-MANIFEST signature checkGW: Core in cpic lib with SNC and distributed traceNetweaver for HANA and linuxppc64Performance optimization for non-canonical cluster tablesPossible loss of decimal accuracy extracting data on LinuxSORT: file deletionSQL error SQL code -1: Invalid Descriptor IndexSYB IQ: Performance enhancement for LOAD statementTH: init cpicrc in ThSapCMRCVCollect mode switched off (COVDATA access error)Head memory leak block-id CUA__Sy-subrc = 2 when calling AB_GET_CALLERABAP-PH: Fix CONSTRUCTOR creation for empty public sectionBypass of Filter in SAP Internet Communication ManagerChange/Activation/Deactivation of services doesn't work asCrash in NW RFC SDK if Application Server is stoppedDB2 z/OS: Update task stopped unexpectedlyDP: Masses of R47 with error 061 in syslogDisplay width of character U+2500HANA System crashes when running native virus scanITS: P3: setting PERSONAS3 editor formatting option ReadITS: P3:onAfterRefresh is not called on every roundtripNo scrollbar for steploop on popupPersonas: Turn off Control (amodal) based F4 helpRace condition when accessing compression handlesSAP GUI for HTML: Correction to behavior of switch for disSAP GUI for HTML: Expand and collapse OK Code fieldSAP PERSONAS kernel part backportSORT: avoid EXSORT_CLOSE_SORTFILE_REMOVEStore scroll position of dynproAgi contextmenu, focus handling et alCodepage used by taskhandler for error messagesWebgui: fixed Hotkey handling on popupsWebgui: fixed SEGV when dialog appears right after logonWebgui: fixed X.YE+Z notation for floating valuesWebgui: fixed dynamic menu on popupsSHO: avoid memory leak in string handlingDb_cluster_buffer_flush: always all cache items undecidedENQU: EnqConvSrvRespToUni = 128SCOV: avoid corruption of coverage resultsDB6: R3ta causes SQL0802 on very large tables if dbms_typeALV Gridview Control: current cell is not set returned froALV Gridview Control: processEventArgs() : Control with idALV Gridview: MODIFIED event not correctly processed; backALV Gridview: features for SAP Screen PersonasChanges for GOS Container button in the title bar are noDialogControl height is getting smaller after every open/cENQU: minor corrections (april 2015)Fixes in CommonCryptoLib 8.4.36IBM i: Can't release transports via CTSITS HTML Viewer: error, if sapevents with form.submit areITS: Focussing on a disabled checkbox within a tree controITS: Wrong behaviour on tree controls with enabled multi sITS: textedit control readonly optimize trafficITS: textedit text selection adoption for new UR lightspeeITS: toolbar control right align toolbar buttons feature lMoved controls cannot be edited in PersonasMoved controls from hidden tabs crash browserNew unified rendering versionTablecontrol: ENTER key has no effectText in dialog box button is truncated/shorted with ellipsText in input field and texts on buttons are vertically miThe constant height for the status barTypeahead suggestions are not available.UPD: rdisp/vb_inline_wait_when_inactive new default FALSEWeb dispatcher or ICM crashes while running at trace levelError in umode 1 handling for import all and CTC=1ITS: improved Monitoring (RZ20) routinesSapgui profile parameterWebgui: fixed Backend error upon double-clicking SearchHelWebgui: fixed missing HTTP Header fields in ITS contextWebgui: revert of change described in Note 2157777Webgui: some fixes for SearchHelp controlWrong version information is displayed for ICM/WDPSQL Error Message Text for Remote ConectionsDB4: Support for Deflated Tables and Exclusive Lock AcquisSYB: ERROR SQL4096 not enough user connectionsABAP-PH: Fix missing inheritance of CONSTRUCTORABAP-SYCH: Fix missing type resolution for VALUECCMS: Sapstartsrv process hangs after stop actionCheck screen load : Field exitDP,GW: number of registered programs is 0Dropdownlist of combobox for proxies missingENQU: enqueue log 2.0Fullscreen SplitterContainer is not visibleIMPORT_CREATE_DATA: structureless string tablesITS HTML Viewer: error, when sapevents with form.submit arITS Up/Down: Correction is not relevant for patch productiITS: no search help criteria popup after pressing search hIllegal characters in RFC statisticMoved nested tabstripts are displayed twiceRTTI: syntax error exceptionSAP GUI for HTML-Javascript error Object doesnt support...Backend error blocks applicationNew supportbit NO_FOCUS_ON_LISTNo context menu after scrolling in tableScreen load : correct table workarea idWebgui: fixed SID of a Dialog control when Docking enabledWebgui: fixed popup handling in a second imodeENQU: performance, AIXR3load/MaxDB: DbSl Trace: no output buffer for columnDuplicate key on table E071CCCMS: Double entries for the same SID in csmconf fileDefend DOS attack on connection portError message: ThNiOpcodeAddrToName: NiStrToAddr failedFixes in CommonCryptoLib 8.4.37Handling of HTTP pipeline requestsOptimize performance of function module DB_SETGETVMC: SM52 does not show line Memory AllocationMissing gui_fkeyt entriesDB2 z/OS: R3load core if dbs_db2_maxartition is setSYB: start and stop database in HADR environmentAvoid cursor overflow in function DB_SETGETDP: Deadlock in soft cancelKernel support for browser stickiness (SAP note 2038180)Potential loss of buffered data at SAProuter during networST: release sem 9Avoid core in dyGetNextBsdupByArea()Correct transaction statistics for MODIFY operationsDump in SYSLOG detail viewQR Code InitializationReceiving -Maformed saposcol response- error from SAPOscolIXML optimization of runtime behaviorIXML: Do NOT create an inst. upon rollout if none existsIXML: Fix maxExpansion computation.Entries of client dependent customizing tables are not impDB6: patch collection 06/2015SAPFTP segmentation fault on AIXERROR trace: HttpPlugInHandleNetData: server: premature EPotential information disclosure relating to ABAP DebuggerSORT: file deletion without TRCERRSupport of expires header for cache in web dispatcherUser concept conversion using the tool CONVUSRCPTSAP GUI for HTML: Process Batch Input correctionSAP GUI for HTML: Solving 'Invalid GUI input data'Popups in portal are not openedSuggestlist with columns and headerColumns of a dropdown listbox are not properly alignedTab merging is broken with mandatory fieldsDropdownlistbox on initial popup missingITS: toolbar button has wrong background colorRESTGUI: It is not possible to expand disabled nodeAdjustment of scaling factor for sap_corbu and sap_tradeshSteploop on popup not displayed correctlyMoving buttons from/to OMRT toolbar does not workSome icons are missing from TableTreeView controlITS: flavor change indication is not reset for URL start tP3: Entries filter changes are not applied for ComboControProperty's originalActivationId value is not a valid XMLToolbar button style sheet changes made with Theme EditorITS: prefilled native input fields return sometimes differImproved focus handlingLogoff in Portal locks browserDrag and Drop does not work correctly in CJ20NDummy icons are missing in tradeshow designPrefilled value is not applied GuiTextEdit controlError in debug output of a browserScriptnames in script editor missingTS: P3: PERSONAS editor Drop-down List bound onSelSAP GUI for HTML: Object doesn't support property or methodError after selection a flavor with hidden status bITS: P3: onBeforeRefresh scripts are not triggeredSetting a prefilled value on a readonly GuiComboBoxSize changes are not applied in runtime for GuiTextITS: IDA_ALV grid input field find button without button iSize changes are not applied in runtime for GuiTextEdit coControls moved from GuiUserArea to custom group box are noNew way to apply style sheet changes to controls:beginningonActivated event triggerITS: Tree control meta data contains redundant dataPerformance improvement in the date conversion from GregorITS SearchHelp Control : Control still rendered on the sSet correct waitstate for IMCSAP GUI for HTML: Javascript error '_rootwindow'Nested controls are not shownTablecontrol: focus not set on row and column selectionST: CPU time too highITS: P3: onBeforeRefresh triggerType EVENT_ENTER after ENTTablecontrol: Personas changes not correctly appliedALV Gridview Control: Gridview Proxy in Personas does't workALV Gridview: Personas changes not correctly applied and nALV Gridview: select/deselect all only applies to visible roTablecontrol: Select/Deselect all results in an backend erGW: gw/resolve_phys_addr not displayed in SMGWwebgui: fixed selection of custom ComboBoxeswebgui: fixed Not possible to restrict with search patternITS: fixed exception upon failed SearchHelp searchCST: sync high resolution timer (Windows)ITS: improved error description in RESTGUIDP: improve handling of message server sncnameDP, GW: no change of gw/timeout in work processesITS: fixed missing stateCore dump building SQL statementR3load conversions from Unicode to non-Unicode not recommeCore dump building SQL statement (2)Additional trace outputHANA & ABAP: New option to enable/disable FIPS 140-2ICM doesn't work when the first HTTP service has subparameITS Webgui Personas 3: Setting HasIcon property of toolbarITS Webgui: Loading animation still visible on start screeITS: Column resize within tree control doesn't workITS: Tree control item highlighting incorrect when multiplIncorrect backgrund color of ABAPList elementNot possible to hide toolbar buttons on popup windowsNotification about incorrect column reorder operation doesSetting of external theme breaks webgui screenSource code revisionStarting RFC servers takes too longWebGUI Dropdownlist control :Fix for custom dropdown listsCore dump in dyFocusCopy()Endless lock in ESITS: fixed julep/PpioRecoverLocksITS: fixed string escaping in JSON serializationLogin/password_change_for_SSO = 0 ignored with new kernelNo js error for input fields with help button on popupsOnActivated event triggerOra: add policy for oracle 12.1DB6: increase maximum number of external connections to 16Error in certificate parsing kernel methodPreparations Linux 4.x KernelAlthough NO-SCROLLING scrollbar is displayedSupport for SVG filesSYB: DBSQL_DBCNT_MISSMATCHFixes and Features in CommonCryptoLib 8.4.38Linux UUID check: Adaptions for SLES 12Wrong E071-LOCKFLAG update during parallel importSYB: describe for execution of proceduresAsynchronous re-dispatch of update requestsICM crashes when processing outgoing emailsROLL_IN_ERROR after softcancelSmart Linefeed for non-UTF8-filesWrong remote IP address is logged in ICM or web dispatcherDB6: Explain does not find matching optimizer profileCheck session information before each SQL callFixes in CommonCryptoLib 8.4.39Invisible moved controlsNothing happens after click on status bar message in any cSAP GUI for HTML: failed to fire action on displaysizeImprove performance of onload/onafterrefreshMoved enjoy controls are still visible on original placeHistory entries not shown correctlyWebgui crash with empty dockerDB6: ignore warings during array MODIFYGateway crashes while tracing with higher trace levelITS: JULEP: F4 Search help result list shows blank lines oITS: SE80 double click text selection not possibleIts: fixed WP crash caused by Out of memory in big ALVGridWebgui: fixed ITS_SET_CONTEXT from a non-Unicode into UnicJVM crash by SIGSEGVPersonas: Toolbar SID fixed tbar -> shellDB6: SPLITTED LOAD and indexes are created via .SQL FilesHidden OMRT controls should not appear in the screen stateITS UpDown: showdocument with empty parameter keep_fileITS Webgui : F4 multiselect help : double click event doesLIST_PARSER_ILLEGAL_SWITCH after second %PRILoad of SSF default product SAPSECULIBNo busy indicator after entering data in input fieldTablecontrol: column width, resizing and PersonasWebGUI javascript error in IE8Window Image for Theming is not visible after it has beenITS HTML Viewer: documents with sapr3 url not shownITS UpDown: new popup when java does not run in browserWrong request transfer rate calculationA checkbox in ABAPList is partially hiddenCCMS: Extending length of CCMS alert text sent in SNMP traCode injection vulnerability in ABAPError message in the message serverGW: more Info in case of gw startup failureGateway error message from NiStrToAddrMaskUnauthorized modification of displayed content in messageUntyped global FIELD-SYMBOLS with CHANGING VALUESapstartsrv: missing text description for EME/EMF eventsDB2 z/OS: Error: SQLCODE = 0DB4: XDA Fix to 2126327 - SQL Error Message Text for RemoSAPHTTP - Incorrect Content-LenghtE2E trace level low : missing entries in GUI_E2E_TRACESBatch-Input: BDC_RUNNING Parameter BIEND (Kernel Part)RTTC: system areas addedSAPOscol WebService call SendRequest corrupts responseFixes in CommonCryptoLib 8.4.40GW: parameter gw/resolve_phys_addr contains invalid default valueVMC: Improved performance of authorization checkDump DIAG_RFC_EXCEPTIONDB6: AFTER_LOAD property for secondary indexes ignored inR3load HANA: Correction Warning massloader dismatchR3load/HANA Correction SQL-Error 257Enabled AS4FIXFILE to change program objects, parameter nuIBM i: Handling of tool MGTIFSOWN improvedSAP Netweaver SAL incorrect logging of addressesAgisess: uninitialized pointer fieldDuplicate inboud e-mails after SAP Kernel updateDB6: Set CURRENT REFRESH AGE = 0 at connect timePrefer join method using a VALUES clause is not taking effUse connection variables instead of table M_CONNECTIONSError during export: invalid generic selectionDDLADA.TPL: Primary Key Template ADD AttributeSAPFTP unicode charcter conversion in FTP_COMMANDR3szchk stops processing attribute line 'att:'Deadlock in soft cancelNU: Add trace for number range object when mutex cannot beSAL incorrect value used for maximum size per dayImprove handling of invalid dialog step numbersFixes in CommonCryptoLib 8.4.41A GuiLabel is indicated as GuiTextField in personas editorALV Gridview: calculation of height incorrect when a title iBackend Error Occurred - Failed to set value: readonly - aBackend error while tabmerging causes popupsBrowser Title not updated after Personas ChangesCST: minor corrections (september 2015)Changing Icons of ALV Grid Control Toolbar Buttons, settinDefine toolbar child controls as disabled from Home FacetDropdownlistbox on popup is missingENQU: checks for lock ownersHorizontal Alignment for Inputfields and Labels cannot beITS SearchHelp Control : Search Help result grid with pareITS: IDA ALV toolbar controls label is displayed in pixelITS: Right click on tree control discards multiple selecteITS: Right click on tree node doesn't always fire the correcITS: Scroll position within tree control is not maintainedInputfield in ABAPList does not limit input lengthMenu Entries cannot be enabled/disabled and no custom TextNew design for SAP GUI for HTML in SAP_BASIS 700/701No effect after making custom changes on GUI Actions andNo icon option does not work for GUI Actions and SettingsPersonas 3.0: Tooltip for StatusbarQR-Code bug: missing UTF-8 encodingRESTGUI: Action TotalClick fails on GridView Cell controlRESTGUI: MaxLength property is missing from GridView EditCRESTGUI: Not possible to change display size out of WEBGUIRESTGUI: Override rules are not applied to TabStrip SelectSAP GUI for HTML: no resize on ListsScrollbar when F4 button is displayedSearchhelp on custom inputfield does not openSetting custom Text for ALV Grid Control Toolbar Buttons hSupport for tabmerging on popupsTH: Minor memory leak in JNITablecontrol: columns are not displayed or work process maThe custom toolbar separator added by user is not shown iToolbar buttons do not work in IE8Toolbar buttons overlap if the width is not big enought toTooltip for OMRT (Enjoy) controls is not setTooltip for Titlebar is not setTooltip for multiline editfieldUsing vector grafics rendering SAP iconsVMC: References of cache objectsTypeahead does not work for fields in subscreensDB4: Unicode Literals in SQL Text not Converted CorrectlyMemory leak of DSQL cursorsITS: fixed viewing of Documents stored on Content serverPersonas: fixed onSelect on ComboBox controlsSuppress ICM trace about setting ABAP releaseR3szchk wrong size for table with fields larger 256 charsCentral CTS: Recommended transport tool versionsA popup makes the personas button disappearALV Gridview: readonly checkboxes can be changedError trace: cuaGetBuffer overflowPrint spool requests > 2GBTablecontrol: horizontal scroll position lost on dialog stTablecontrol: rows are not selected when selection is disaThe maximal character number for user created One-line andWidth changes on OK-code field are not appliedAgfrwork: unchecked return, agisess: uninitialized scalarGW: Minor corrections in gateway executableSapstartsrv: Fix soap_check_permission2 crash on UnixDB2 z/OS: Protect CLIGarbage characters at VARCR3trans may import wrong initial values to newly added fieldCCMS: Running TREX instance reported unavailable, CCMS MonIBM i: Kernel Patch for ILE signal HandlingIncorrect time zone information following change from MSDDB4: Workprocess do not end completelyR3load aborts importing table with large LOB objectsOnClick event is not processedABAP-GEN: Fix potentially unsecure kernel sources (1)ALV Gridview Control: current cell is not always marked asComplete scripting events firingDetect runtime objects with duplicate UUIDsEnjoy controls cannot be resizedITS Search Help Control : Search Help patterns beginning wITS UpDown: applet alternativITS: Double clicking tree item images on tree control leadMemory Inspector: perform. optimization for table linesMore Information on error EgAlloc failedStickyNote Size not correctly set in editor (in 2nd sessioTabmerge of enjoy controls leads to backend errorWebgui: fixed SIDs on AGI popups with personas controls~webgui_icon_toolbar shows Save iconSAP Screen Personas OnCellDoubleClick for ALV Gridview & TALV Gridview Control: Title wraps when text exceeds availaALV Gridview Control: first selected row should be scrolleALV Gridview: invalid input dataITS: Tooltips in header cells of tree controls are not disRestrictions to the maximal number of characters in Text FWindow background color is being applied to the scrollbarsGuistatus load validationALV Gridview: modified cell values appear in wrong columnALV Gridview: row-range selection not displayed when firstPotential false redirection of Web site content in InterneSapstartsrv: Fix ParameterValue function on OS390Invalid characters at end of character strings of type VARDB6: early close INSERT statement on duprecDescribe on a decimal datatype with a large scale valuePSE download on instance startup may not always workSap personas : diag tracesProfile parameter and hint for FOR ALL ENTRIES with VALUESBackground jobs terminate due to TemSe errorsENQU (ENSA): wildcards in queriesMissing reset of Control ID AliasENQU (ENSA): additional traces on shm attachR3ta produces .TPL.TPL entry in the generated command fileR3szchk -s DD -t mss -g mss hangsDIAG GROUPBOX : missing contextmenuDIAG GROUPBOX : missing inputJCo: Support of local DNS cache invalidationCorrections for the ABINDEX hintR3trans crashes with signal 11Fixes in CommonCryptoLib 8.4.43DB2 z/OS: Support for cascaded static accounting in batchAfter import method of preliminary import is not executedMemory leaksignal 11 during import of R3TR VDATR3ta: WHR-conditions contain non-masked quotesEXPORT/IMPORT: always close compression handle 2Last entry in the hostname/service buffer is overwritten bMultiple hints in one MSSQLNT clauseENQU (ENSA): wildcards in queries (2)Dipgntab - enable parallel processing of copy shadow nametSystem standstill: MtxLock EMADMDBSL: Tracing error with Core DumpABAP-PH: Add indirectly referenced types to D010TABCCMS: agents fail to display permitted file content, logicLocal user time during double hourSystemtime is UTCEnable leading blanks in sap shortcutsRSCLTK PERM block trailer defect at cluster table SELECTConversion from byte array to string with code page 6100 sSAL garbage character at the end of terminal IPSpooler: Increase barcode bitmap buffer size to 10 MBAblist5: uninitialized scalar variableDisplay correct filename when creating memory dump fileDB4: SQL0113 during DYNPLOAD ModificationASSIGN ... CASTING TYPE HANDLE and type gcR3load HANA: Create longchar flied as blob or nvarcharR3load HANA: Migration Targetdb HANA is data lost possibleMaxDB SWPM Installation, log full if table depoolingENQU (ENSA): reset enquelogAPYSIDKRN: Handle orphan dir. trees in customer backupsIBM i: Recognition of SAP HANA and MaxDB clientPotential denial of service in Message ServerTime measurement in taskhandlerBatch-Input Log: Write initiator when proc. in backgroundFix dump in SPAD printer definitionProblems with TA SHMM in embedded SAPGui in ADTRemove the limit on maximum segment size on AIXSource code revision dybisbic.c: Logical vs. bitwise op.Fixes in CommonCryptoLib 8.4.44DB2 z/OS: Key only MERGE with CLI 10.5FP4DB6: CLI overflow in DMO migration phaseDB4: Trace outputs with interchanged textsAPYSIDKRN: Handle filenames with spacesAPYSIDKRN: Don't append comma to created archiveNew Unified Rendering version.SAP GUI for HTML: ~ignore_okcodeSplitter shows wrong cells with width/height of zeroCursor position 0 not recognizedITS Search Help Control : Date type Selection Fields whenMandatory fields block tabmerge processingRESTGUI: Action 'push' does not work on Toolbar OutlookButRESTGUI: GridView is empty after click on total expanderRESTGUI: New operation POST /sapr3 for OCI catalog scenariSAP GUI for HTML: Permanent dialog area settings from URLSM04 displays HTTPS-sessions after logging them offVertical alignment of moved controls[Template for a SAP note that describes a fix that is shipLoop through onload script that changes transactionOnF4 scripts for simple textfield is not calledWebgui: fixed SEGV in CtxtSetValue while uploading a fileWebgui: fixed SIDs of dialog controls hosted on popupsWebgui: fixed itsp/LocalRepository feature on LinuxWebgui: restored ~RG_SCRIPTING context fieldITS UpDown: ITS Filebrowser dialog z-order problemButton moved to Toolbar from Tab Strip changes its locatioColor theme changes are not applied correctly to GUI actiITS: Easy Access Menu with large image cause core dumpNew SAP icon design for sap_bluecrystal theme is set to deNew version of SAP iconsRESTGUI: ModalWindow width and height are zero after setSiRESTGUI: TextEditor value is lost after back-end interactiRESTGUI: UserArea position and size should be adjusted wheSAP GUI for HTML (WebGUI) internal changeSAP GUI for HTML: XML interpretation of logoff pagesWrong Format for Date Picker Input FieldLocal events on proxies force backend errorOnClick script interferes with onload/onafterrefreshOnload script blocks url parameterWebgui: fixed SearchHelp selection options in julep caseWebgui: fixed dropdown menus on OMRT toolbar buttonsCrash with controls moved to collapsible areaEqual keys and values in dropdown listboxFocus not set correctly after open/close of popupIncrease of connectionsJS-error in tree and gridview after textedit manipulationRESTGUI: Segmentation fault when requesting state for ContRegression: Prefilled value is returned by control inspectSAP GUI for HTML: correct version differencesSAPSAP GUI for HTML: No complete processing of Batch InputITS: performance optimizationCCMS: Cannot maintain properties of MTEs from J2EE contextCustom buttons added to the toolbar overlap after font sizENQU: syslog in ERSITS SearchHelp : Enter event on search expression field peLSX download doesn't workProblem with ABAP debugger activation with terminal IDR3load export, NULL values in DecFloat columns cause AVALV Gridview Control: columns rendered too smallALV Gridview: text in cells with icons is not displayedApplying a Theme can result in a System Core Dump.Changes to Visibility and Tooltip of the StatusBar have noCustomStyles of some controls are applied to additional coF4 Help in Text Edit: Enable Search, but do not set TextJavaScript error with Gridview, Tree or Textedit on PopupLimitations to the Text Length of Multi-line Text Fields hMM memory leak block-id DIAGOCMultiple RadioButtons selectable if Group contains a read-No fixed columns in Gridview and Table via SAP Screen PersOnCellDoubleClick in Gridview and Tablecontrol must refresPersonas Scripting: Custom styles do not supersede those oPushing EnterButton in StandardToolbar does trigger incorrSetting a Password Field to Read Only does not have an effTablecontrol: Focus is not set on row selection in ChromeTablecontrol: focus on row selection with empty first cellUser inserted controls may cause performance issues.WebGUI: JavaScript error on DoubleClick in ALV Gridview anLoading animation is always displayedALV Grid Control Toolbar cannot be hiddenEnhanced error message when loading ICU shared librariesSwitching a Tabstrip displays empty panelSAP Node.js 0.12 Patch Collection 0ITS UpDown: ITS Filebrowser dialog terms translation[WebGUI is frozen on initial startSubscreens (GuiVContainer) do not support colors and backgDB6: dynamically enable/disable netstatis collectionMap SQL returncode -4023 to unknown objectAccessibility of Transaction Code Field: No Show/hide ButtBackend error after several scroll operationsGW: Improvement of trace informationHiding docker cell blanks screenHiding the ContextMenu has no effectITS UpDown: ITS Popups instead of window prompt boxesITS: ABAP documentation link do not openITS: PERSONAS 3.0: memory leak in tabstrip processing flavOnload scripts are not executed while script recordingPrerequisit correction for CERTRULE to support EMail logonProblems with timezone buffer for down-under time zonesProcess stops working on particular toolbar settings (ITS)RESTGUI: Size and position are not calculated correctly foSAP GUI for HTML dialog area on new DIAG implementationSAPup installation of first temp license sometimes failsST: DB connection name (default)Screen is not refreshed after OnSelect() event of ComboboxStyle sheet changes for Docking Container are not appliedTabchchange with popup can break tabmergeVisible hidden tab after popup on proxyDiag : CALL_FUNCTION_NO_GUI_BUFFERNew agi interface GetXmlBlobTablecontrol: missing column checkWebgui: fixed Week53 in calendar controlJava is not restarted after shutdown due to timeout of recFixes in CommonCryptoLib 8.4.46R3ldctle fails with <tabname> is not a DB tableMissing leading zeros in NUMC-CHAR conversionIllegal character on non-unicode systemENQU: too short re-connect cyclesDB4: Package Dispersion with Namespace TablesABAP object access causes OBJMGR_INTERNAL_ERRORDP: Core in Taskhandler Service functionOpen SQL: correct subqueries with <>ANY operatorSAP JVM Crash in VSI create instanceIgnore hint files in R3taOra RAC: startdb/stopdb do not recognize RAC databaseNew feature in CommonCryptoLib 8.4.47Profile-based optimization on Oracle SolarisCentral CTS: Recommended versions of transport toolsEnabling field history for personas custom fields.Flavor is not applied to table with onload scriptKernel patches for code pages, languages and localesOut of memory fix for TemsePersonas Changes for Password FieldsRestricting the number of characters a user can enter intoSAP GUI for HTML Minor Dialogarea CorrectionsSAP Screen Personas Scripting: highlighting virtual controScreen size is not adjustedTemse writes too much trace infoUnauthorized modification of displayed content in WebGUIUnjustified MESSAGE GAF WarningValues lost for Read-only Input FieldsWebSocket: Tracing output for successful execution of codeWrong size calculation for custom themesIac: fixed text upload in IACsITS: fixed SEGV in CtxtSetValue(31 to 32) in non-Unicode cWebgui: fixed SEGV in ReportITSstatictics()ODBC driver restrictions for SQL Server 2016Workprocess exit during SLT replicationVSCAN_RFC: Antivirus not availableCCMS: Missing or not-updated MTE nodes in Java Startup FraMemory overwrite for dynamic parametersEfficient vardata handling in agiIXML: internal codepage changed to UnicodeImprove new ABAP DebuggerSaphttp tracing enhancementAPYSIDKRN: Improved check of archives for other DBMSNo break of tabmerge for normal messagesDB2 z/OS: db2radm add read zparm and additional grants for*** ERROR => agits.cpp 250Open SQL: correct subqueries with NOT IN operatorCCMS: SNMP utilities failing on WinNTPROGID Parameter is cut to 8 characters if copied from theDB4: make statement IDs uniqueSYB: Start database and stop database in an HADR environmeR3loadl and R3szchk: New Oracle feature for database ILM pABAP-PH: Fix Evaluation Order of Base Class[M]*PPC JAVA portal InaccessibleCorrect RFC parameter SNC_PARTNERNAME for two SNC_LIBs atLoss of icm/server_port_XX specific CIPHERS settings on SSPrincipal Propagation from Cloud Connector via RFC failsSCAN ABAP-SOURCE error for list-token with commentCrash in SsfSupGetCommonCryptoLibVersionStringIBM i: Enable OS Release IBM i 7.3vscan_rfc.exe randomly crashesDispatcher and ICM get blockedFix for HPPA compilerSapstartsrv: Missing CCMS agent shutdown on WindowsPotential denial of service in Enqueue ServerSAP GUI for HTML: issue on ~webgui_simple_toolbar=1SAP GUI for HTML: no system buttons/~webgui_simple_toolbarDB6: unexpected VBKEY value found in VBHDRCPIC: new function SAP_CMKEEPALIVE for JCoFixes in CommonCryptoLib 8.4.48Fix DpContextIsActive in case of master-slave scenarioSYSTEM_CORE_DUMPED at parameter->attrIBM i: Message Server and Dispatcher run priority too lowSAP Support Package Stack Kernel 7.22 Patch Level 100Wrong conversion of UTC timestamps with CONVERT TIME STAMPSCS processes crash because ERS system log NWA Heap Dump Analysis: Error while getting server nodesSAL audit log read returns one entry too lessDP: Logon lasts longPotential denial of service in jstartALV Gridview: Total lines not highlighted in dialog boxALV Gridview: undistinguishable background and selection cBackend error with nested proxiesCCMS fixes in kernel binaries: sapstartsrv, sapccm4x, sapcClass 4 driver printCollapsed Sticky Note hides ControlsError with moved fields from invisible subscreenError: unexpected return code 2 calling ins_ddlogFailed Trusted System logon reported as successful logonGW: Names of communication partners are cut offITS Search Help Control : implementation of processing horITS Search Help: Error with search option when there areITS Tree Control: Column Optimization for column tree contITS UpDown: dynamic menu and frontend servicesIn ALV GridView rows get always first visible position aftIntegrity check can be executed on open fileMissing PERSONAS error messages with onload scriptsReorganizing mimes for theme structureSAP GUI for HTML: ~nosplash as GET parameterSAP Screen Personas: Accessibility Texts for Logos in theSetting the maxLength for Password FieldsWebGUI cleanup: remove rowId parameter from GridViewCellIXML: dangling pointer in a cloned node to an documentITS: fixed SEGV caused by a wrong UserAgent (chrome)Sapstartsrv: Fix ReadLogFile endcookie responseSystem_core_dumped when scrolling in acc listWebgui: fixed enabled flag on Checkboxes and RadiobuttonsWebgui: no-history flag respected on AGI Text fieldsXtc: Allow (restricted) use of DTDs in XSLT sourcesDB6: Missing double qoutes in CREATE TABLE statementDB6: Support for tablespace poolsIBM i: Tool Support for Lock Queue and Deflated TablesENQU: minor corrections (january 2016)ENQU: minor corrections (january 2016, 2)Error handling in case of deadlock on table COVREFALV Gridview: Flavor changes not applied when control is rALV Gridview: cells with icons and text may cause a backenALV Gridview: leading spaces are always trimmedALVs containing dropdown list in the cell cause an error wAccessibility Tooltip for Toolbar Input FieldAdditional Texts for SAP GUI for HTMLAmodel F4 help don't display result grid forArbitrary Log File Injection for SAP GatewayCell double click in ALV does not work in SJOBREPOCode injection vulnerability in SAP Internet CommunicationContent Filter match traced wrong dataContent of fullscreen container hidden after browser resizCoredump in ab_regObjUnregister()Correct assignment of scripts to popupsCoverity Check FixDisabled input fields don't show correct colorsDocker cannot be resize after script manipulationEdit moved table in PERSONASGW: Illegal characters in GW Log FileHTTP responses with multi-parts are not parsed correctlyHidden docker hides userareaIMPORT_CREATE_DATA in UC for NUC dataITS Tree: horizontal scrollbar for single column-no headerITS UpDown: WebGUI File Browser menu entry missingITS UpDown: applet alternative for FF, IE, Safari and EdgeITS UpDown: applet certificate validity end date 01/11/201ITS: Item selection and activation in tree control is possImplementation of Sap Table Cell Mode Read-onlyImprove performance of tabmerged controlsImprove popup detection during tabmergeInconsistencies in Personas themesIncorrect expiry date from old licensesLogon not possible with invalid http requestMenu 'System' sometimes still visibleMinor corrections in the logon routineMoved table control cannot be changed anymoreNew Unified Rendering VersionNo backend error with preset values under initial popupNon-ABAP correction is not relevant for patch production.Obsolete state of gridview after tab mergePersonas 3 SAP Toolbar: Buttons are moved to overflow menuPersonas changes not applied for Toolbar Buttons of PopupPopups aren't created in heavy load situationsRectangles with background color for moved toolbar buttonsRemove unused border on popupsSAP GUI for HTML embedded in iframe (Apple Safari only)SAP Screen Personas: Wrong Application of Custom Styles toSAP Screen Personas: no call during system updateSelection of a contextmenu on AbapList returns a wrong lisSuggest response moves focus back to the inputfieldSupport custom template containerSupport transaction based switch of PERSONAS authorizationTable Control: Select Event not fired on select/deselect aTablecontrol: Applying Changes to the Tooltip of Header CeTablecontrol: Backend Error after Changing the Column WidtTheme name from URL is wrongly case sensitiveUser area background changes applied with space around[Onload events after script executionCore in cuaGetInfo()Gui-status: trace entry >invalid LF3 version<Htmlviewer controlled by script causes javascript errorIXML: access to an document that is removed from ABAP GCITS: DropMenu toolbar buttons to support action/3ITS: fixed SearchHelp in IAC modeITS: shellcont == shellcont[0] and vice versaLoop through onload scripts with failed tabmergeOnbeforerefresh event with last focused informationScreen events for popupsTrace entry: WARNING PfSetGuiTime: gui time < backend timeUnnecessary scrollbars due to dropdown listboxWebgui/personas: GuiGridView.selectedRowsAbsolute addedWebgui: fixed SEGV caused by a wrong UserAgentWebgui: fixed front-end service from OMRT popupsWebgui: fixed popup title overwrite over Screen PersonasWindow related execution of start scriptsFormatting error in FOR ALL ENTRIES statements in ST05AS4FIXFILE fails on libraries with 120,000+ objectsChange Journal receiver size option from *MAXOPT2 to *MAXOIBM i: Instance kernel library is empty after SAPCPEE runIBM i: Instance does not start; GetAuth(QSECOFR) Failed (-1DP: disp+work crashes with access violationCorrect table statistics in ST03NICMAN - Redirect page shows server informationLinux on public cloud VM: no SAP licenseMemory consumption in RABAXOpendir() error on WindowsPDF mergerST: componentName is wrong in statdumpSWINCF: Some Problems with List PrintingSystem internal logons are not properly logged in SALUUIDs on AIX are not RFC 4122 compliantAbap list uim for specific fieldsAgisess, agiatoms, agfrwork: uninit memberCleanup RFC layer on ond of transactionFx: empty attribute in basXML has wrong valueRe-enable debugger with async RFC logonSapstartsrv: Fix http logfiles supportScreen generation: memory usageText of checkbox/radiobutton cut offDB2 z/OS: lib_dbsl, allow unload of CLI driver when not coAvoid spool-file generation in APYSIDKRN child jobsIBM i: Instance does not start once after applying a patchR3trans may run slow in parallel import situationsR3trans incorrect transport of TRDIRT entriesR3trans: Duplicate key error during the import of R3TRCDAT, R3TRVDATDB2 z/OS: R3load export, -904, 00C90089, EDM DBD SPACEDB6: Row-organized temporary tables for SPLITTED_LOADDB2 z/OS: Disable cfg file creation when connect.ini existR3ta: implementation of the check_utf8 option for MSSQLENQU: access violation in enqt when no enq srv is runningGEN_INTERNAL_ERROR for expression in complex hierarchyITS: fixed workprocess crash caused by URL-escaping a u (mLogging username of client certificate based authenticatioSapstartsrv: stack overflow vulnerabilityFixes in CommonCryptoLib 8.4.49VMC: Settings in customer configurations not recognizedSaphttp and TCP bufferAvoid core when raising a JCB messageRuntime error PERFORM_NOT_FOUND cause of THEW_LIST_MASKINGR3ldctl crashes processing very large view definitionsUUIDs on AIX are not orderedICM crashes intermittentlyDB4: SAP Host Agent 721/722 Uses Advanced XDN ServerENQU: internal optimizationsCCMS_OnAlert_SNMP_TRAP fails because of quotes in alert teCCMS: MTE node OperatingSystem_Memory_Free has a wrong uCCMS: periodic RFC_EXCEPTION in agent's log file, fixed LoDunning activity run does not delete dunning linesDuplicate client host or IP entries for x-forwarded-for heCorrect forkey check for loop fieldsMissing interface for turn off AgiMenuItemReturn code UNKNOWN OBJECT also used for constraintsMemory allocation sequence for nondia work processesDB6: Not all rows loaded after load resetdictionaryonlyIBM i: Program does not start; error: tcsetattr: Invalid aA new way to apply style sheet changes for controlsALV Gridview Control: cells are not merged horizontallyALV Gridview Control: data not correctly trimmed from deltALV Gridview: styles and maxlen not taken over from deltaAccessibility: Status Bar MessagesAdditional texts for SAP GUI for HTMLBackgroudColor change is ignored for GuiMenuBar in runtimeDisabled Textfields don't show correct colorsError trace during applet startFixed control type for Checkbox and Radio toolbar buttonsGZIP: close stream also in case of exceptionGridview & Tablecontrol: invalid client data when controlGuiHtmlViewer does not handle URLs with SAPR3 prefix set bHTTP form fields cannot be readHTTP form fields cannot be read when using SEARCH_OPTION =Html Viewer: quick clicking results in backend errorITS: Error after choosing a tree context menu itemITS: textedit control get_/set_text_as_r3Table method damaMoved fields are not displayed with wrong inputNested controls of active tabpage missingOnload script execution after initial popupSAP GUI for HTML: sap-browserhistorySAP Screen Personas : resize diag output areaScrolling of moved gridviewTabmerge on local tabstrips confuse active pageToolbarbuttons can not be disabledUser panel width change affects the size of popup windowsWebgui File Browser: different symptomsCorrecting calculation of subscreens containing checkboxesITS: fixed ~templatename to lowercaseWebgui/personas: GuiUserArea type for fullscreen containerWebgui/personas: restored initial values set by PersonasWebgui: ALEWEB_GET_CONTEXT does not work for binary fieldsWebgui: added GuiGOSShell container for GOS buttonWebgui: fixed an error when a GOS container owns a toolbarWebgui: fixed static popup menus on OMRT toolbarsWebgui: no X button on popups which disallow cancellingWebgui: return error on a too long value in ComboControlTablecontrol: Horizontal Scrollbar Position slightly displDouble entries in Application ToolbarTp IMPORTPREVIEW does not finishIBM i: Additional Info at SQL0913Call of macro DBST_ENTER_EXEC_STATIC correctedBackground changes are not applied to the user area if theChanges of style sheet font properties for Group Box are nControls moved out of splitter are not visible in editorDrag and Drop between two ALV GridView controls inside traITS: fixed wrong index in ITS_IMPORT_CONTEXT result tableSAP GUI for HTML: ~webgui_simple_toolbar & 4 not HELP/LOGOSplitter content is emptyStyle sheet changes set to custom input fields via Theme ETypeahead results are not displayed after screen changeWebGUI File Browser: extensions (MIME types) supported forChange tab sequence doesn't workCustom combo boxes do not show empty record as standard coWebgui/personas: fixed SID of a desktop-bound dialog contaWebgui/personas: fixed control type for help windowsSAPCCMS web method GetAgentConfig protectedST: Refused length specification, template application dumNew option -notraceIBM i: Description of command APYSIDKRNSE30: record mismatch for system-exitSE30: trace record inconsistenciesLimit for Memory Inspector SnapshotsCCMS: Sapstartsrv hangs during initialization at instanceSHO: Free pending lockDB6: null termination of SPLITTED_LOAD tablespace nameENQU: enqt, print command lineICM of J2EE server crashes when illegal request is sent toDB6: SQL cache analysis does not show ABAP locationBuffer size for TCP communication sockets to improve transDIAG field namesDriver version check optionalRuntime error SYSTEM_RFC_TLSALLBUFFERSINUSEMissing quickinfo on abap listScreen load: trace outputTLS1.2 support for sldregALV GridView control does not automatically scroll to theALV Gridview: Personas flavor changes not taken over initiALV Gridview: text in cells with icons wrapsBackground color change is not applied to the toolbar sepaExotic language support in kernelFalse automatic dialog area setting on PERSONASFlavor name instead of Flavor Id in the popup menu of theGroup of virtual RadioButtons: Selection reverts to defaulITS Restgui: CUA Menubar and standard toolbar informatio nITS SH Control : Column Widths are not accurately renderedITS: all toolbar separators at end of toolbarImprove error message when SAP Screen Personas initializatMissing cross-reference for function-signatureMonospaced font is used to display dropdown listboxSAP GUI for HTML: No seperated system buttons on ~webgui_iSash not visible after browser resizeSearch focus in ABAP List report not setSize of userarea changes while popup is openTablecontrol: Consistent Behaviour of Select AllTablecontrol: workprocess drop on flavor changeTrusted System ACL check not working after note 2264239Unexpected vertical scroll bar on popups with IE11 and BelWebGUI File Browser: Applet free implementation of the froWrong icons on Session Timeout popup in Fiori lookZ3A Personas: ALV: changing column title does not change tFix regression onload script execution after initial popupSapstartsrv: Call sldreg with profile optionWebgui/personas: RasterLayout used for FullScreen containeWebgui: fixed Uncaught SyntaxError: Unexpected token ILLEGWebgui: fixed to accept the ? character in the SIDsWebgui: fixed weekdays in Calendar Control when a start ofLength error in remote connectionSaphttp and SSL - client ciphersuites configurationAdditional public key for Amazon Web Service Hardware IDENQU: wrong network format in query requestsPoor performance of Simple Transformations with many templWrong cache size is displayed for cache statistics in webIBM i: SUM fails in ABAP phase START_SHDI_FIRSTENQU: interne Optimierungen (lock, wakeup)CL_ABAP_EXPIMP_UTILITIES: MEM_GET_KEYS and MEM_DELETESWINCF: Some Problems with Arabic PrintingGet codepage for taskhandler messageGet field names for non-translation-relevant fieldsScreen generation: memory usage regressionDB4: INSERT with isolation level and concurrent accessDB4: Standalone SAP tools can't switch user using OLD userDisable UPSERTDB2 RADM -m AddAppServerToDB2dsdriverCfgFileDB2 z/OS: addclienttocfgfile multiprocessAPPEND .. SORTED BY does not add any rowsDBIF_RTAB_KEY_ALREADY_EXISTS on AIXSymmetric Encryption with Initialization Vector - KernelITS: fixed control not found error in Portal modeIBM i: Avoidance of errors for code page that cannot be unIBM i: Revision of bundle codingCCMS: Fixed downtime, Log Attribute MTEs, failure of CCMSSYB: sybctrl support of multibyte characters running isqlABAP Debugger: fix problem with interactive system areaCoredump during batch job start (wrong language)GW: wrong hostname in gateway log (field ACCESS)PERM/TASK memory : trace all corrupted blocksSHO: avoid rebuild of areas with restr. lifetime without rWebgui File Browser: improvement of document displaySYB: Implicit conversion from datatype 'TEXT' to 'VARCHAR'Summary size of partitioned segments too smallSIQ: Windows only: Incorrect path is set by dbsl when a muSYB: reconnect in DR or HA environmentABAP Call Monitor for STPIKernel functions to identify CJK languagesLength error in remote connection, 2nd corr.EXPORT/IMPORT USING: avoid exception breakoutDB2Radm not longer supported on OS390DIAG GROUPBOX : invisible framesDelayed print jobs do not print after connection problem tIncorrect Datamatrix BarcodeSYB: startdb/stopdb with hadr setupWebgui: fixed dynamic ContextMenu on ALV Grid Toolbar ButtIPv6 RFC connection using SNC returns empty listSAPINLPGM: Error in multithreaded jobDb metadata of a CALL statementALV Gridview Control: Backend Error in conjunction with aALV Gridview Control: cells are not merged correctlyALV Gridview Control: coloring of readonly cells is wrongALV Gridview Control: focus is not processed correctlyALV Gridview Control: workprocess drops on flavor changeALV Gridview: copy and paste from Excel or Notepad do notAdditional Languages for SAP GUI for HTML: Hindu and KazakAllow empty Host header even when icm/HTTP/allow_invalid_hFlavor changes behind popup missing.Flavor name or Flavor Id in the popup menu of the status bHTTP filter: Exception for individual ICF servicesITS Search Help Cotrol: The incorrect tab is displayed wheITS Webgui SH Control: The value for field Maximum No of HITS: IDA combobox control cause backend errorITS: Some controls may not receive focus events while theyITS: click on node of a SAP IGS (Internet Graphics ServiceITS:Checkbox labels in tree control not displayed monospacIncrease the size of shared memory pools from 32bits to 64Listbox in Tablecontrol: Parameter for displaying Keys areMove of docker sash maximizes dockerMoved toolbar button not visible on other tabMultiple input to moved fields from tab produces backend eNo flavor applied after system errorPicture control in disabled state does not skip onclick evREAD-ONLY Attribute sind als Felder auf einem Dynpro eingaRFC debugging: GUI is not availableSE30: Corrupt trace filesSE30: heavy use of semaphore 51 though no trace activeScrolling of ALV grid in fullscreen container clears pageVH: Parts of the docker are looking out by bringing two saWebGUI File Browser: deleting several files at onceWebGUI File Browser: memory usage: file blobs in listviewWebGUI File Browser: no error popup for privacy modeWebGUI File Browser: tracing improvedWebGUI File Browser: wrong close button behavior in popupsIXML: truncated characters leads to an infinite loopOnBeforeRefresh() event is not fired after clicking on cliWebgui: Fixed text in the Backend error popupWebgui: fixed backend error on F1 in SearchHelp result diaWebgui: fixed control not found error in when called fromWebgui: overlong values accepted in edit fields (and Combo~webgui_icon_toolbar shows no system icon buttonsDBSL: Core dump for tracing, corr. 2DIAG enhancement: batchinput stateFilesystem monitoring crashes on unicode systemsGW: Improve performance during acl file accessGW: small memory leak in gatewayMinimum hostname length on WindowsR3load: MaxDB: sql-error drop unknown dbobjectAPYSIDKRN: fixed errors in hint handlingDB6: inline length 8K for column DCONTENT in TST03DB_SET_ISOLATION_LEVEL: Do not bypass table bufferDisplay width of some mathematical symbol charactersFailed SPNego logon causing core dumpMESSAGE text TYPE type: garbled text displayedFixes and Features in CommonCryptoLib 8.5.2CCMS: No data reported for QueueLength, ErrorsInWpENQ, ErrorFreqInWpENAdditional trace for PDF mergerITS: F4 button press in textedit control show no effectSAP WebGui does not work with IPv6SNC: Remote logon with destination <SID>@BACK@ not workAssembly export not working correctlyALV Gridview Control: doubleclick on a cell may cause a backend errorITS: Drop session on implicit port 443AS ABAP in client role encodes received cookie values with ict/disable Missing personas 1:1 alias mappingWebGUI File Browser: js error during file download with append flagWebgui: fixed missing buttons on popupsWebGUI File Browser: directory not found in file open dialogFlavor switch after screen change is not appliedBackend error for toolbar event with proxies on pageWebGUI File Browser: incorrect filename/foldername in fileAPYSIDKRN may break with empty environment variablesDB4: reopen adjustable via profile parameterAS ABAP in client role encodes received cookie values with ict/disableWebGUI File Browser: directory not found in file open dialWebGUI File Browser: js error during file download with append flag.Webgui: fixed missing buttons on popups when separators arALV Gridview Control: Scrolling On Demand may not load additional rowsDynamic dynpro contextmenu isn't displayedFlavor changes are missing in native GUIsLogon rejection shortdumps in spite of rfc/signon_error_loOpenSQL: Subquery and dyn. Table in Mainquery fails gen.WebGUI File Browser: clipboard import error in firefoxZ3A Personas: onResizeEvent with returnWebgui: fixed GOS container menu with FrontEnd servicesALV GridView: wrong context menu when called on the column header besiCPIC: change of SAP_CMTRACE in cpic libDelete obsolete reference of unneeded iXML libraryEXPORT_TABLE_UPD_CONFLICT,DATASET_CANT_OPEN: improvementsParamters of RABAX in developer traceSPLIT: check overlap also by addition ...INTO TABLEAvoid memory overwrite with ABAP debugger watchpointsIts: fixed context field setting in a non-continuous modeAccess violation when reading NUMC fields in EXEC SQL or ADBCParallel import of a deletion transport failsPDF merger for AIXIXML: Return to UCS-2 encodingMissing Texts in Languages other than EnglishOptions for handling illegal characters in SXML writerWebGUI File Browser: filter selection in file dialogs raises js errorDiag enhancement: spool session activeDB2 z/OS: SIGSEGV in lib_dbsl with dbs_db2_autobindAPYSIDKRN: DSPSAPVERS ILE does not workFixes and Features in CommonCryptoLib 8.5.3Frontend Services: Java applet-free implementation is now default forWebGUI File Browser: change of some display textsAPYSIDKRN: QFileSvr.400: Creation of patches.mf failsSldreg using new option pf=<profile> fails with HTTPSInvalid Parameter in TRMSG-MessageFocus information is lost after pressing button.ENQU: ENSA does not desuspend ERSDIAG trace: flagbit values > 255Do not add session tokens to URLs which don't trigger a requestMmxCheck for block size greater than 4Gb fails when mm_diagmode is seWebgui: fixed invalid 0xA0 character in TextEdit controlFix Memory Leak in Message ServerSAP Support Package Stack Kernel 7.22 Patch Level 200SAP Support Package Stack Kernel 7.22 (EXT) Patch Level 200Transaction based PERSONAS activation doesn't workFixes in CommonCryptoLib 8.5.4Disable input history for multiple line texteditOnBeforeRefresh/onEnter not executed on tableWebgui: fixed hanging GOS menu requestSAP Support Package Stack Kernel 7.22 Patch Level 201Remove double increment of length variableSAP GUI for HTML: Blank page on start of SAP GUI for HTMLIBM i: avoid having atfork handlers after a dlclose.Webgui: fixed SEGV caused by a wrong connect codepage for Vietnamese lFixes in CommonCryptoLib 8.5.5ABAP CONVERT TIME STAMP..: bugfix for 1582 and 9999CONVERT fix Buf entry for start of non-dst in case '?'Regression: Control of type CUA_POPUP_MENU is missing from RESTGUI staScreen generation: memory usage regression 2SAP Support Package Stack Kernel 7.22 (EXT) Patch Level 202ALV Gridview Control: listbox row selection doesn't work with keyboardALV Gridview: Backend Error with F-Key in conjunction with Modified-EvALV Gridview: dump when using and/or switching layouts in SAP Screen PALV Gridview: rendering error when cells are merged across fixed and nAdoption of New NengoAvoid dump ATRA_CANT_OPENBypass SAP_CMKEEPALIVE call for a lower remote GWCoredump in RFC delta managerDIAG GROUPBOX enhancement: get cursorDIAG enhancement GROUPBOX : invalid GUI input dataDIAG trace: invalid first byteDynpro : amount reference fieldFix appending spool requests with POSS optionsFocus on popup missingFrontend Services: locking of frontend services correctedGETWA_NOTASSIGNED when calling ABAP Methods in STsGW: Several Fixes in SAP GatewayITS Restgui - Fixing the units of table treecolumn widthsITS: textedit control method set_selected_textstream end with RABAXIt is not possible to apply transparent color for toolbars with sap-thMissing printer initialization for ADS spool jobsOnSelect event script block double click on gridviewOnload after flavor switch not executed.SAP GUI for HTML: Annoying confirmation popup for TXSAP GUI for HTML: Solve CSRF issueSAP GUI for HTML: Titlebar too highSAP GUI for HTML: ~newwindowattributesSAP GUI for HTML: ~webgui_icon_toolbar 1 != 2SHO: Cleanup after ATTACH_MODE_DETACH_READERService name is missing in trace when it is not resolvable on WindowsSetting of user area top, width and height do not work using Control SSignal 11 while using Java_com_sap_vmc_sec_auth_JTSAuthority_checkPermSticky Note does not show a tooltip, when it is not set explicitStyle class psmbar is not attached to the menu barTabmerge with disabled tab pagesWebGUI File Browser: Chrome: calculation of free space of browser's fiWebGUI File Browser: HTML Local Storage disabledWebGUI File Browser: help text updated.WebGUI File Browser: locking of long running import taskFirst webgui dynpro response is without no-cacheOnload of popup after flavor change not firedPersonas: unable to focus into a table, dragged out of the tab strip pSapstartsrv: support service/admin_groups on WindowsWebgui/personas: fixed ID of custom Personas controlsWebgui: fixed "serialization failed" errorDB4: XDN Jobs remain in system after DB connection close (ILE).IBM i: Out of memory error in NWRFCSDKIBM i: V5R4, APYSIDKRN: Function error X'0306' in machine instruction.R3load bad export performance with many containersR3load/Hana: correction sql-error for fasloaderDB2 z/OS: enable transcational consistent replicationDB4: Reparse Warnings in Developer Trace for MULTI Action TriggorsDB6: RENAME INDEX on virtual tablesDBDS type mapping for SSTRING changedIUUC commit hookSupport storing ABAP client and user in database sessionDB2RADM creates 2 or more logfiles at onceAffinityfailbackinterval improvedMissing agi interface IsSAPBatchinputActiveSapcpe returns success when the file system is full in temcCTS: accumulation of u-modesAgi personas alias: missing special casesAutomatic cleanup of suspended transport requestscCTS: support for operation_mode=proposedDB2 z/OS: R3load use RSCAN hint for export splits by partAiE Debugger does not stop while many WPs in debug modeMemory overwrite for runtime error ITAB_DUPLICATE_KEYDisp+work on AIX with Profile Based OptimizationMore Oracle shadow processes than SAP work processesENQU: ensmon loops endlesslyBroken event handling in quirks modeSYSTEM_CORE_DUMP when parsing a certificateCCMS: Messages from SAP system log classified always with ERROR levelIncomplete Printing on PDF Device Types (mixed Endians)ABAP expression with EQUIV and off/len access yields wrong resultABAP list on popup does not display all dataALV Gridview Control: Changed data is not taken over after dialog stepALV Gridview Control: select/deselect all menu doesn't work with multiCST: validation of parameter names while changingENQU: re-opening of the enqueue logOpen SQL: Correct subqueries evaluating to falseWrong result for FIND/COUNT( REGEX )Soapclient signature removalMTE node 'OperatingSystem\Memory\Free Memory' displays incorrect unitInvalid QR Code in Kanji ModeALV Gridview & Tablecontrol: conditional formatting only when controlALV Gridview Control: key columns and total rows are sometimes not colDocker not visible on popupForm Print Options with Additional Print OptionsITS: Items in column tree control may become unreadable while positionMoved subscreens cannot be editedNew TID algorithm for transactional and queued RFCNew Unified Rendering versionScrolling in gridview in dialogboxSetting the read only property for the native Textedit control via PerStyle class psmenu is not attached to the menu bar itemTablecontrol: Backend error after changing the column orderWebGUI File Browser: file paths with language specific characters incoWebGUI File Browser: js error on double click in listview headerImproved FailbackShort dump in class constructor during object deserializationPDF merge for mapped device typesSAL | paged read does not work reliablyVMC: Wrong UC endianness in external RFC from NUC LE systemSUM Shadow Import: Correct handling of objects that are only partly stored in shadow tablesR3trans does not export all TADIR entries of the objects contained in a transport requestSAPINLPGM does not always evaluate .dbenv.sh of <sid>admDB2 z/OS: lib_dbsl chaining error on single modify stmtDB2 z/OS: CLI seamless failover not detectedCross-Site Scripting vulnerability in SAP GUI for HTMLDP, MS: improve access to MBUFFM NI_ADDR_TO_FQ_NAME doesn't always return FQDNFunction module TH_SERVER_LIST may return wrong IPv4 addresses for appITS Search Help: core dump due to incorrect trimming of a column in reNew default value rdisp/rollin_locking = 1SAP GUI for HTML: Start of BOR object with object key and object dataUPD: Authorizations and printing in updateDB6: database connection using SSL encryptionImprove sldreg tracingDB6: dev trace entries with SYSPROC.ADMIN_REVALIDATE_DB_OBJECTParameter maxincnt is obsoleteTracing of saphttp incomning HTTP dataITS Webgui Tree Control: Incorrect width rendered for optimized tree cJVM crashed -UXP(ouxp006a) App server restartedPersonas: Background image is applied to the window using control specPersonas: Existing title bar/status bar colors are not removed when crSAP Support Package Stack Kernel 7.22 (EXT) Patch Level 201SCOV: fix branch coverage for CHECK SELECT-OPTIONS.SYSLOG Message AB1 not initialized correctlySYSTEM_CORE_DUMP when logging on with X.509 certificateSYSTEM_CORE_DUMPED in kernel function SetCgProgInfoSYSTEM_CORE_DUMPED or misplaced diacritical marks when printing ArabicSash move of replaced splitter produces backend errorSome icons are not correct in SAP_CORBU themeToolbar- and contextmenu on popupWebgui: fixed dynpro context menu on popupsWebgui: fixed submenu handling in toolbar menusFixes in CommonCryptoLib 8.5.6Screen load: check multiple releaseIBMi: Java-Upgrade fails when starting SCS instancesDB6: wrong VALUES CURRENT TIMESTAMP statement executedSaphttp does not fill status_codeMissing GUI status objects, string length errorALV Gridview: errorneous cell merging in first non-fixed columnGW: Minor memory Leak in GWITS: Tree control loses selection status when a popup window opens onSAP GUI for HTML: Javascript error in Internet Explorer on trim() methTREX process crashes in NiISystemErrorRe-enable Job debugging (note 573128, point 3)Webgui/personas: allow HTTP(S) URLs in OMRT Image controlsWebgui: Fixed "control not found" when closing a second dialog boxIASP toolseAvoid core in abTpdaSlave_setSignalAfterAsyncMessImprove access to debug info in EG memoryDB4: Correction for PARALLEL_DEGREE with numeric parameterRZ20: EG Memory not shown in MTE R3BasisSystem / MemoryManagementBinary Data in Datamatrix BarcodeCL_ABAP_AAB_UTILITIES=>IS_ACTIVE: wrong rc in batchDenial of service (DOS) in Dynpro EngineDo not show containers drawn previously on a different scrrenJS-Error with moved dropdown listboxJava Script Engine of ABAP server may become unavailablePrint of Symbol Font with UPERTTI: Describe on interface typeRZ10: import of profiles not possibleTablecontrol: Inconsistent focus handling when pressing ENTERWebGUI File Browser: sorting in file listviewCCMS: SNMP traps sent by auto-reaction method CCMS_OnAlert_SNMP_TRAP_CVSI - Truncation long MIME type listDB2 z/OS: support application compatibility DB2 12R3load cannot convert tables with fiels type VARC to Unicode in upgradCCMS: Cannot activate RFC server trace in sapccmsr, sapccm4x, ccmspingAS ABAP client doesn't encode special characters in formfield nameCorrect memory waste for page admin of internal tablesDIAG GROUPBOX enhancement: set cursorDP: change of db reconnect handling in taskhandlerDP: gw/timeout for monitoring connect to gatewayHTML Viewer: backend error control not foundInstance on AIX 7.2 can not be started by sapcontrol because getpeernaMemory Leak in ABAP Reference Handling with TYPE-POOLsSAP HA Script Connector Library: Interface extensionSE30: wrong calculation of net timeST: Unjustified syntax error for value map with P(0)Avoid core in dyBufferInternalLoopValuesClient proxy support for sldregExternal command breaks off with exception SYSTEM_FAILURESaphttp return compid with missing last characterDB2 z/OS: R3ta improved error handlingCorrection of the license check for Amazon Web Services ChinaFixes in CommonCryptoLib 8.5.7Combobox: Empty Item missingDo not display Docking Containers on wrong ScreensGrid or tree looses focus after roundtripWebGUI File Browser: Safari version identificationWebgui: fixed backend error on too many popupsUser defined HTTP logging with TLS informationSapSSL update to facilitate TLSv1.2-only configurationsAvoid LOAD_NOT_FOUND_AFTER_GEN due to swappingInconsistent secondary table keys after MODIFYNew DIAG supportbitSapstartsrv: Fix crash during trace file truncationWebgui: calendar focus is lost after a backend roundtripWebgui: fixed to support Microsoft Edge browserR3load crashes processing TOC files with short select statementBlanks in fields of type TIMS or DATS are converted to 000000ENSA: additional traces (EncIDoParamReq)Sapnames loggingJaxWS introductionSybase ASE: Database Fault Management: new features and correctionsCorrection of OS version detection for Windows Server 2012R2 and higheSaphttp fails with open ... error: No such file or directoryR3load aborts during a Unicode conversionFixes in CommonCryptoLib 8.5.8ITS Searchhelp: Default values in search help fields cannot be modifieCannot open popups with changed titleFixes in CommonCryptoLib 8.5.10Fixes in CommonCryptoLib 8.5.9Error in HTTP_GET_FILES and HTTP_POST_FILESSAP Support Package Stack Kernel 7.22 (EXT) Patch Level 300Focus lost with PERSONAS after action outside of controlMenuSelect on dialogshell not workingALV Gridview Control: buttons are erroneously displayed in sub-/totalALV Gridview: conditional formatting not applied after scrollingALV Gridview: modified event not triggered after insert, append, dupliDrag and Drop cannot be performed on tree control when node key contaiHorizontal aligned Splitter Controls are not rendered in IE11 with SAPLocal history access causes exceptions due to shortage of available spMake sure the size of a Dialog Box in SAP GUI for HTML does not exceedNew Unified Rendering version for SAP GUI for HTMLTablecontrol: SAP Screen Personas changes to the column width are notVarious fixes for Docking and Splitter-Controls in SAP GUI for HTMLSYB: Adaptation of error handling for MERGE statementsImproved R3ta performance, improve large partition numsImproved R3ta table split performanceImproved R3ta table split performance, large part numbersAGILIB : Gui VersionCCMS: Trace of events in Monitoring Segment with AlertLog, severe RFCCCMS: crash of agent for ViewDirList, transmission error in SM66, tracDIAG Browserversions stringDIAG: fastpath and wan gui connectionDP: Increase constant TH_DELAYED_MAX_ARGLEN for debugging purposesDebugger Patch CollectionDenial of service (DOS) in SAP Message ServerDisable syslog in SM21 for host/service lookupError getting the hardware key on Amazon AWS serverFull access to SAP MMC WEB-ServiceGW: don't stop when Hostname resolution failsGui-Status : own luw generation traceHTTPS traffic is not logged with ms/HTTP/logging_0 parameterHanging spool WPInformation Disclosure in SAP Message ServerList UI Masking: Masking on all PagesLocal IP interface is not identified as being local.Problems with sapstartsrv from Release 7.00 and 6.40 patch 169Runtime error LOAD_TRFO_PROGRAM_MISMATCHSHO Constructor Logon: RUNT_INTERNAL_ERRORVMC: Signal 11 during Mutex lock operationVMC: sporadic RFC_VMC_COMMUNICATION_ERRORWhite text not visible in printer language PCLAvoid LOAD_PROGRAM_LOST for modified programsSupport multiple includes in debuggerTrace PERM/TASK memory listFix default authenticator; Trusted-Library Attribute;Fix for system not shown when sapmc starts via browserENQU: no replication at keepalive problemsCDS objects are not needed for remote connectionsDB2 z/OS: Support of DB2 12DB2 z/OS: avoid dump when Bind and SAPGLOBALHOST is not setDB2 z/OS: map SAP_OSFA_NAME to CLI OSFA_NAMEDB4: Clearer Message Text for SQL0443 and SQL723 Trigger errorsDB4: INSERT triggers on tables with LOBs may cause loss of data.DB4: endless loop at prepareDB6: lock wait on cursor executed WITH RS clauseDB6: schema name in SYSTEM commentExtention of maximum row numberSIQ: Improve error handling if write of IQ load file fails.SYB: Client-side cursor in SAP BW contextTransaction log full in tempdb due to ACTIVE_TRANSACTIONDb4: use SYSRPYL for INQRYMSG in secondary connectionsHint SUBSTITUTE_LITERALS correctedNotice truncation on datatype SSTRINGUpgrade stops in phase TABIM_UPG due to strange SQL errorTransport of deletions: missing synchronisationavoid anonymization of TADIR.SRCSYTEMavoid duplicate key error due to toggled key fieldsSYB: ASE Error SQL17240 - password change on database failsSYB: Start database: dataserver process not foundSYB: start/stop database, improve error handling if environment checksOnActivate event not active while tab mergeUnneccessary scrollbars after userarea resizingABAP bit expression leads to illegal type or runtime errorDIAG trace without timestampsDP: timeout for frontend printingDetermine Hardware ID on Google Cloud Platform (Linux)Determine Hardware ID on Google Cloud Platform (Windows)Fixes in CommonCryptoLib 8.5.12M_LANDSCAPE_HOST_CONFIGURATION only on default connectionSQLDBC_SUCCESS_WITH_INFO is always a warningDebug Authorities and auth/new_buffering = 4GW: SNCERR_INVALID_FRAMEDB2 z/OS: Check if IUUC hook is still used by DbSlDB6: Floating exception for tablespace with zero containersDB2 z/OS: possiblity to specify another pwd file locationDIAG: display/window dimension for rfc connect dataMMC start/stop also create filter in NWSAP Screen Personas: No call during an updateWrong Colors in Composite Spool RequestsCCMS: High frequency of requesting the samphore 38 in SM50CL_ABAP_EXPIMP_UTILITIES=>ITAB_CONVERT: uninit. var.DIAG: invisible pushbuttonsAvoid crash in ThrtDbgInitSystemWideDebugging()Enable users with space in their names for ext. debuggingDBSL Support for SQL Server 2017R3load/MaxDB -readcommited worksDump heap usage only if no more space availableICM crashes due to P4S connection interruptionsBackend error with moved control and actions on otherITS: Tree control scroll position wrong after searching for tree nodeMissing reason in SAL for failed transaction startSAP GUI for HTML turns unresponsive in language HE_ILSupport local scrolling of popupsWebGUI File Browser: CTRL-A, close button, messagebarFixes in CommonCryptoLib 8.5.13AGILIB: Performance optimizationCCMS: AlMsUpload fails while uploading SYSLOG_MAPORA: Core dump for illegal defined secondary connectionUpdating SAP_R3_MIB.TXT for SNMP traps for OS Command Adapter at SAP FDB6: change connect user password on DB2 pureScale systemAssertion Tickets passed wrongly as LOGONTICKET to kernel routinesSHO: error handling if nested mode failsSubsequent error because of empty Connect Info in DBCOAPYSIDKRN misinterprets dw_gui patchFSM: Safari: export to filename "unknown"FSM: files not selectable in file open dialogFixes in CommonCryptoLib 8.5.14SAP Support Package Stack Kernel 7.22 (EXT) Patch Level 400IBM i: SAP System does not start in pure IPV6 environmentIBM i: STARTSAP INSTHOST(*LOCAL) with virtual hosts doesn't start orIBM i:SAP System does not start in pure IPV6 environmentHandling of splitted tables by R3load for MaxDBDB4: enhanced data type support describing metadataInitialization of substitution flagRow count calculation changedSldreg - new profile parameter sldreg/secudir_unsetAGI: new method AgiObj::GetAssociatedObjectBatch-Input log: wrong type for message 00 381CPIC: determine network interface for outgoing connectionsCorrect initialization of USR01 fieldsDIAG: core in diagograph()DIAG: hide help/system menuDIAG: invisible pushbuttons - regressionDo not cache responses with an incorrect content-lengthError in MMX statisticError message MpiFreeBuff in dev_icmError message during tabmerge blocks applicationGW/CPIC: Set parameter SNC_LIB via environment variable is not supportICM handles HEAD response with "Transfer-Encoding: chunked" header incITS Search help: system dump when showing all search fields on the lasMPI buffer usage in FCA with inconsistenciesPotential error while scanning with virus scan adapterSAL | Filter selection by user group does not protocol unsuccessful loSAP GUI for HTML: Cumulative patch UnifiedRendering 1708STPI Blacklist MonitorSpool trace errorVMC: Improved error handling resizing a SharedKeyHashSetWebgui: full-screen OMRT controls get the size of the popup windowSapstartsrv: buffer overrun in GetInstancePropertiesWebgui: fixed backend error in SearchHelp dialogWebgui: fixed dynamic drop down menu on toolbar buttonsWrong trace info for IUUC Commit hookUPE: Gaps after diacritical characters (Courier New)DIAG: context menu of column titleDIAG: resize ztta/diag_areaDYNP: frame resizeMessage server HTTP connection leakSAP GUI for HTML: English text shown in sap-language "bg"Webgui: workarounds for different browsers made possibleDTP batch job shows success when data load is interruptedSYB: SQL error 7725 Cursor was declared with a FOR UPDATE clause. ThisDB4: New DLTOLDPKGS for removing Zombie Single Execution PackagesFixes in CommonCryptoLib 8.5.15ICM / Web Dispatcher log handler files with unexpected log timesSMANIFEST_VERIFY modules with default signature namesSmall Corrections to PDF MergerAvoid trunction on numeric datatypesCore in function systrao()Improved codepage check in DBSLCCMS: RFCOSLIB: Method CCMS_Fsys_Collect_creporting errors: can not fiImplementing an Independent ASP (IASP) SystemJob remains in status Ready and background WP cannot execute DB reconnectCore Dump at Easy Access in ABAP Shared ObjectsNo S_DATASET for COA filesSapstartsrv: register message server https port(s) in SLDCRTSAPDB does not work for user ASPsFixes in CommonCryptoLib 8.5.16DB4: enhanced data type support - part 2DB6: call out script to collect support data after SQL exceptionsDetermine HardwareID on OpenTelekom, Huawei, AlibabaIncorrect audit log entries for CALL TRANSACTION in backgroundNormalization for file namesPossible Heap CorruptionWindows on Alibaba Cloud (IaaS): Adaption of your SAP LicenseInternal / trusted system RFCs not failing despite locked/expired userJQuery updateRe-enable external debugging on current appserver onlyWebgui: provide $System.BrowserName and $System.BrowserVersionDB4: Describe upon a table with more than 16 columns, might result inSIQ: support for IQ odbc driver 16.1SYB: Database Fault Management - Heartbeat reconnect after network ouSYB: password change for ASE administrator syb<sapsid> fails on LinuxDIAG GROUPBOX : overlapping frames and step-loopsWork process crash during restartGW : *** ERROR => failed to open (Invalid argument)SE30: memory overwrite in jump bufferCCMS: Invalid value at MTE OperatingSystem\Filesystems\[fsys name]\Fixes in CommonCryptoLib 8.5.17SAP Support Package Stack Kernel 7.22 (EXT) Patch Level 500DB500Fixes in CommonCryptoLib 8.5.18Fix docking control calculations in Personas 2.0Fix splitter control calculations in Personas 2.0Personas: Labels will not be set to disabled statusSAP GUI for HTML: Cumulative patch UnifiedRendering 1711WebGUI File Browser: option in file save dialog to save to native fileMissing deactivation of SQL stmt, overflow stmt. cacheABAP compiler dumps for DDIC inconsistencyCL_ICU_TRANSFORMATION=>TRANSLITERATE returns additional charactersDIAG GROUPBOX: Frames cut step loopsSE30: record mismatch for message inside conversion exitWrong Handling of Binary Spool RequestsWrong colors if spool request is partly printedScreen load: invalid load tracesIBM i: DLTSAPSPLF fails deleteing more than 10000 Spools.Syslog analysis: rslgview.exe and rslglscs.exe are not available for WAzure SQL Database and Azure SQL Data Warehouse ConnectivityDB6: error handling on connection attempts without passwordMissing synchronization of calendar bufferAGI: Okcode missingCCMS: Accidentally lost MTE node settings, alerts and performance histCPIC: corrections and improvements in cpic libCore in AB_GET_CX_DATADIAG GROUPBOX : loop field inputDump LOAD_PROGRAM_NOT_FOUNDGW: too many TCP/IP connections openMetadata for profile parameter abap/path_normalizationPotential memory corruption on linux optUPrevent High Paging on Windows OS Using The DiscardVirtualMemory() FunSE30: long runtime for SUBMITSecure Storage in the File System: Error SSFS-1400 with text "... (errWrong Security Audit Log entry for failed Callback Whitelist Check forBasXML: unexpected EOF leads to workprocess restartCorrect handling of multiple included parts of an includeUnable to detect correct number of cluster nodesCPIC: accept remote trace level in cpic layerDP: Work process always restarts (II)Fix roll in errorImprove access to anchor arraysSE30: Switch on/off runtime measurement while debuggingDisable debug changes in mode Session_InspectionWrong compare of local host name and explicit host nameAccess violation during workprocess reconnectCollective note for password assignmentEm usage displayed in st02 is higher than actualAGI: Personas Alias HandlingCST: mini trace layer for request flowMMX: Improved double free identificationMinor errors fixedCALL TRANSACTION: ignoring missing authorizationAGI: window dimensionsLogon with valid assertion tickets can fail with RFC/DIAGPXA: introduce guard page to avoid memory overwriteSAPHTTP - extended HTTP body traceABAP kernel sync sporadic missingAdd GuiControlToolBar type to the controlType mappingCalculate sizes for children of a splitter control early in SAP GUI foNUM: number range buffer deactivationNot possible to change rdisp/os_heap_for_restartDB2 z/OS: no need to specify APPLCOMPAT for secondary connectionsDYNP: type ahead request and user mailClient certificate authentication support for SLDREGNo time zone information, switch to UTCNew sapgui profil parameterRestgui: Unsupported property [__added_by_personas_scripting__ : X] inWeb Dispatcher doesn't handle multiple cache-control response headersDB6: incorrect member number in network statisticsDIAG GROUPBOX: missing fieldsDownport Fast RFC SerializationDynp: max dialogbox dimensionRABAX TABLEVIEW_DUP_COLUMN_INDEX if RAL is activeSCMON: performance optimizationsSuppress the output of payload in RFC_NO_AUTHORITYNew version of AS4FIXFILEFastload expert options on SQL Server omitted by R3loadAdditional normalization for file names in virus scanNUM: Improve kernel traces for number range bufferSAP GUI error with message "SID:frontend without SNC received SNC MessSAP GUI for HTML: Cumulative patch UnifiedRendering 1801SAP on AWS: Adaption of your SAP LicenseSapstartsrv: Avoid deadlock in Unix signal handler (nuc)Incorrect display of missing PTF Groups in CHKR3PTFFixes in CommonCryptoLib 8.5.19BUS_ERROR in Fast Serialization Move ModeFast RFC Serialization Move To Different EndianessRFC - memory overwriteSFASTRFCMAINTENANCE is not workingSAP GUI for HTML: Cumulative patch UnifiedRendering 1802SAP GUI for HTML: fix reading initial splitter column or row sizes wheCompatible mode for SLDREG after Note 2553966SAP Support Package Stack Kernel 7.22 (EXT) Patch Level 600Dataloss using TRFC with mixed Unicode/None Unicode DestinationsT/Q RFC with JCo 2 fails with Invalid Protocol VersionABAP Message NavigationABAP-SYCH: Dumped TYPES table has dangling type idsAGI: max size of IO-bufferCCMS: False Alert on R3DeveloperTrace or R3SystemTrace MTECCMS: No method assignment is stored in the DB for Monitoring Object RCCMS: Update of SNMPLIBCCMS: host monitoring in cluster environmentCPIC: Network error not detected with CPIC_PING IICore dump when printing RTL documents with long lines (>256 charactersDIAG GROUPBOX: Missing fieldsEnable PSE creation with CCL algorithms | Kernel partExtracting exception attributes destroys memoryFast RFC Serialization odd NUMC fields from None UnicodeGW: increase default value of gw/monitor_timeoutImprove Debugging of SHM Area ConstructorMaximum file size (MAXSIZEKB) of parameter icm/security_log does not wNUM: Deactivation of the number range bufferRABAX TABLEVIEW_DUP_COLUMN_INDEX if RAL is active (2)SNMPLIB 5.7.1UI list masking does not work for local variables or field symbolsAvoid TABLVIEW_DUP_COLUMN_INDEX with UI-LoggingFxreader: insufficient Unicode supportHANA/MaxDB: Better log output for execute DDL-StatementsHANA: Check for Existing Row in DeltaDB2 z/OS: Ability to switch to another Linux schedulerDB6: OPTGUIDELINES may not be parsed correctlyDB6: hint FAE_JOIN_BLOCKING_WITH_DISTINCTDB6: statement string is blank or emptyDb4: ignore WAIT FOR OUTCOME with old db releasesSLG: Mapping between SAP Messages IDs and MS Windows Event IDsENQU: ERS looses conn to ENSA in state transferImport aborts due to memory shortage when import table entries with large stringsMessage class not visible after transport (missing T100A entry)Missing table entries in SEOCOMPO due to parallel importR3trans import with statistical informationALV Gridview: Delete Row only deletes visible rowsIncorrect canonicalization if payload contains content strings "&apos;SAP GUI for HTML: Cumulative patch UnifiedRendering 1803Destination NONE is not regenerated in case UNICODE setting is wrongFixes and Features in CommonCryptoLib 8.5.20No access to 'exttransdirpath' during exportDB6: row locks on column-organized tables cannot be translated to keySYB: Re-execute statement after sql error 107ABAP UNIT: Avoid incorrect coverageST: huge response times in ST03Fix size (calculations) of dialog boxes in SAP GUI for HTML if the metSAP start service on Unix platformsR3load error during load with Fastloader on MaxDBSAPHTTP and relative path for redirectionParameter rfc/selftrust is not workingFixes in CommonCryptoLib 8.5.21Import breaks with sql error 'string data right truncation'Tp clearold does not delete subdirectoriesDP: ThReceive, ill msg_typeDYNP_GET_STATUS enhancementNUM: R0P syslog entrySimple Transformation exception CX_ST_MATCH_ELEMENTTrace for PERM/TASK memory areasSHO: SYSTEM_SHMCONSTR_LOGON_FAILED during auto buildSHO: Transactional locks and inserted sessionsIBM i: SAP Database Performance Collector Version 6.0CCMS: agent stops connecting CEN system for MSSQLSERVER_-1, extended tLOOP with dynamic WHERE condition returns wrong resultsetSapstartsrv: On Windows GetTraceFile webmethod can failCursor error and workprocess exit in DBSLInvalid length in LCHR fieldAS4FIXFILE fixed delete program objects bug, changed library lock handFast RFC Serialization - Date compression not usedScreen compression: invalid loop container heightGW: external cpic programs do not start any morePASEInlPgm-Profile or -Login should be useable non-interactiveSAP GUI for HTML: Cumulative patch UnifiedRendering 1804DBSL: Corr. for ORA-12415 after RAC switchDB6: db6util -sold option to show application holding oldest transactiCALL_FUNCTION_SNC_ERROR and dynamic destinationSAP GUI for HTML: Cumulative patch UnifiedRendering 1805SE30: record mismatch for W message (automation calls)DB2 z/OS: db2radm Patch Collection Q1 2017DB2Radm produces 2 log filesDeferred close not to delay DELETE operationError in spool monitoring correctedDB6: better handling of cancel requests during connect processingIBM i: Sapinst missing error propagation from kernelUPE with Postscript: Output of Wrong CharactersAvoid core in abDbgReadUserBps_delDuplicatesError: R3trans time runs backwardClear focus for custom controlsSAP GUI for HTML: Cumulative patch UnifiedRendering 1806PPMS technical database name is incorrect.Patch collections for ICU shared librariesIBM i:Externel UNIX Pgms are tried to start as ILE ones.UPE: Wrong Characters on Systems with Mixed EndiansNew diag supportbitESC has no effect on popupAGI: new tracesDIAG:don't send actionbar on dialogboxesDIAG: no actionbar data on dialogboxes - regressionDIAG: invisible window-stack entryUse SAPSYSTEMNAME as setInitialEnvironment Indicator.Comparison of data references in Shared ObjectsGui-Status: status SAPMSSYD 0020 missingIBM i:externel UNIX Programms tried to start as ILE onesTest : ABAP Kernel SyncAPYSIDKRN cannot install igshelperCustom controls on fullscreencontainer not visibleSAP GUI for HTML: Cumulative patch UnifiedRendering 1807Webgui: fixed horizontal scrollbar in horizontal Calendar controlAPYSIDKRN SAVSAR runs foreverR3trans stops with sigal 11 during import of table content (e.g. R3TRBad performance during language import in systems with many clientsExplict PSE file for SLDREGSupport for Microsoft ODBC Drivers for SQL Server in SAP NetWeaverCERTRULE | collective note for rule based mapping #2Label is handled as Textfield in Personas flavor, monospaced font cannWebgui: fixed error caused by a wrong escaping of Shift-JIS response iMS: crash while starting the AS JAVADB6: no DB error message was returned on MODCCMS: Update of SNMPLIB with NET-SNMP 5.7.3 and with iniParser 3.1Fixes and Features in CommonCryptoLib 8.5.22SAP GUI for HTML: Tolerate other negative values than -1 as row heightLeft aligned checkboxes covering the textCPIC: correction to function SAP_CMMAXCONVSAP HA Script Connector Library Windows: Fix EnvironmentR3trans: GUI status load deletion missing during importSAP Support Package Stack Kernel 7.22 (EXT) Patch Level 700DB2 z/OS: uninitialized ABAP raw fields (type x)DB6: Explain with invalid statement text may cause work process abortDbcon entry for SQL connection to VORAForce reconnect after sql error -10923ENQU: parameters validation in the enqueue libSAPHTTP uses only SAPSSLC.pse for HTTPSCCMS Syslog Monitor: Filters at MTE nodes of Message container are incCERTRULE | Redundant entry check sometimes incorrectDIAG GROUPBOX : Set CursorDP: add Trace to display message counterDP: rdisp/elem_per_queue configured too highDynpro: PropertybagEPP and update II (kernel fix)EPP in update taskFast RFC Serialization 16 byte packed values with all digits filled reFast RFC Serialization increase protocol version for connectorsFix crash if ccm perf data for last 15m or 1h do not exist.Gateway does not read during connection handshakeNT: Instance cannot be restarted after dispatcher diedNUM: Change return code in case of timeoutRFC Transfer of string with more than ?536870911? charactersRemove SNMPSAP GUI for HTML: Cumulative patch UnifiedRendering 1808SAP GUI for HTML: Cumulative patch UnifiedRendering 1809SHO: avoid mutex timeoutSYSTEM_NO_ROLL at SELECT ... FOR ALL ENTRIESCorrect audit log of transaction startMemoryblock DIAGAR corruptionDB2 z/OS: db2radm Patch CollectionSAP language delivery transport deletes customer OTR textError when the same ADBC statement produces two or more different rowsProfile parameter dbs/ora/dbsl_iuuc_end_transaction_hookLog full Oracle 18 server versionDetect HTTP requests from browserTabToElement is not appliedWebgui: fixed submitting data encoded in Shift-JIS containing 0x5C bytDB2 z/OS: Db2 network statistics don't show virtual hostsDB6: make dbsl_iuuc_end_transaction_hook dynamicItab - NULL pointer access on modify basket updateNew profile parameters for transactional replicationChange responsibility of dev project "proj/sapha"Determine HardwareID on Huawei KVM CloudSAP GUI for HTML: Cumulative patch UnifiedRendering 1810Make dbsl_iuuc_end_transaction_hook dynamicABAP Call Monitor: New Profile Parameter and ImprovementsRelease of temporary offset/length access of PXA stringsFixes in CommonCryptoLib 8.5.23DIAG: invisible column titelsRuntime Monitor error Can't write to RTMDATA occursTSV_ILLEGAL_REFERENCE after CATCH BEFORE UNWINDVMC: Signal 11 during tracing of lock informationImprove initialization of an internal modeIntroducing HASYSINFExport of deletion transport ends with returncode 0006Audit log content missing after Unicode conversionSYB: stop database fails if SRS is installed and ssl enabledCL_ABAP_CONV_OUT_CE: initialize alignment gapsIntroduce a new ACL file entry "permit local" to allow connections froSYB: make dbsl_iuuc_end_transaction_hook dynamicHost information updated after a database failoverNegative smoothed and averaged values at performance MTE nodes in Rz20DIAG: missing toolbar entriesGW: GwIPrxyCheck: no matching entry foundGW: wrong lu name in slot 0 of logged on clients listSAP Screen Personas: shadow systemSELECTION-SCREEN INCLUDE SELECT-OPTION add. syntaxerrorTSV_ILLEGAL_REFERENCE after CX_SY_DYN_CALL_ILLEGAL_TYPEAvoid incorrect PXA pointersSYB: Database Fault Management: Floating IP will be attached with subnSYB: Database Fault Management: handle hanging network callsABAP syntax check: SYSTEM_CORE_DUMPED when function module signature uFast RFC Serialization None Unicode String to other typeIllegal Unicode characters are replaced with # when using fast RFC serMissing performance statistical records in CCMS Transaction-Specific DDB2 z/OS: dynamically switch on/off transactional replicatonDB6: Bad Isolation Level for IUD Statement with SubselectDeadlock in SoftcancelITS HTML Control: display of files with content type application/xmlRFC: CALL_FUNCTION_SNC_ERROR and dynamic destinationSAP GUI for HTML: Cumulative patch UnifiedRendering 1811Webgui: UR release version made known to ABAP applicationsR3ta must not use values clause on SQL Server 2005SRT: Error in WSRM Soap ApplicationUUID based on RFC4122 cannot be generatedSLDREG no longer supports fallback to SAPSSLS.pse if SAPSSLC.pse is miMissing function include after import with R3trans (parallel mode) onDb2radm: db2radm.log and autobindDB6: db6util uses MON_GET_UNIT_OF_WORK with 3 parametersSAP GUI for HTML: Cumulative patch UnifiedRendering 1812Signal 11 in DispatcherICM error "no more free event-flags"Impersonate Session Security Context errorIBM i: DLTR3SYS now with option to keep the database libAPYSIDKRN Patch Index OverflowDIAG GROUPBOX: Fields below invisible frames are shiftedDynamic RFC Destination do not work with Trusted/TrustingNo further support for MDMP in RFCFSM: save to native file system for multipart downloadSAP GUI for HTML: Cumulative patch UnifiedRendering 1813VMC: Hanging Compiler VMWrong service information is logged upon SSL handshake error for outgoENQU: Improvement of the ADM message processingProfile parameter dbs/mss/dbsl_iuuc_end_transaction_hookDB4: avoid duplicates of "WITH CS" in statement textIBM i: Profile parameter as4/dbmon/enableDB4: New profile parameter for transactional replicationImprove single transaction modeNUM: Client in statistical recordWrong length in shortdump APCRFC_MOVE_ERRORIssues with profile parameter change via icmon or wdispmonFixes and features in CommonCryptoLib 8.5.24Outgoing HTTP(S) connections via SAProuterABAP: core in scSetStatementFSM: excel files couldn't be opened with the WebGUI File BrowserFSM: unnecessary error popup when accessing native file pathMemory corruption in RFC causes TEXTENV_UNICODE_LANGU_INVALID dumpsSAP GUI for HTML: Cumulative patch UnifiedRendering 1901Windows on Huawei Cloud (IaaS): Adaption of your SAP LicenseDB4: Password Configuation Tool (setdb4pwd) accepts parameters as stanImprove Supportability of HTTP Security SessionsMemory leak in EGFixes and features in CommonCryptoLib 8.5.25VMC: Signal 11 in dispatcherVMC: NullPointerException when connecting to ext. RFC server programSAP Support Package Stack Kernel 7.22 (EXT) Patch Level 800Fixes and features in CommonCryptoLib 8.5.26ABAP-PH: Fix GEN_INTERNAL_ERROR for RANGE type checkCCMS agent implementing unit rescale for performance MTE nodes stops unexpectedlyCONCATENATE into String too much memory allocation for CCPIC: Network error not detected with CPIC_PING III, registered Servers and client combinedCPIC: workaround for Apple, when Host2Addr() fails for own hostnameEPP and update III (kernel fix)GW: Improve name resolution handlingGW: Improve name resolution handling IIGW: NiHLGetHostName implementation doesn't support IPv6GW: display of wrong IP address for remote gatewaysNiGetOwnFQDN returns truncated hostnamesThe adoption of the new Nengo "Reiwa" in SAP systemsAvoid loss of pending input with document viewerDB2 z/OS: memory leakDB6: Default isolation CS for inline compound SQL statementsDB6: Default isolation for directly executed statementsDB6: on PureScale TRUNCATE TABLE may be blocked by BACKUPSYB: Performance issues when cancelling fetch on an open result setError when executing tp command "extrdocu"Tp: parameter 'handling_of_inactive_transports = SKIP' does skip inactive entries in shadow bufferSapftp - relocation of tmpfile: /tmp/ftpUnchecked Pointer access in ReadEnvironmentFileSAP GUI for HTML: Cumulative patch UnifiedRendering 1902SAP GUI for HTML: Cumulative patch UnifiedRendering 1903AGI: F4 is not displayed at the right edge of a frameCustomer transports involved in an upgrade are not visible in the import historySemaphore 53 continuously locked due to memory overwriteIBM i:DLTR3SYS now supports option not to delete databaseNot closed database connection after using saplikey executable with ENCRYPT=TRUESCAN ABAP-SOURCE: No subrc for too long statementMissing trailing zeros for decfloatsSAP GUI for HTML: Adaption of session closing request to new browser demandsSAP GUI for HTML: Cumulative patch UnifiedRendering 1904Custom alert value for SNMP trap received by CCMS agentFixes and features in CommonCryptoLib 8.5.27Improve Okcode handlingSWINCF: Wrong Size of Icons and SymbolsAvoid deadlocks on table REPOSRC during parallel importDb2-z/OS db2radm: db2radm.log and autobindDb2-z/OS db2radm: writing db2dsdriver.cfgRepetition after SQL error for LOBsITS Translation: localization of SAP GUI for HTML own textWebgui: fixed workprocess crashGenerating of destinations with invalid namesRe-enable system commandsSapstartsrv crashes while reading data from saposcolFixes and features in CommonCryptoLib 8.5.28FM FTP_SERVER_TO_R3 does not perform correctly UTF-8 to UTF-16 conversion for ASCII modeSome network errors are not classified as restart errorsABAP Debugger: fix problems with restart featureICM/WDP crashes when a URL is redirected via redirect handler to a target URL containing a format string patternOverflow > 65535 Table Deltas RFC with fast serializationSAP GUI for HTML: Cumulative patch UnifiedRendering 1905SYB: Password changes with sybctrl and ASE user storeIBM i: QDFTJRN does not exist anymore with IBM i 7.4IBM i: Support of new OS Release IBM i 7.4List Masking SupportMI: Wrong destructor handlingSet connect property IFR_CONNECTPROPERTY_PREPROCESSPWDCoredumps during debugging of ABAP Simple TransformationsDeep Exporing/Importing/Changing Parameter with _ at the end is omitted during RFCSAP GUI for HTML: Cumulative patch UnifiedRendering 1906DB6: correlation name for table name in optimizer guideline not foundSet connect property PREPROCESSPWDAGI: Fields below the visible window are not accessibleWrong result for predfined function on INT1/INT2Webgui: removed BOM from webgui_min.jsGettimeofday() with high precisionLinux/LDAP: Use reentrant libldap_r-2.4.so.2GUI Shortcuts with case sensitve parameter valuesRetry after SQL error at OCILobGetLength2Blank screen in the background in WEB GUICCMS: parameter service/j2eethreadtasktime/red takes no effectFSM: virtual filesystem case sensitivDynp/diiag: correct call of au_rautxRdisp/core_file_size in kernel release 722Inconsistent state in ABAP Runtime when raising exceptionSAP GUI for HTML: Cumulative patch UnifiedRendering 1907DP: Parameter rdisp/TRACE_PATTERN_[0,1,2] does not workSYB: FDCT transfer for nZDMRepetition after SQL error - ResetDBSL: ORA-01036: illegal variable name/numberBatch work process cannot reconnect to DBFixes and features in CommonCryptoLib 8.5.29SAP Support Package Stack Kernel 7.22 (EXT) Patch Level 900Duplicate TIDs with new algorithmDB6: DBSQL_DBCNT_MISMATCH on table RIS_PROG_TADIRDb2-z/OS handling Db2 V12 reason code 00C90637IBM i: Handling of QAQQINI in dev trace (SM50)SAP DBSL connectivity to Microsoft "SQL" or "SQL Server" branded productsIBM i: Wrong output from PTF check for PTF groupsATRA: respect SQL prepare timeAdditional public keys for Amazon Web Service Hardware IDCOV: introducing TIDX in internal modeDynamic RFC Destination don't work with Trusted/TrustingIMPORT: improve RC handling in case of exceptionITS Translation: localization of SAP GUI for HTML own text stringsNo Workprocess Reconnect because of reconnect refusedRTM, endless loop in rtm_deallocate2SAP GUI for HTML: Cumulative patch UnifiedRendering 1908SAP GUI for HTML: Cumulative patch UnifiedRendering 1909ST: WP restart if long ddic names are usedUndesired automatic deletion of password when password is changed or assigned in SU01 / SU10 for a currently logged on userWebgui FSM: js error for paths starting with Z: or Z\ and not with Z:\Improve sync ABAP with kernelSapstartsrv: Avoid deadlocks in Unix signal handlerSapstartsrv: Fix crash in ListLogFilesDB6: replace deprecated SYSIBMADM.TBSP_UTILIZATION in db6utilERROR => CCMS: AlMsUpload ignoring too long lineRFC_SYSTEM_INFO: assure structure RFCSI filled correctlyCCQ fix SAPFTP 721RfcAccept is called too lateFile and directory names with a tilde character on Microsoft WindowsSPNego Authentication fails for one hour nearby a daylight switchRFC Fast Serialization Compatibility Mode Multiple Overlap ErrorSYB: no connect possible with 722 EX2 kernelDb2-z/OS db2radm: sapclinst fixPost Copy Automation: "Duplicate Key" Fehler beim ImportAvoid Core Dumps in Runtime MonitorGW: Kernel 72X, local Ip address not accepted as localGW: Unwanted prxy_info check in gatewayMany errors "NiIShutdownHandle: SiShutdown failed for hdl" in the trace file dev_icm or dev_webdispSAP GUI for HTML: Cumulative patch UnifiedRendering 1910Webgui FSM: save to native file system option not checked by defaultDB6: TRUNCATE TABLE may be blocked by BACKUP on MPP databaseSAP HA Script Connector Library: Fix for WindowsDynamic destination doesn't work if CONVERSION_BYTES=initImprove start of variant transactionsRFC library doesn't send all requested tables parametersSPNego: missing reauthentication checkFixes and features in CommonCryptoLib 8.5.30APCRFC_INTERNAL_ERROR after applying note 2837494VMC: VM does not contribute to a shared GError in R3trans export option LSM=ALLSAP GUI for HTML: Cumulative patch UnifiedRendering 1911Core Dump for FIND IN TABLE with SUBMATCHESRe-enable shortcut parameters with SAP EasyAccessRetrieving a structure with > 1 fields into structure with 1 field result in a errorWrong ref count for string in itab with secondary keysRUNT_ILLEGAL_SWITCH at CREATE OBJECT ... PARAMETER-TABLEShortdump with RFC instead of SYSTEM_FAILURE/COMMUNICATION_FAILURETH, UP: unneeded trace from ThUserKeyForTid()IBM i: sapcpe Call for IGSHELPER needs a long timeSAP GUI for HTML: Cumulative patch UnifiedRendering 1912DB4: Support named parameters in SQL functionsCore instead of shortdump at RFC after note 2855732 is appliedCPIC: implement CPIC trace file limt for 72XInvalid PDF file during partial printing of ADS spoolPXA: mprotect fails with error 13Sapstartsrv logging improvementsGeneration of ABAP programs during transportsSYB: Status shows wrong database hostname after planned failoverSAP GUI for HTML: Cumulative patch UnifiedRendering 1913Remove deactivation when loading BPs for ext. debuggingDb2-z/OS: signal 11 during instance startupCX_SY_NOT_IN_DYNPRO_ENVIRONMNT for CPIC serverSAP GUI for HTML: Cumulative patch UnifiedRendering 2001FTP_SERVER_TO_R3 does not break lines correctlySE09: Successfully exported transports are displayed as 'export still running'AIX: Avoid core dump for syntax error during RTTI callGW: Unknown IP Adress is displayed in Gateway Monitor(SMGW)Get rid of jQueryITS: fixed content-disposition HTTP header handlingRemoval of incorrect error messages in the traceR3ta syntax error near '/'SYB: Database Fault Management: "sybdbfm status" returns "no fault manager found for current working directory"SYB: Database Fault Management: Access of the Secure Storage fails.SYB: Database Fault Management: Upload binaries for heartbeat also from LIBPATH.SIQ: load files cannot be deleted if write failsSYB: Work Process connect to database fails in HA modeDb2-z/OS db2radm: coredump with SLES 15Open SQL: Nametab fix binary search on NUCSAP GUI for HTML: Cumulative patch UnifiedRendering 2002ABAP Debugger Interface: symbol analysis with offset/lenFTP_SERVER_TO_R3 - possible infinite loop in sapftpABAP Debugger: Rare core during watchpoint creationGW, RFC: ABAP debugger suddently desappearsPerformance issue when receiving response data from the server via HTTPSR3load: Pool corruption during unicode conversionWrong Error message for RFC group logonSAPHTTP needs to be linked with the latest librfcUTF-16 Surrogate pairs are not correctly written to a UTF-8 fileFixes and features in CommonCryptoLib 8.5.31ABAP Short Dump on Sorting ( icucoll )Data send with fast serialization to NetWeaverRFC Lib even when not requestedHardware key based on unique IDJSTART: fix core dumpProcess restart in ABAP Compiler (Function SetStamp())SAP GUI for HTML: Cumulative patch UnifiedRendering 2003SYSTEM_TYPE_NOT_ELEMENTARY none unicode RFC using fast SerializationXSLT Debugger: Trace missing permissions for debugger operations only in case of violationAvoid core in dynpstpvCALL_FUNCTION_NOT_FOUND error in RFC communication with GUIFix potential memory issuePop-up Dialog has overlapping elementsRFC error message garbled over different endianess serversDB4: Avoid RetrieveMessage for SQL0000Open SQL: COUNT(*) resturns always -1CPIC:Ping reply timeout cannot be set to 0 againDeadlock during GUI Status GenerationIssues with Java P4/IIOP maximum request sizeOpen SQL: Wrong Xcross for SELECT * FROM <TABLES-WA>SAP GUI for HTML: Cumulative patch UnifiedRendering 2004BasXML: unexpected EOS / work process restartDelete rfc/ext_debuggingWebgui: fixed SearchHelp related issueIBM i: Fix the profiling regarding new o4fopenlibIBM i: enables UNICODE Filenames for IBM iPatch for ICU shared librariesSAP Support Package Stack Kernel 7.22 (EXT,EX2) Patch Level 1000SAP Support Package Stack Kernel 7.22 (EXT, EX2) Patch Level 1000Avoid dump in case of exception during IMPORTConversion failures in classic RFC serializationDP: Request (type XXXX) cannot be processedEPP Callcounter with ConnectorsGW: ***LOG S1G=> GwCheckStolenConvid, capture attackGW: addtional trace during registration of programsImprove Tracing of Certificate Revocation Check in SAP Software ValidationJSTART: Fix for orphaned web sessionsLong Runtime for IMPORT FROM DATA BUFFEROpen SQL: Wrong Xcross for SELECT * FROM <WA>Parsing error at processing instruction <?xml-stylesheet ...?>RFC Fast Ser. Compatibility Mode Char to structure failedSYSTEM_CORE_DUMPED in CALL TRANSFORMATION with result JSONSYSTEM_CORE_DUMPED in class CL_HTMLTIDYWeb Dispatcher crashes in libcsaXSLT-Debugger: Runtime error RUNT_ILLEGAL_SWITCHIXML: Correction for Treatment of invalid charactersSapstartsrv: avoid zombie processesADT / AIE: objects are invisible after transportComposite SAP Note: Performance optimization during importIBM i:SAPMMC Logon with long username failsDB4: IUUC commit hookDBSL Support for SQL Server 2019Fixes and features in CommonCryptoLib 8.5.32Fixes and features in CommonCryptoLib 8.5.33DB6: db6util -lock2key may cause SQL0104NENQU: Improve connect behavior in ERS1Access invalid memory locationLinux on IBM Cloud (IaaS): Adaption of your SAP LicenseSAP GUI for HTML: Cumulative patch UnifiedRendering 2005SAP GUI for HTML: Cumulative patch UnifiedRendering 2006SAP GUI for HTML: Cumulative patch UnifiedRendering 2007Update lz4 tp 1.9.2Webgui FSM: incorrect encoding of results in non-unicode R/3Webgui FSM: upload of files in Chrome in incognito modeWebgui: wrong colors in GUI ResourcesRe-enable tx pars for /Nxxx within a tx started from SMENWebgui: fixed wrong popup orderWrong trace 'INVALID SAPGUI CONNECT DATA: TOOLBAR_HEIGHT'Db2-z/OS db2radm: schema for sap_util_seqExport of TEXT object fails with RC=0008Inconsistent transaction field in AU3/AU4 entries in the security audit logSAPKPROTP RFC failing After SNC enableCompression error while sending HTTP responseDescriptionCONVT_CODEPAGE dump after SEC XML API processingExport of docu object fails when name contains the character 'SAP GUI for HTML: Cumulative patch UnifiedRendering 2008KRNLREG: missing EX2 suffix in SLD data for 7.22 kernelItab, secondary keys, access violation on write accessR3trans: introduce automatic memory limit for string cacheFixes and features in CommonCryptoLib 8.5.34IS SUPPLIED not working with NWRFCSDK and JCoCore Dump in error handling during RFC signon with httpSAP GUI for HTML: Cumulative patch UnifiedRendering 2009Enable SNC for the CPIC connection for debugger communic.Customer transports included in upgrade: returncode handlingAccelerated import on windows fails with error message 'can't close file'ABAP: String refcnt overflow at offset/length accessSAP GUI for HTML: Cumulative patch UnifiedRendering 2010Sapstartsrv: trace the web method invocationsFM FTP_SERVER_TO_R3 inserts extra blank lineRFC Fast Ser. error with fixed sized char fields with > 16383 CharactersRFC Fast Serialization Error with identical values in packed column and includes in compatibility modeDB6: TRUNCATE TABLE may be slow when temporary tablespaces are in useIncorrect DBSL patch level displayed in System-StatusFixes and features in CommonCryptoLib 8.5.35APCRFC_INTERNAL_ERROR or core during data transfer of tables parameter data (fast serialization, new mode)Batch session logs discrepancyWebgui FSM: file display produces empty popup windowRFC changes in TABLES Parameters are transferred empty or incorrectly in case structures differ on client and server side with Fast Serialization in standard modeExtension of transport object R3TR WDYN by documenation objects with id WCSAP GUI for HTML: Cumulative patch UnifiedRendering 2011SXML Reader: Errors processing XOP/MTOM documentsScreen buffer: Hit ratio is greater than 100%Windows on IBM Cloud (IaaS): Adaption of your SAP LicenseSXML Reader: SYSTEM_CORE_DUMPED in XOP/MTOM pocessingAPCRFC_MOVE_ERROR Fast Serialization New Mode for values < 0.1Database connection to Microsoft SQL using secure storageSSL for DBM connectionEnable private clouds: Alibaba Apsara, AWS OutpostsFixes and features in CommonCryptoLib 8.5.36IBM i: Error in hint list of APYSIDKRNIBM i:STOPSAP now supports SOFT Shutdown of an SAP-SystemSYB: Database Fault Management: unnecessary unplanned failover due to database server incorrectly reported downABAP Debugger native list preview: disable for BTC/HTTPPuffer synchronization: Optimized interfering callsSLDREG on Windows should not display passwordCore Dump for IMPORT DIRECTORYSAP GUI for HTML: Cumulative patch UnifiedRendering 2012Webgui TextEdit: problems when characters % and & are used.Output of external command is corruptSAP GUI for HTML: Cumulative patch UnifiedRendering 2013Webgui FSM: applet ws.jar blocked by java securityTH: WP crash while iterating over CPIC connectionsABAP Debugger: WP stops at wrong line, after BP was hitDatamatrix barcode: Invalid handling of UnderscoreRABAX at RFC Call instead if SYSTEM_FAILURERFC Dispenser / SYSTEM_RESET_RFC_SERVERSYSTEM_CORE_DUMPED in CERTRULE when creating rule using a certificate with empty subject nameUndetected deadlock during array insert accepting duplicate keysLOOP .. ASSIGNING, unexpected line changesWebGUI ALV Gridview: focus can't be set programmatically by the applicationJPERFLIB: adaption to SLES15Logon with SNC credential from external RFC client works despite having SNCSYSACL entry configuredWebgui FSM: use of file path enclosed in quotation marks.DB6: TRUNCATE TABLE may be blocked by backup on index tablespaceRUNT_INTERNAL_ERROR at dynamic structure type creationSAP GUI for HTML: Cumulative patch UnifiedRendering 2101SAP GUI for HTML: Strange rendering issuesSapstartsrv with loaded SAP HA Script Connector Library exceeds OS Limit "Number of open Files"STORAGE_FREE_FAILED in Spool WorkprocessWrong pseudo-random numbers for the ABAP types decfloat16 and decfloat34Jstart: suppress redundant trace messageSYB: check HADR primarySYB: undetected deadlock during array insert accepting duplicate keysSYB: Password check for java stackDb2-z/OS: missing privilege for SAP_UTIL_SEQSAP GUI for HTML: Cumulative patch UnifiedRendering 2102Blank screen after tabmerge actionWrong trace entry "INVALID SAPGUI CONNECT DATA: TOOLBAR_HEIGHT""Error in HTTP response: Invalid header field" caused by missing name of HTTP header fieldDUMP DSTEP_ILLEGAL_PROGRAM_STATE after warning message in PAIDB4: Support USE CURRENTLY COMMITTED clause on SQL statementsCorrect conversion of 'packed' fields during tranportNo enqueue server shutdown if IBM Z XCF not accessibleAPCRFC_INTERNAL_ERROR Transfer of asia chars from JCo or Unicode to Noneunicode to large string or char fieldEnable lowercase table names in control fileFast RFC Compatibility Mode - Use of includesRFC Fast Serialization empty NUMC columns performanceRFC Internal Logon Ticket - Increased Compatibility LevelDB6: transactional replication procedure missingSapstartsrv: fix memory leak in GetEnvironmentAsync RFC - No Error Message for not existing or not remote enabled functionMemory Leak in XPath ProcessorWebgui: fixed Context Menu on ABAP listR3trans memory leak during exportSLDREG should send port in the Host headerSAP trace: improvements in the error handlingENQU, ENSA: memory leak in the replication threadGateway diesPerformance-Assistant Pop-Up-Dialog opens in background with SAP GUISecundary Table Index not updated in method DESERIALIZE_HELPERIterated salted hash is empty after having assigned or changed a passwordR3trans import error: Input buffer ... bytes too short. Probably the data file was destroyed during file transfer!?DB4: CREATE / DROP Collection results in errors in Dev TraceSIQ: connection to IQ with IQ 16.1 SP04 PL09 ODBC driver failsCore dump in ab_BcdToCstring()Internal RFC fails due to time difference between database and application serverMessages of type 'W' are not handled correctlySAP GUI for HTML: Cumulative patch UnifiedRendering 2104SAP GUI for HTML: No F4 button or scrollbar counterStore NI handle of registered server programs in gatewayXML_FORMAT_ERROR during RFC communicationIUUC check existence of Oracle proc IUUC_END_TRANSACTIONRuntime error PERFORM_NOT_FOUND due to a bug in the ABAP Kernel SynchronizationLOOP .. ASSIGNING, unexpected TABLE_LINE_NOT_EXISTINGPrinting with SNC enabled is not workingSAP Support Package Stack Kernel 7.22 (EXT,EX2) Patch Level 1100SAP Support Package Stack Kernel 7.22 (EXT, EX2) Patch Level 1100Fixes and features in CommonCryptoLib 8.5.39SYB: Fault Manager: enable Log File RotationDB6: CHECK_NETSTATS_CONFIG leaves uncommitted database transactionsDB6: WAIT FOR OUTCOME for MERGE stmts originating from ABAP MODIFYNo exception for decimal conversion errorsHuge dev_rfc trace files in Kernel work directoryNUM: dynamical creation of year dependent intervalsRFC Performance improvmentSAP GUI for HTML: Cumulative patch UnifiedRendering 2105SAP GUI for HTML: Cumulative patch UnifiedRendering 2106SMTP auth fails for AUTHUSERS not excl in upper caseWork processes are stuck in state 'Stopped SNC'Performanceregression of type T destinations with note 3007182 or 3026990ENQU: ENQUEUE_READ and empty resultsR3trans: inconsistent data copied during copytoshadow of tables with field types DecFloat16 and DecFloat34Enable search help shortcuts (hot keys) for right-justified input fieldsCore Dumps in ABAP Garbage Collector due to invalid referencesMemory read error in XRfc tracingMissing system log entry after fail of asynchronous function callSAP GUI for HTML: Cumulative patch UnifiedRendering 2107Wrong tabchain using SAP GUI for JavaDB6: SELECT SINGLE statements may get invalid isolation levelRecompose previously decomposed trace stringsSPAM: missing buffer synchronization after 'downtime optimized import'SYB: Fault Manager: error: hostctrl release 7.22 unsupportedSYB: use current version of SAPJVM for connection test for Java stackZ/OS: Enqueue Replication into System z Coupling FacilityClient transport issues with table BSEGLz4 change methodR3trans: enable memory limit for string cache also for copy-to-shadowSAP GUI for HTML: Cumulative patch UnifiedRendering 2108Invalid Memory Access during OTF OutputLOAD-OF-PROGRAM and DEFAULT values in RFC callsShared Objects: Freelist of VersInst-Table CheckDB6: db6util with option -lock2key may end with lock timeoutDP: TH Deadlock on Mutex in SNCSapstartsrv: Improve deregistration on Unix/LinuxIncorrect where-used list for SELECT * FROM <TABLES-WA>Information about list statements in short dump DYNPRO_SEND_IN_BACKGROUNDRFC Fast Ser. WAN mode results in APCRFC_INTERNAL_ERRORWork process crash instead of shortdump in case of memory shortageOpen SQL: bug fix type cast dbrspost errno (note 3090711)SAP GUI for HTML: Cumulative patch UnifiedRendering 2109Fixes and features in CommonCryptoLib 8.5.40Allow ACL entries with trace level 0CL_FAST_SERIALIZATION recorded LE playback on BE system / Compression mode wrongFix calculation of a docking control extension when Personas 3 is usedMemory Leak in API CL_FAST_SERIALIZATIONSetting DIR_PROFILE parameter on an environment variableSimple Transformation with XOP source documents terminatesRABAX with RFC even in case exceptions are catchedRuntime error DATASET_CANT_OPEN occurs sporadically in class CL_IXMLMS: extend process header informationMisleading message in case of WebGUI in async RFC callsDB4: Reduced SQL package size by improved pruningPerformance regression in list statements caused by note 3089826Core Dump When Using XPath Evaluation with "Wrong" ExpressionsCCMS: Update of SNMPLIB with NET-SNMP 5.9ABAP-SYCH: Resolve EVENT of Event handler methodDP: Trace has too many warnings "ThSaveUserKey2: don't overwrite valid user"RFC Fast Ser. Comp Mode Alignment does not fit in next fieldSAP GUI for HTML: Cumulative patch UnifiedRendering 2110RFC Statistic partly empty after SYSTEM_RESET_RFC_SERVERDP: System slowness and semaphore messages due to unreleased lock comm tableSLDREG does not send port in the Host header after applying note 3042242Checkbox is partly hidden after patch upgradeHandling of net.ipv4.ip_nonlocal_bind=1 in network interface layerICM crashes due to duplicate P4S connectionsRFC Logical Destination to same system with user change and snc/r3int_rfc_secure = 1 not using SNCSAP GUI for HTML: Cumulative patch UnifiedRendering 2111XML serialization of Dynpro properties returns incomplete XML treesRabax during sapgui logonDeletion of table entries with double asterisk in the selection keyXCF note pad description was too longA patch for SAPCARInternal RFC calls waiting longer than 5 minutes for a free workprocess failTH,GW. add timestamp in ACCEPT on server sidePatch texts to be displayed in reverse orderCore dump during dynpro generation or syntax checkExtension of password length'ERROR_CHECKING_IMPORTSTATE' during GETIMPORTSTATE due to wrong length of SAP_TPLOGPTR_LNDB6: cluster table read on AIXOpen SQL: Refactoring of cluster interface, checksSYSTEM_CORE_DUMPED instead of SYSTEM_FAILUREFixes and features in CommonCryptoLib 8.5.41Work process trace files contain: WARNING => SncGetMyNameU and ThSncGetMyName failedDump MEM_ALLOC_FAILED missing / misleading informationICM and Web Dispatcher crash in function HttpPlugInHandleNetDataInsufficient information in trace errors for an unknown hostname or serviceLogical RFC Destination points to dest with SNC is not working after applying note 3102343Open SQL: BTACK_BLOCK_ILLEGAL_STATE: GROUP BY in subqueryRFC connection between Unicode and non-Unicode system fails using WebGUISAP GUI for HTML: Cumulative patch UnifiedRendering 2112SAP GUI for HTML: Cumulative patch UnifiedRendering 2113SYSTEM_CORE_DUMPED in function BxmlReader::destroyWork processes stuck in a stopped state and constantly restartingDo not ignore the return code in repstDeleteRecordAPCRFC_OVERLAY_ERROR with Structure containing Decfloat 34 Unicode to none Unicode transferCall from NetWeaver RFC Lib on EBCDIC with Fast Serialization to none Unicode system is not workingRFC Don't use offset mixed Unicode/none UnicodeSAP GUI for HTML: Cumulative patch UnifiedRendering 2201SIQ: allow COMMITs to IQ within load streamingSYB: ASE configuration parameter check at connectR3trans: performance fix for tables with xstring fieldsTraces for rabax during sapgui logonFixes and features in CommonCryptoLib 8.5.42Db2-z/OS: Modification of retry on duprec during upsertDb2-z/OS: error message after seamless failoverSYB: Fault Manager: VIPA is moved unnecessary during long running failoverMSS: DbSlRollback96 while DBIF already activeSAP Support Package Stack Kernel 7.22 (EXT, EX2) Patch Level 1101IBM i:Support for new OS release IBM i 7.5Writing client TCP ports in trace may slow startup of an ABAP system on Microsoft SQLIBM i:SAP System does not start if DLTSAPSPLF ends in errCore Dumps in iXML Parser when WP Trace is activeFix error handling in CALL FUNCTION .. PARAMETER-TABLEITAB - RUNT_ILLEGAL_SWITCH with statement ATIndeterministic behavior of CALL TRANSFORMATION calling XSLTModule ID filter missing for some level 2 trace callsSAP GUI for HTML: Cumulative patch UnifiedRendering 2202SAP GUI for HTML: Cumulative patch UnifiedRendering 2202.2SYSTEM_CORE_DUMPED in function FxHashTableDestroySYSTEM_CORE_DUMPED in methods of interface IF_SXML_NSURI_HELPERSupport Internal Installation NumbersTable Buffer: More Trace during displacement runXSLT Import PrecedenceMS: wrong client name is passed to ACL checkLonger passwords for SMTP authenticationSAP GUI for HTML: Cumulative patch UnifiedRendering 2203R3trans core or crash in function db_basic_str_prepDump in client transport table BSEGICM/Web Dispatcher crash in IcmIsTrafficControlViolatedSapstartsrv: Linux systemd supportError 1406 reading V$PDBS in Oracle Multitenant DatabaseSaprouter rejects accepted client connectionsIBM i: APYSIDKRN stops due to false bundle messageFixes and features in CommonCryptoLib 8.5.44IBM i: AS400_API (APICODE 17) failed with SY-SUBRC = 6SYB: SE30 Error Record MismatchSAP GUI for HTML: Cumulative patch UnifiedRendering 2204Table buffer: additional diagnostics tracesWork process trace logs error in dyGetDefaultTooltip (Bsdup is NULL)Improved locking in ES layerMemory corruption when reading or writing to cluster tablesSecondary database connection fails to reopen after work process changeMtxILock errorIMPORT DIRECTORY: CONNE_IMPORT_ILL_OBJECT_TYPESapkprotp does not start on Sun SolarisSAP Support Package Stack Kernel 7.22 (EXT,EX2) Patch Level 1200SAP Support Package Stack Kernel 7.22 (EXT, EX2) Patch Level 1200SAP GUI for HTML: Missing vertical scrollbar in tree control if content rows are exceeding visible rows by oneMS: client is not recognized by ACL functionality after kernel upgradeException at external performHTTP modification rules cannot be displayed properly in web admin UI and SMICMNegative counters in Runtime Monitor, SQLM, and SCMONSYB: using more than one hint with ABINDEX()Forward SMTP status code to ABAP in case where the network connection is closedITAB - Runtime Monitor Check ITAB_FREED_IN_LOOPRFC related short dumps with garbled and also missing informationRFC Fast Ser. memory leak when (X)Strings are overwritten Exporting/Returning/ChangingSAP GUI for HTML: Cumulative patch UnifiedRendering 2205Core in function ab_DsegToProg in ABAP List-ProcessingGenerate traces for rabax during sapgui logonShared Objects: Clear version entry on multi_attach throwing CX_SHM_INCONSISTENTOpen SQL: Wrong Where Used EntriesSYB: simplify developer trace entriesABAP: Fix core dump in C-Call GET_PREDEF_TYPESSAP GUI for HTML: Cumulative patch UnifiedRendering 2206Wrong error handling of string handles in R3transDeinstallation of a component fails due to object of type SQLTSYB: Fault Manager: display status DB sap_host_available REQUIREDSYB: Fault Manager: handling network outagesSYB: Password change with sybctrl and SAP ASE user store failsSYB: validate existing SQL scriptsRABAX repair dev trace c and abap sourcepositionSAP GUI for HTML: Cumulative patch UnifiedRendering 2207Web dispatcher integrated in central instance crashes with ROUTER protocolDB6: incorrect row count of UPDATE statement due to unexpected warningDB6: INSERT ... ACCEPTING DUPLICATES may return wrong row countDb2-z/OS: ADBC SQL statements with leading blanks failDb2-z/OS: Adjustments to support of Db2 version and Db2 connect driver versionExtending input required error message by field informationReturn value of GET CURSOR is incorrectUserarea too smallLinux: sapstartsrv for SAPSYSTEM 90 or greater requests a password to start or stopITAB - LOOP AT itab INTO wa terminates unexpectedlyError reading DF34_RAW, DF16_RAW, DF34_SCL or DF16_SCL data from the databaseIBM i: external programs called via SM49 end in errorSAP GUI for HTML: Cumulative patch UnifiedRendering 2208Retirement of High availability ChecktoolMSS: R3load with fastload imports LCHR columns with trailing spacesDB timeouts due to too few intermediate commitsAdvanced List Masking: Writing LiteralsSYSTEM_CORE_DUMPED when performing operations on cluster tablesDB4: Corrections for PowerHA Switchover of ASCS/ERS for IBM iDB6: Multiple or conflicting keywords involving the IN clauseLanguage import fails with return code 16 due to invalid string handleSAP GUI for HTML: Cumulative patch UnifiedRendering 2209Memory leak in saprouterDP: wrong trace output in ThLocalResourcesError transfer of structures > 65535 bytes in compatibility modeTable access subrecords with empty tablename in transaction STATSSAPFTP fails to perform actions on files and directories with special characters in file names on FTP servers700710701702703711720730731732AIX 1 6AIX 1 7AIX 2 7AIX 3 7700 710 701 702 703 711 712 720 730 731 732 disp+workdisp+work -Vgatewaygwrd -Vmsgservermsg_server -VR3transR3trans -Vtptp -Vsaplicensesaplicense -versionrelinfodbslenqueueenserver -Vicmanicman -Vjcontroljcontrol -vjlaunchjlaunch -vjcmonjcmon -vvscan_rfcvscan_rfc -VLDAP Connectorldap_rfc -vSAProutersaprouter -VERSIONSAPCARSAPCAR -versionR3loadR3load -VR3ldctlR3ldctl -VR3szchkR3szchk -VSAPinstsapinst -vjstartjstart -vjsmonjsmon -vsaplikeysaplikey -versionILEDSPSAPVERS ILEdb2radmdb2radm -vdb2jclliblibinfo <DBMS> <lib>RSecSSFxrsecssfx -vR3taR3ta -VSAPSLDREGsldreg -versionccmagentsapccmsr -VERSIONlibrfclibinfo ALL <lib>cpictlibrslgcollrslgcoll -VERSIONrslgsendrslgsend -VERSIONsapcpesapcpe versionsaphttpsaphttp -VERSIONsapftpsapftp -VERSIONsapiconvsapiconv -VERSIONsapstartsapstart versionsapxpgsapxpg -VERSIONsapevtsapevt -VERSIONcleanipccleanipc versionshowipcshowipc versionlgtstlgtst -Versionsappfparsappfpar versionR3checkR3check -Vsybctrlsybctrl versionmdxmdxsvr -versionsapmccat ./servicehttp/sapmc.mfsapacosprepsapacosprep -VERSIONsnmplibtrapsend_cfg -versionsapkprotpsapkprotp -Vsybdbfmsybdbfm versiondb6utildb6util -Vunknowndwlib_dbslenserverldap_rfcSAPACEXTsaprouter722722_EXT_RELAIX 1 6 00F8B2C54C00 use-pr20220518Sep 18 2022 07:02:13executablePATCHHISTTIMESTAMP"TIMESTAMP"SAP_SKIP_VERSIONCHECKYESdbms_typeDB4saprel.cIBADASELECT EXECUTABLE,SAPRELEASE,HOSTNAME,PLATFORM,DBVENDOR,%s,PATCHNO,DBSLPATCHN FROM PATCHHIST WHERE EXECUTABLE = '%s' AND %s = (SELECT MAX(%s) FROM PATCHHIST WHERE EXECUTABLE = '%s' AND SAPRELEASE = '%s' AND HOSTNAME = '%s' AND PLATFORM = '%-.*s' AND DBVENDOR = '%-.*s')AIX%04d%02d%02d%02d%02d%02dIB%-*.*s%-*.*s%-*.*s%-*.*s%-*.*sIB%0*dIB(%2d.%03d) %-.*s (note %d)IBSAP_IKVERSIBGot SAP_IKVERS=%d from environment 31030E72L --------------------------- %s patch information --------------------------- IB ---------------------- IB---------------------- %s update level %d IB patch number %d IB source id %d.%03d -------------------- IB%s information -------------------- kernel release %s IB kernel make variant %s IBnone DBMS client library %s IB DBSL shared library version %s IB compiled on %s for %s rs6000_64 compiled for 64 BIT IB compilation mode UNICODE compile time %s IB --------------------- IBsupported environment IB--------------------- IB database (SAP, table SVERS) %s DBMS server %s IB operating system IB -VIB-VERSIONIBR3CHECKR/3IBdbms_type%-*.*s2x SIGINTSIGINT2x SIGTERMSIGTERM2x SIGQUITSIGQUITSIGINT + SIGALRMIB%d seconds for a last chance.PId-file "%s" contains a negative number. IB That is a lock. IBPId-file "%s" does not contain a number. rslgsmcc(71).rslgsm1_write_pid_file.kill(,0) for %s(%d)S1 : rc = -1, continueIBS2 : other_is_alive, stop processingIBmaybe other daemon is still alive,IBLast daemon disapearedIBrslgsmcc(73).rslgsm1_write_pid_file: unlinkPId-file "%s" seems to be empty. rslgsmcc(72).rslgsm1_write_pid_file: open(,O_RDONLY,0) frustrated. Stop.%lu IBSIGALRM/tmp/traceRSTRBCD>pIBiaIBrstrw1(6): rstrbseek I/O error. IBrstrw1(7): rstrbfl_flush I/O error. IBrstrw1(10): cannot get enouch space in buffer. rstrw1(5): rstrbopen cannot open trace file. ?tc? ? IBM IB?tc?rslgwait.wait_for_interrupt: for %d seconds. rslgwai2.rslgdcc_catch_clock rslgwait.wait_on_input: at fid/sid %d for %d seconds. IBrslgwai1(1).select@(#) $Id: //bas/722_REL/src/krn/rscp/rscpu86r.c#2 $ SAPdest buffer overflowIBHalf surrogate in middleIBHalf surrogate at endHalf low surrogate in middleIBcontrol codes not allowed hereIBillegal start byteIBsource exhausted within a charIBillegal follow-up byteIBoverlong UTF-8 sequenceUTF-8 bejond UTF-32source exhaustedIBcontrol code not allowed0     E06sender_upsender_finishedsender_stopedsender_disappeared<illegal state>cent_format1988cent_format1993aprunknown ! IB+-------------------------------------+-------------------------------------+ IB self| sender_id _____%20.20s_| | | recevive_time _____%16.16s_| pos_creat_time ____%16.16s_| IB| _________time _____%16.16s_| information about a sending daemon | | sender_behind _____%12.12s_____| | | computer_id _______%6.6s___________| sender_state ______%-16.16s_| | last_recive _______%16.16s_| last_send _________%16.16s_| IB| inst_no ___________%2.2s_______________| listen_port _______%5.5s____________| | native_s_id _%-20.20s____ | IB| inst_id _____%-20.20s____ | IB| _________time _____%16.16s_| central SysLog file number %-6.6s | | | file format is %-20.20s | IB| _________time _____%16.16s_| information about a remote clock | | _________time _____%16.16s_| start up of collecting daemon | | _________time _____%16.16s_| shut down of collecting daemon | | sender_id _____%20.20s_| <strange sender_id> | +------------------+------------------+------------------+------------------+ IB| type | tc_______%4.4s____| dattim___%8.8s| proc | IB| ftyp____%c______| repna____%8.8s| ...tim___%8.8s| unixpid_%5.5s__| +------------------+-------------------------------------+------------------+ IB| type | repna____%27.27s| proc | IB| ftyp____%c______| dattim___%16.16s___________| unixpid_%5.5s__| IB+---------------------------------------------------------------------------+ IB| tc_______%20.20s_____________________________________________| | repna____%40.40s_________________________| | type | | dattim___%8.8s| proc | | ftyp____%c______| | ...tim___%8.8s| unixpid_%5.5s__| IB| tabe____%3.3s____| ltrm_____%8.8s| mand_____%3.3s_____| tskhtno_%5.5s__| | mode_____%c_______| user_%12.12s| data | ttyp____%2.2s_____| +------------------+--------------+---' any_data `------------------+ IB| raw_____%-32.32s| IB| | ... ___%-32.32s| IB+------------------+--------------+---' (deamon up) `------------------+ IB| deamon__%8.8s________________________| | | problem_____%-28.28s| IB| | ... _______%-28.28s| IB+------------------+--------------+---' (deamon down) `------------------+ IB+------------------+--------------+---' (deamon problem report)-------------+ IB+------------------+--------------+---' (change SysLog file)----------------+ IB| filenum_%6.6s_________________________| +---------------------------------+-----------------------------------------+ /tmpIBdir/datafilesdir/executablesdir/protokollsIBdir/libraries.errIBasapdaem.sapdaem.fork(2nd)sapdaem.sapdaem.fork(1st)#[%]SAPPlatform: rs6000_64#[%]SAPFileVersion: 7220, 1212, 32, 59072#[%]SAPSpecialBuild: optu (EXT) (Sep 18 2022, 07:20:49)#[%]SAPProductVersion: 722, patch 1212, changelist 2156224#[%]SAPrbIFileVersion: IBProductVersion: IBMPlatform: ISpecialBuild: ?x; @(#)23 1.6 src/bos/usr/ccs/lib/libpthreads/init.c, libpth, bos610 6/21/07 15:28:59@(#)61 1.16 src/bos/usr/ccs/lib/libc/__threads_init.c, libcthrd, bos61B, b2007_33A0 8/2/07 13:09:21<@(#)42 1.1 src/bos/usr/ccs/lib/libc/POWER/crti.C, libcproc, bos610 3/13/07 11:03:08ޭ<(<@UU@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgcoll.c#1 $ SAP @(#) Unicode@(#) Unicode@(#) Unicode@(#) Unicode@(#) Unicode@(#) Unicode@(#) Unicode@(#) Unicodedddddddd|d|||dddddP|dddddt(ƈ@>P>| TΠT LDL@TϰT@pTҔL$ |L ш  P ,@@p@P@ؤ T@Tt@Ͱ<hƈ TdTTTT4TpD݌MMM0MdMx,ʬ@lހ@ޠ˄޴Xtd߈Dߜx߰լH|h,נM״@ ӄH@|<x@ԴԴ<ְ L `@!H` t9 !`x0H/ 2<PX"t @\dt|<# J0\lp$@(Hp(Lh8L 8 Dd 8DXh0L $ 8<D\|„œœœœœ$4tÈXpĸ  8D0@ 8XDxŘŨ 8D ,Llƈ 8ƜƸ 8Ƹ0LT 8lƸnjLǬ 8ƸL 80ƸLht 8Ȕȼȼ$ȼ<ȼTȼlȼɀȼɬ 8Dȼ0DPxʈʬ$@\˄˘˼8d̈ @Tt͌Ͱ 4XlΠΰ @Xxόϰ DXДа,LdшѠ$PlҔҬ $H`ӄӠ<TxԐԴ0 DXxՌլ(H\|֐ְ,Dh|נ|״| D\ؤظ,P|d|٠ٸ0Tlڐڠ @X|۔۸( 8 H \ l | ܌ ܜ ܬ ܼ 4 8T 8p 8݌ 8ݰ 8 8 8 8, 8@ 8X 8l 8ހ 8ޠ 8޴ 8 8 8 80 8P 8d 8߈ 8ߜ 8߰ 8 8 8 8 8 8, 8D\l  0<tt$(lt,Td 8 p  ``Ƹ0DHhœȼ0HXt 8 8$D\h (8\l HT|,L\x($ThDHDp(T8TXx$$\ @` 8L 8 8  8D 8p 8H \h 8 8 8@ 8| 84<` 84DL `T4@\d 4X|@| \h 8 8 8< 8h@dT,H   , x HT$| X` 0<p$Hh @L@X (`   H ` |       ( L X x X     0 P p       < `  | 8  8  8   8  $ 4 X p        HxDt  Pl0Ph  <x$,\Dt0<dt  0d  (0Hdt  4d  h LtHP l (@l4    @dpL| , 8 D  l   !!$!T!! ! "  "0 "X"p""$""##$#D#d#####$($H$p$$$%%H%|%%%%&&,&T&h & & &''$'T' ' '((8#(h#(((())@)l)))#)**$*T*\* * * ++8+P+x+#+*++,,,,4,,,l,, - -H L- - ..H.x,,. . //,/X////00|0011<#1t1D1112(202d2212333P33344L444 45$5X5`%|5d555#66,6h6,666 77@7h77788L8x88 8 9 9<9`9p999:,:h:t:::;;P;x;;<( 8>P 8>| 8>>>??@?l??4@@8@T@ @ @A A(ATA`A AABB<BhXBBBBCC(CLCCC:hD(Dp*D D DE E,ETEEEEXFF\FFFFG XGHGdGGGGHHHPH HHI0 IhI I*IJ,JXDJJJKKDKxK:hKKK LL0LLLtLLL MM4$M\MMMN$NDN`*N 8N 8NNN\OO0O<\O\OOOP P\PPQ QXQ Q:hQR R0DR\RRR SS(SLSpS 8S S\STXTXTTTU,U8UTUtUTUUTUU V VPVXXV:hVVW W( WT WW[[\0:h\d:h\3\]]0]<]\]h]]]]^4^<^^__:h_<_t___` `\``a4ataa a b( b\ b b b c, c` c cccd0eePeeef fdfffg|gh4ghhghghi iHijj8jtjjk`kkl$ldlmnnLnnno oDotoopp4pdp pq:hq4 q\ qDq q r r(rh,rr,,ss(sTs ssst>8>X>>>??<?X??=@?@@8@l@@@@lAAPAl@lAAA\ABBB8BBCDClDDD<D DDEEE<EDEdEEF F@FXFtFFFFGG$G<GXGGGGHH4H`H|HHI I$ ILpIxUV`VVVVVVVVVVWtWVVVVVVWX XlX@(#) Unicode@(#) Unicode@(#) $Id: //bas/722_REL/src/flat/nlsui3.c#1 $ SAP@(#) Unicode (08@HPX`hpxHPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hppx (08@HPX`hpx$,4<DLT\dlt| Dt$,4<DLT\dlt\ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (px (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx| $,4<DLT\dlt|(4@LXdp|ˆ” ¬¸ $ (08@HPX`hpx<DLT\dlt| $,4<DLT\dlt| $$,4<DLT\dlt| $T\dlt| $,4< (08@HPX`hpxT $,4<DLT\dlt| $T\dlt| $,4<DLT\dlt| $,4<DLT\dlt| $,4<DLT\dlt|8@HPX`hpx$0<HT`lx ,8DP@(#) Unicode@(#) Unicode@(#) $Id: //bas/722_REL/src/flat/sapstr.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgwren.c#1 $ SAP D 0   \@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgwr1.c#1 $ SAP@(#) $Id: //bas/722_REL/src/krn/rslg/rslgwr1.c#1 $ d: Sync@(#) $Id: //bas/722_REL/src/krn/rslg/rslgwr1.c#1 $ b: rstrb@(#) $Id: //bas/722_REL/src/krn/rslg/rslgwr1.c#1 $ c: no_locks@(#) $Id: //bas/722_REL/src/krn/rslg/rslgwr1.c#1 $ a: round_and_round@(#) $Id: //bas/722_REL/src/krn/rslg/rslgwr1.c#1 $ e: background_task%x@(#) UnicodeOL@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rstr/rstrcc.c#1 $ SAP&  4 H \ p@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rstr/rstrwcal.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rstr/trdumext.c#1 $ SAP P@(#) UnicodeH@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rstr/rstrtime.c#1 $ SAPqqqrr<rxrrs @(#) Unicode@(#) $Id: //bas/722_REL/src/krn/perf/pfclock.c#2 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rstr/rstrio.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/sap/saptep.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/sap/saptet.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/flat/nlsui6.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/sap/sapsbgp.c#1 $ SAP @(#) Unicode@(#) $Id: //bas/722_REL/src/krn/sap/sapscsa.c#1 $ SAP@(#) Unicode@(#) Unicode@(#) Unicode  < D t    <  < < < < 0 < <\ < < <0@(#) Unicode@(#) Unicode 'h@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/sap/sapcscsa.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgtime.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rstr/rstrbfp.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rstr/rstrbfn.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgwrcf.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/flat/nlsui2.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/flat/sapgterm.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/flat/tsstinit.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgmoni.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgwri2.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgwrup.c#1 $ SAPV0@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgtinc.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgtdec.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgtdad.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgtsub.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgtdha.c#1 $ SAP@(#) Unicode   0 @ P@(#) $Id: //bas/722_REL/src/flat/saprel.c#23 $ SAP           )  )  )  ) ! ) ( * "   ` l x            $ 4 H d t          !  !$ !0 !D !X !p ! ! ! ! ! ! " "  "4 "\ "l " " " " " " # # #( #8 #L #X #l # # # # # # $ $4 $H $` $l $| $ $ $ $ $ % $ %0 %D %h %| % % % % & & &4 &H &l & & & & & ' ' '< 'L 'l 'x ' ' ' ' ' ( (( (0 (P (\ ( ( ( ( ) ), )H )X )x ) )  ; o ; ; tA < ; o <\ ; mf < ; kp = ; d =` ; = ; cE > ; .: > ; > > b ? >  ?t ?' ? @` , @p @` , @ A8  A@ ; m Ap ; \ A ; gE BX ;:> B ; G C ; R C| ;  C  ;  DD Dx  D Dx l D Dx x EP E C E ; F  ; / FT ;  F ; v' G ; tA Gh ; o G ;  H ; f HT ; H ;  I4 ;C Id  ; X I ;  J8 ; mf J ; ] J ;  K04 ; o7 K ; o7 K ; _ L ; i L ;  L ; n M4 ; eK M ; , M/ N` Np ;7 N ;  O( ;  O ; O ; F PD ; ` P ; ~ P ; < Q ; N Qh ; Q ; m R  ;  Rp A8= R ; d R ; d S0 ; d Sx ; d S( ; P TT E  T ;  T ; ( U8 ; cR U ; 3 V ; d VP/ ;vt V ; c V @` ? WT ; g W ; ` X0 ;  X ; R X ; Y ;  Y  ;  Yt ;  Y ; Y ;  Y ?  ZT ; ̔ Z ; [0 >  [| ; r [ ;  \h ; u \ ;  ]  ;  ]l ;  ]l ; ϧ ] ; + ^X$ ;  ^ _  _$ ;  _ ;a2 ` ;  `` ;  `` A8 ѡ ` ;  a  ? Y a ;  a ? " b  N`  b ; b ; w c( ;  c ;  c ; c d  ; % d  ; % d ; ] e  ; ] e ;  e Dx  e ; F  ;  fD ;  f ; g f ;  I4 ;  gH ; ( g ;  h, ;B ht ; t ht ; ? h ; ? h ;  i< ;  i ;ٿ j ; = j` ;  j ;ٿ j ;  k@ ;  k ; ĩ k ;  ld ; @ l ; < m ; 8 mh ; 8 mh ;  m ;  n ;!  nt ;!k n ;! od ;!  o ;  pT ;!O p ; E q( ; q ;  q ;  r, ;! r| ;!  r ;!  sh ;!  s ; , t@ ;  t ;  u0 ;  u ;  u ;! | v  ;  vl ;!F v ;  w\ ;! w ; ] x  ; D xt ;X x ;  yT ;!b y ;!  y ;!  zT ;! z ;  {,  ;! { > q { >  |D N`! | ; 2 } ; ¾ }| ;!  } ; ~D ; F  ;!u ~ ;!u ~ ;! ~ ; tA 4 ; tA 4 ;!- ` ;!#y  ;!  ; }  ;!!  ; #D  ;! Q  ;   ;!p \ ;!   ;!b  ;! X ;!W  ;! '  ;!K t ;!  _!  ;cn p ;   ;!)m  ; | d ;!   ;   ;!  \ ;!G  ;!#  ; tA 4 Dx!.W T/ ;!  ; v  ;!* x ;  fD ;  fD  ;!1  ;!* $ ;!!  ;!3  ;!9  ;!5" x ;!.  ;   ;ǂ X ;ǂ  ;!  ; h ` E!<9 % ;!9   ;!E X ;!E3  ;  D ;!?   ;  ;  I4 ;!] \ ;!Qe  ;! ( ;!! h ;! X ;!  s ;   ;!) u ;!$z  ;! x ;!  ;! , ;   ;!$$  ;!4 ` ;!+  ;!2 ( ;!)`  ;!$  ;!)  ;!0  ;!< x ;!;  ;!5  ;!?  H ;!7  ;!C  ;!G3 P ;!GI  ;!E   ;!F | ;!A=  ;!@ L ;!J  ;!G  ;!J  ;!ND  ; ̂  ;!S\  ;!R 0 ;!Or  ;!Q~  ;!ND  ;!P  ;!X  ;!T ( ;! d ;!U  ;!V  ;!Q1 x ;!J  ;!/ ` ;!W  ;!Q T ;!A  ;  yT ;!7 , ;!!O  ;!C  ;!> h ;!> h  ;!> h ;!G  ;!S\  ;!3V  ;!  t ;!J  @`!R  ;  P ; h ` @`!R  ;!`\  ; F  ;!C D  ;!1  ;!cW ( ;!_  ;!a  ;!VE  ;!Wn  ;!W T ;!a5  ;!Qe  ;!]# 8 ;(  ;   ;!]  ;!N  ;!Q  ;!Z  ;![ ( ;!C  ;!c  ;!S\ p ; J  E!WW  ;!i \ ;!aw  ;!S   ;!_4 L N`!N x ;!Je  ;9  ;!X \ N`   ;!h   ;!/@ l  ;!t7  ;!y0   ;!i H  E!o  A8!rs ,  ;!t  ;!i u  ;!k  ;!  ;! x  ;!c2  ;!}@ D  ;!t  ;!x  E! @  ;!x%  ;!x%  ;!u  ;!~J t  ;!  ;!s1 T  ;  ;!q  E!- L  ;!/  ;! 8  ;!  ;$  ;! |  ;! u  ;!  ;!{} 8  ;!d  ;!  ;!A P  ;!v  ;!A8 (  ;! x  ;!~X  ;!~X 3 ;!~X  ;!4 H  ;!.  ;!s  ;! 4  ;!gv Œ  ;!  ;! d  Dx!  >!W  $ ;! Č  ;!  ;! D  ;!v Ŵ  ;!  ;!B X  ;! Ƙ  ; ]   ;! ǀ  E! ǰ  A8! $  A8!b Ȍ  ;!  ;!r P  ;!m ɨ  ;(  ;! X  E!? ʼ  ?!=  A8!u ˘  ;!#   ;! h % ;!  ;! ,  ;! ͌  ;! ͼ  ;! 4  ;!Q Θ  ;!  ;!( 8  ;!c ϰ  ;!< ,  ;! Ф  ;!W  ; d  ;! Ѵ  ;! ,  ;! Ҡ  ;!  ;! $  ;! Ә  ;!   ;!{ Ԅ  ;!  ;! x  ;!X  ;!* X  ;!`  ;! u  ;!# u  ;!j <  ;! װ  ;! $  ;! l  ;!Z ش  ;! (  ;! ٠  ;!   ;!a ڐ  ;!)  ;! (  ;!l ۄ  ;!G  ;! @  ;!H |  ;!;  ;! h  ;! ݰ  ;! (  ;! ބ  ;!n  ;!   ;!} X  ;!  ;!c2  ;!dž ߜ  >!O  ?! t  ;!x  ;!k  ;!e |  ;!  ; K L  ;!c  ;!͋   ;!  l  ;!  ;(  ;!   ;!4 d  ;!P  ;!ǣ T  ;(  ;!Y (  ;!Y (  ; d  Dx!  @`!9   ;!Ʌ P  ;!h  ;!z D  ;  >!B   ;!b ` ;!  ;!J  ;!X x ;!:  ;!~^ 4 ;!   ;!  ;!{ H ;!  ;!ٓ  ;!o l ;!  ;!  8 ;!~  ;!  ;!q X ;!͌  ;! H ;!  ;!S  ;!{ | ;!  ;!ޝ l ;!<  ;!   ;! ' ; d  @`!9 h E!  A8!f 8 ;!  ;(  ;!  ?! L ;\  ;!ڡ  ;!! d ;!  ;!  ;! | ?! L ;!  ;!  ;! D ;! D ?!S  ;!  ;! $ Dx! d ;"g  ;!_ L ;! d ;"  ;   ;! t  ;! t ;! t ?"  ;!ڡ 8 ;"?  ;"  @`" @ ;"  ;!0   ;!0  ;"  h ;  ;"  ;"* $. ;"* $ ;!F  ;"H  ;" p ;(  ;" , >"   ;"o  A8" H A8"U  _" 0 ;"  ;  ;"C D ;!H  ;"c  ;"M @ ;"*  ;"&;  ;! \ ;(  ;"u 0 Dx"#9 p E"  >!j  ; p ;  ;!{ H ;! $ ;! d ;!  ;!:  ;!  ;!; X ;"  ;! $ ;!  ;!4  ;!  ;!  ;! d ;"M  ;! ( ;!  ;!  ;! d ;!R  ;" < ;!{  ;"H  ;! x ;"H  ;"! \ ;"  ;!  ;!%  ;!  ;" p ;"& p ;" C  ;" 0 ;"  ;"a  ;"  ;"   ;"  H ;!  ;!  ;"$H p ;"c  ;"8   ;"1  ;"  ;"N ( ;"  ;!  ;"! t ;(  ;!.   ;"6 ( ;"6 ( ;!F  ;"$=  ;"4  ;"! @ ;!0  ;".,  ?"8 \ ;!>  ;!0 0 ;!  ;!  ;!*  ;!b  ;"  !l ;!P ! ;"7o "X ;"  " ;" < # ;"s # ;!P $ ;" $x ;" p ;"  $ ;" %h ;! % ;"$ &T ;".z & ;" '8 ;"$C '- ;  |D ;I ' ;" (L ;  ;"< ( ;!{ ( ;"<$ )T ;":F ) EE * _"= * ;"3B * ;"M +P ;! + ;! + ;"OB + ;"Uc ,< ;!{ , ;"O , ;"V: -H ;"PB - ;! .0 ;"Im . ;"W / ;"G / ;!f 0 ;"D4 0x ;"D4 0x ;"= 0 ;"; 10 ;"R 1 ;"H 2 ;"S 2p ;"> 2 ;ٿ 3 ;"5Z 3D ;"9 3  ;".= 3 ;"9 4X ;"? 4 ;"[X 4 ;"` 5T ;"\. 5 ;"\. 5 >"( 5 ;! 6D ;"U' 6 ;  fD ;"X 6  ;"_+ 7\ ;"A 7 ;"Re 7 ;"; 8H ;"F< 8 ; K 8 ;"U' 6 ;"j" 9\ ;"ZE 9 ;"8   ; :( ;"k : ;"`l : ;"^ ; ;"l ; ;"\H ; ;"V \ ;"lO > ;"h > ;"i ?h ?"h ? ? ~ @  ;"U0 @l ;"Eo @ ;"? A, ;ٿ A| ;! A ;"e B ;"e B$ ;"a BL ; B ;"?  ;"q< B Dx"7 CD ;"v C ;"{ C3 ;"Z DX ;"F D >"o^ E/ ;! E\ @`"lx E ;"ce FL ;"t F ;"v F  ;"{ G\ ;"{ G\ ;"  G ; HH ;" H ;" I ; :(  ;" IX ;" I ;" I  ;" I ;" I ; d J ;"w` Jl ;"w` Jl ;"t F ;"tC J ;" K0 E" K ;"X L ;"X L ;"c LX ;" L ;" Md ;" MTd ;" MTd ;" MTd ;" Md  ;" Md ;" Md  ;" Md  ;" Md ;" Md ;" Md ;" Md' ;" Md _" Md Dx" Md >" Md E" Md A8" Md ?" Md @`" Md N`" Md ;"Ͻ N4d ;" Nd ;"# Od ;" Oxd ;"Ҙ Od ;"z[ Pn ;" PLn ;"ٖ Pn ;" Q4n ;"  Qxn3 ;"  Qxn ;" Qn ;"O Rn ;"7 Rhn ;"3 Rn ;" S0n ;" Sn ;"X Tn ;" T|n ;":M Tn ;!{ Hn ;"c Uhn ;" Un ;"! V@n ;" Vn ;" Wn ;" pn ;" WTn ;" Wn ;" X$n ;( n ;" Xxn ;!n Xn ;" Y\n ; d Yn ;" Z(n ;" Zn ;"[ Zn ;"  [dn E"x [n E"6 \8n >" \|n ;  Pn ; \n ; ]<n ;"3 ]n ;" ]n ;"* ^pn ;" ^n ;"% _Hn ;"s _n ;"tv `n ;"@ `n ;"t `hn ;" `n ;" `n ;" a n  ;!Y an  ;" bn ;"d bPn ;" bn ;"ƨ c n ;" c\n ;"  cn ;" cn ;" dHn ;"V dn ;"V dn ;"+ dn ;" eDn ;" en ;"^ en ;" fDn ;"Ε fn ;"Wj g$n ;" gn ;" hn ;" htn ;"zf hn ;" in ;"S i`n ;"ϋ in ;" j n ;"̀ jXn ;"ob jn ;" kn ;"0 kn ;" kn ;" k@n  ;"y kn ;"n l$n ;"q l|n ;" ln ;" mhn ;"y7 mn ;"" n@n ;"m nn ;"t nn ;" ohn ;" on ;"x pDn ;"! pn ;"# pn ;" qhn ;" qn ;" rXn ;"^ rn ;" s,n ;"W sn ;" sn ;"ā tn ;"< tpn ;"tM tn ;" uTn ;"s} un ;" un ;"tN vXn ;"  vn ;"j w$n ;" wXn ;" wn ;" x0n ;"} xn ;" yn ;"  ydn ;"sg yn ?"T z,n ;" zn ;"s {n ;" {|n ;"; {n' ;"; {o ;" |hp ;" |p  ;" }p ;" q ;" q ;"p dq  ;# q ;# Tq ;"> q ;"Q r$ ;" Xr ;# k@r ;#  r ;# r ;"k Lr ;#7 r  ;# r ;" 0s ;# s ;# s3 ;#  s ;# Ps ;# Ps ;" s ;" s ;# <s  ;"e s ; :(s ;# s ;#q hs @`#w s ;#" ,t E#%y t ;"% t ;"% t ; ̂ t ;# t ;#1 Xt ;#8 t ;#+ Dt ;#< t ;"a t ;"c Pt ;#  t ;#"b t ;#$ `t ;"r t ;" 0t ; t ;#' t ;# `t ;" t ;" 4t ;"ϋ it ;"{ t ;#[ t ;# kt ;# `t ;" pt ;" t ;# t ;#/+ `t ;" t ;" t ;" Dt ;# t ;# ] t ;#" t ;( t ;"L t ;"[ Dt ;" t ;# 0t ;" t ;#.R t ;"- tt ;"9 t ;" Xt ;#+ t ;#+] t >" `t A8#> t _#> t ;#  t ;"^ |t ;# t ;#v ht ;#A t ;" kt ;# Tt ;#* t ;" t ;#% xt ;#.O t ;# `t ;#Q t ;# t ;#  u ;#2 u ;# Xu) ;#9& u ; u ;"g Hu ; O u ;" v ;" (v ;#6 v E#F8 v ;#> <v  ;S |v E#< v ;#+H \v  ;#+H \v ;#3D v ;#G v ; 4v ;#?? v ;#H' v ;#3 v ;#8 4v ;#N| v ;#T[ v ;#FY |v ;# v ;#C7 v ;#4 8v ;#D v ;#[ v ;#>\ v ;#Ag v ;#1 tv ;#O^ v ;#Tk Hv ;#V7 v ;" kv ;#( v ;#N v ;#3 v ;#I (v ;" v ;#El v ;##T Hv ;#: v ;#H= 0v ;#' v ;#W v ;#XG v ; d v ;#@ \v ;#4 v ;#E Lv ;#: v @`#F| ,v$ ;" pw ;#d w ;#d w ;#2 Lw ;#[ w  ;#8 w ;#Y x ;#N2 x ;#X- Lx ;#< x ;# x ;#3D \x ;#b y >#@ y >#1 y A8#s5 y _#s5 y Dx"4 $y Dx"4 y ;#$ y ;#5; (y ;! py ;#Z  z ;#a Hz ; z ;#| z ;#| z/ ;#` xz ;#m z ;# \z ;#f z ;#f z ;#D $z ;#z ŀz ;#j z N`"WB dz @`#~ z N`#B <z N`#b Ǵ{ ;">y { ;#| <{ @`#F| Ȕ{ ;#Z 0{/ ; Np{ ;# { ;" p{$ ;" p{ Dx#Y L{ ;# ɘ{ ;#0 { ;# T{/ ;#^ ʐ| ;#kw |, ;# P| ; ˴| A8# | ;# @| ;#k ̴| ;#tN | ;#b ͔| ;#) | ;#m x| ;#S | ;#{ d|  ;#{ d| ;#un | ;#| (|  ;#t Р| ;#V | ;#v5 р| ;#m | ;#e0 T| ;# | ;" D| ;". Ӽ| ; :(| ;# 4| ;#| Ԭ| ;# | ;#9 T| ;#{4 | ;#V[ | ;#o ֐| ;# | ;">- P| ;"А ׄ| ;#n | ;#` h| ;#mg | ;# H| ;#G ټ| ;#p (| ;# t| ;#N | ;#x_ X| ;# | ;# ,| ;#Z  ܤ| ;# | ;#( ݐ} @`" } ;#d @} ;". ވ} ;# } ;# } ;#| L} ;#| L~ ;#Kh ߐ~ ;#Kh ߐ~ _#I ~ ; 8~ E#\y ~ ;!p ~ ;# \~ ;# ~ ;# ~ ;#q H~ ;# t ;#$  ;#$  ;# \ ;#  ;"ϋ i ;#>  ;#D T ;#U  ;#l  ;#  ;#G  ;#  ;# H ;#  ;#7 P ;#  ;#I  ;#  ;#!  ;# k ; d >#p  ;#G ,  ;#G , ;#  ;# 4 ;#  ;# H ;#7  ;# 8 ;#o  ;#p  ; t ;#Z  ;#r ` ;#  ;#p  ;#;  ;#  ;# p ;#  ;] L ;#D  ;#  ;#ģ l ?#  ;# \ ;#  ;#΃  ;#!  ;#eG | ;#q  ;# | Dx#E  ; 4 ;#  ;#   ;#w h ;#^  ;# @ ;#   ;#W  ;# X ;#5  ;#  ;# ` ;#Z  ;# d ;$  ;$  ;$  ;$  ;$  ;$ ' ;$  _$  Dx$  >$  E$  A8$  ?$  @`$  N`$  ;$   ;$  ;$J  ;"  ;# 4 ;$  ;$   ;$t D  ;$t D  ;$t D ;$t D ;$t D ;$t D' ;$t D _$t D Dx$t D >$t D E$t D A8$t D ?$t D @`$t D N`$t D  ;$t D ;$X  ;$%  ;$= | ;$C  ;$q x ;#  ;$    ;$s  ;$j   ;$ |  ;$ |  ;$ | ;$ | ;$ | ;$ |' ;$ | _$ | Dx$ | >$ | E$ | A8$ | ?$ | @`$ | N`$ | ;$ | ;$ |  ;$ | ;$  ;#  ;$|  ;$M  ;# 4 ;$  ` ;#  ;#  ;#  ;#G  ;$4 4 ;#  ;$$  ;#G ( ;$  h ;$/  ;#   ;# l ;#  ;#  ;$  ;#פ  ;#  ;$'  ;$b k ;#  ;$ t ;$X  ;" p ;#ڭ  ;$%  ;#Y 4 ;" | ;#  ;#(  ;$  p ;# , ;#  ;#u X ;$%4  ;#z x ;"  ;$" d ;$  ;# 8 ;#  ;#\  ;$ ` ;#  ;$A   ; d  ;$$  ;#  ;$%   ;# ` ;$ \  ;# @ A8#  Dx$  >#j x E#C  A8# H _# H A8#  _#  ?$6  Dx$L , Dx$"   ;#  ;# # ;#[   ; K  ;$%,  ;$#~ ( ; K  Dx$-W  ;$. T ;#  ;  0 @`$2  ;$-J  ;$ l ;$;  ;$ % ;$,Q & ;#f & ;$< '0 ;" p ;$L 'l ;$-S ' ;" (D ;$9u ( ;$Br ), ;$E ) ;$  ;$M!  Dx$OP *@ ;$; *d ;$Pj * ;$Z +$ ;$JT +t ;$[h + ;$H , ;$We -X Dx$M - Dx$U .< ;$< . ;$ZF / ;$O /H ;$a+ / ;$TX 0< ;$c 0 ;$h 1$ ;"K 1 E$f 2 ;# 2d E$r 2 ?$r 3$ ;  3T ;$Vh 3 ;#| 44 ;$o '0 ;$ 4 ;$} 5$ ;$s  ;$t 5 ;"" 6, ;$hY 6 ;$? 6 ;$Ut 7` ;$l 7 ;$ 8X ;$j   ;$k  8 ;$Q 9  ;$v 9d ;${ 9 ;$D& : ;#U :\ >$ : E$ ;$ ;$  ; ;# 2d @`! ; ;$ <$ ;$: < ;$: < ;$( < ;$ =h ;$u2 = ;$ >H ;$ > ;$* ?  ; ? ;$    ;$) ? ;$' @$ >$ @x ;$ @ ;$ @ ;$ At ;$ A ;$ B  ;$ Bt ;$ B ;$ C< ; :( ;$ C ;$ C ;$ D0 ;" p ;$u D| ;$ D ;$ ET ;$ ET3 ;$ ET ;$ C< ;$w E Dx$ F0 ;$ F ;$ F ;$A G( ;$ G ;$d H@ ;$ň H ;$ H ;$V Id ;$~ I ;$$ J$  ;$$ J$ ;$t/ J ;= K$ ;$ K ;$< K ;$ LH ;  0 ;$  L( ;$Ń L$ ;$V MP ;$ M ;$ж N ;$ж N ;$ж N ;$z N ;$ N ;$ N ;$ Od ;$} '0 ;$ O ;$ P  ;$O P  ;$a P ;$a P$ ;$a P4 ;$a P ;$a P ;$ QP ;$ Q ;$* R ; d R8 ;$ R ;$ S ;$ St ; ` S ;!\ Tp ;$P T1 ; T/ N`  U ;$) U$ ;$K V( ;$ V ;$d V ;%  W8 ;%8 '0 ;%7 W ;% > X ;$b XT,$ ;% X, ;%\R X, ;%\R X,  ;%\R X,  ;%\R X,  ;%\R X, ;%\R X, ;%\R X, ;%\R X,' ;%\R X, _%\R X, Dx%\R X, >%\R X, E%\R X, A8%\R X, ?%\R X, @`%\R X, N`%\R X, ;%Iq Yd, ;$ Od, ;%K Y, ;%\R X6 ;%  Z$6 ;%n Z6 ;% [46 ;%f [6 ;%-~ \T6 ;%8 \6 ;% ]t6 ;% ^6 ;%( ^l6 ;$p ^6 N`#/ _6 ?$ _6 ;$ ``6 ?$ `6 ;% a 6 ;%" aL6 ;%" aL6 ;%T a6 ;%T a6 ;$ bh6 ;$ bh6 ;%; b6 ;%; b6 ;$U ct6 ;%O c6 ;% d6 ;% d6  ;% d6 ;% d6 ;%^ dd6 ;%^ dd6 ;%  d6 ;% e6 ;% e6 ;$ ep6 ;%W e6 ;%[ f86 ;%N f\6 ;%( f6 ;% g6 ; d gp6 ;%# g6 ;% hD6 ;%"; h6 ;%,2 h6 ;%* iH6 ;$ i6 ;%B j6 ;%'- jP61 ; j61 ; j6 ;%6 kd6 ?$  k6 Dx%  l 6 Dx%! lX6 Dx%, l6 >% m,6 >%Il m6 >%BQ n06 E% nl6 E%0 n6 @`$j o6 N`$ oX6 N`$C o6 ?%O p$6 >%- p6 A8% q6 _% q6 _# qP6 ;%- q6 ;%_ r6 ; rp6 ;cn r6/ N`$za s$6/ N`$ s6/ N`%  t6 ;% t6 ;%? t7 ;$; uH7 ;"li u7 ;%X u7 ;%Ti v@7 ;%Ti v@7 ;%Ti v@7 ;%Ti v@7 ;%}y v7 ;%}y v7 ;%}y v7 ;%}y v7 ;%p w$7 A8%mH wd7 A8%Q w8 ;%w. x48 ;% x8 ;% x8 Dx%} x86 E%2 y,9 Dx%k y9 ;%5 z9 ;%l z9 ;" z9 ;% {,9 ;% {9 ;% {9 ;%O |d9 ;% |9 ;% |: ?%ă }p: _%! }: ;%. }:  ;% ~X; ;%k ~; ;%5 $; ;%5 ; ;% ^; ;%d ^; ;% ; ;% ; ;%ɂ < ;%r 4< ;%$ t< ;% < ;% <3 ;%" < E% = ;% = ;%_ = @`%, l ;&N  ;&# ( ;&+? | ;%  ;&ZD  ;&ZD   ;&ZD   ;&ZD   ;&ZD  ;&ZD  ;&ZD  ;&ZD ' ;&ZD  _&ZD  Dx&ZD  >&ZD  E&ZD  A8&ZD  ?&ZD  @`&ZD  N`&ZD  ;&ZD  ;&   ;&   ;&:B  ;&:B ' ;&:B  ;&   ;&   _&1  >&2 d ?&Ox  A8&+O  ;%  P ;&)   ;&d  ;% p ;&+  ;&!F 8 ;&  p ;&IY   ;&5  ;&M l ;7  ;%  ;$"} L ;$"} L  ;&Y  ;%e l  ;&.  ;&.  ;&B) X ;&L  ;" p ;&9 X ;&  ;&L  ;&:3  ;&!-  ; d  ;%  ;%\  @`&l \ ;&Z  ;&s(  ;&y \ ;&xu  ;&|t  ;&uX  ;&nD x ?&~P  N`%a ` ;&&  ;&P t  ;&P t ;&   ;&qW  ;&v 8 ;&x  A8#  _#  ;&  0 ?&K h ;%  ;%  ; 8 ;&  ;&} ( ;&  ; d  ;&1 4 ;&A   ;&A  >&2  E&  ;&  ;&  ;&  ;&  ;&O   ;&9  ;&0  ;&0  ;&0  ;&0  ;&|  ;&|  ;&|  ;&|  ;& p ;&3  ;&  ;&  >&  N`&3 / N`%_ / N`% t ;&   ;%c d ;&ʳ  ;&ް  ;&Ψ ` ;&Ψ ` ;&9   ;&9  ;'5} ( ;'5} (  ;'5} (  ;'5} (  ;'5} ( ;'5} ( ;'5} ( ;'5} (' ;'5} ( _'5} ( Dx'5} ( '5} ( E'5} ( A8'5} ( ?'5} ( @`'5} ( N`'5} ( ;'   ;'  ;&  ;& P ;&  ;'C  ;&   @`':  ;%  ;&,M  ;&  p ;'3  ;'= 0 ;':  ;'.y  ;&Y $ ;'  ?&{ ( E&}  N`%a ` ;   ;'< t ;'   ;'   ;& , ;& , ;&  ;&  ;&  ;&0 8 ;&0 8 ;&  ;'  ;& H ;&k  ;'  ;'  ;'% 4 ;'!B  ;&p R ;&S  ;'U t ;'U t ;%}  ;'/  ;%! @ ;&2  ;&  ;'&5 T ?&F  ;'S  ;& p ;'  ;'Ts  ;'G  ;'Yu ` ;(  ;'w   ;' @ ;'G p ; \ $ ;'D L ;'  ;"  ;'c D ;'w.  ;'vM  Dx'  ;'  ;&n X ;'o  ;'  ;'6 L  ;'  E') h ;'  ;#S\  ;'C L ;'B  ;'J  ;&i 0 ;&%  ?'  ;' < ;'  ;#  ;'   ;'q  ;'q  ;'q  ;'q  ; d h ;'N  ;'.: D  ;'.: D ;' Ą ;'  ;' @ ;' p ;'ǔ Ÿ ;' , ;' ƼX ;( X ;( X  ;( X  ;( X  ;( X ;( X ;( X ;( X' ;( X _( X Dx( X ( X E( X A8( X ?( X @`( X N`( X ;( X ;' ǐX ;' b ;'  Ȅb ;'~ ȴb ;'b b ;'l Tb ;'  b ;'W \b ;'W \b3 ;'W \b ;'0 ʌb ;'Ym b ;'Ym b ;( Pb ;' b ;' b ;'S ̈b ;'2 b ;(s \b ;'  b  ;'. b ;'V Τb ;'B b ;' lb ;& ψb ;(B b ;' pb A8' b _' b A8' 4b Dx' рb E( c b E(_ Pb E'* Ҥb >#@ b ;' Xb ;' b ;(s \b ;'  8b ;' c ;' \c ;'O c ;'* (c ;'  ֐c ;( c ;(} הc ;' c  ;' c ;' |c6 E(" c N`(/ dc ;( d ;(% d ;(% Hd ;  d _(, e$ ;( ۄe ;' e ;(& (e  ;(& (e ;(AE hf ;( f ;(F 8f ;(> pf ;(A ݨf ;(C f ;%'- <f ;'İ ހf ;%_ g >‰ Lg ;(; ߸g ;(; ߸g ;'# Hg ; d g ?(D ,g ?(G h ;(A h ;( Lh ;( h ;(X i ;(dE i ;(dE i >'p |i >'p |i ;(5W i @`(' pj6 E(nh j ;(: Xj ;(c  j ;' ,j ;(c LHk Dx$: k Dx$XU k >(w 0k ;(y k E(y l ;‰ Ll ;(1 Xl ;( l ;( $m ;(` m ;( m ;( m ?( xn ;' n  ;' n ;' n ;( (n ;( n ;( n ;(X ,o ;( do ;(  o ;( p ;( @p ;(  q ;(Z q ;(! Tq ;(" q ;( q ; K 8q ;(F Lq ;$ѵ q ;(= q ;( pq ;(g q ;( 0q ;(C q ;( Dq ?(k |q ;( q ;( pq ;( r ;( r E(( r ;(W 8r ;(W 8r3 ;(W 8r ;(> r  ;(> s ;( s ;(a t ;(X t ;(X t ;= Xt ;(  ;) < ;) <  ;) <  ;) <  ;) < ;) < ;) < ;) <' ;) < _) < Dx) < ) < E) < A8) < ?) < @`) < N`) < ;) < Dx(  E(  A8%ы  A8)&4  ;( D$ ;)  ;(س  ;(س  ;(>  ;)$  ;(ܰ ( ;(I | ;(h  ;)$  ;(N @ ;( h ;(  ;) x ;)j  ;  T ;(  ;(=  ;(,  ;(޼  ;) $ ;(  ;(  ;)' ( ;( x Dx$:  ;)  ?)  p @`)-  @`) t  ;(  ;)'  ;)1 4 Dx)F9  E)5  8 ;'   ;'  ;'  ;)CE  ;)4  ;)B p ;'7  ;'7  ;'7  ;'7  ;): ( A8)J  _)J  ;(  ;) h ;(`   ;(`  ;)^  ;)\@ X ;),  ;)\r  ;)B  ;)L  ;)g*  ;)F+ x/ N`(  ;) \ ;)7;  ;)7;  ;)7;  N`)J L A8)s  ;)K  ;)K  ;)|  ;)r  ;)r  ;)% 8 ;)% 8 ;)z   ;)w  ;)` \ ;( / N`)O / N`(  ;)  ;)"  ;)'H  ;)  ;)F+ x Dx)+ 8 E)<  ;).: ( ;) X ;)  ;)l4 P ;)n6  ?)s < ;)t  ;'  ;)Q @ ;)  Dx)P \6 E)  ;)  ;)N   ;)  ?'  ;)  \ ;  ;)  ;)  ;(r  ;) @ ;)Š  ;) $  ;)& X ;)  ?) H >)f  >)N !( >)N !( >)N !( ;) !| ;)z ! ;) "0 ;)t "|  ;) " ;)M #L  ;)M #L  ; > # ;) $ ;) $< ;) $ ;)s %< ;) % ;) &8 ;) &8 ;) &8 ;) &8 >)۔ & ;) 'D ;* ' ;) '  ;) ' ;* 0 (( ;*< (d  ;*O (  ;*O (  ;*O (  ;*O (  ;*O (  ;*O (  ;*O (  ;*O ( ' ;*O (  _*O (  Dx*O (  *O (  E*O (  A8*O (  ?*O (  @`*O (  N`*O (  ;*O (  ;* )h  ;* )h* ;*K )* ;*0x *0* ;) ** ;(H +H* ;(H +H* ;*" ,* ;*" ,* ;* ,* ;*W ,* ;*W ,* ;*# -* ;*# -* ;*@ -d* ;*@ -d* ;* -* ;* -*  ;*EB .<* ;'L .* ;*Fi .* Dx* /`* E*f /* E*( 0* E*O 0x* N`'h 0* ;) 1t* ;*'_ 1*% ;)RA 2* ;*V 2* ;*B 3H* ;*J 3+ ;*[s 40+ ;'L .+ ;*O 4+ ;*T 5@+ ;)  5, ;*s 6(, ;*s 6(, ;*P  6, ;) 70, ;*q 7|, ;*y 8- ;*f 8- ;*f 8-3 ;*f 8- ;*<- 8-  ;*<- 8- ;* 9X- ;* 9. ;* 9. Dx)P :H. Dx) :. @`&k :. ;* ;<. ;* ;. ;*; ;. ;(r . ;* / ; K 8/ ;* >t/  ;* >/ ;* ?/ ;*z @0// N`*5 @0 ;* A0 >* A|0 >* A|0 ;* A0 ;*2 B0 _* B<1 ;' 1  ;' 1 ;' 1 ;*و B1 ;* C 1 ;* C1 E* D<1 _*ܞ D1 ;*d E1 ;* E1 ;*^ E1 ;*l F42 ;*" F|2 ;* F2 @`&k G<2 ;* G2 ;* G2 ;* G2 ;) Hd2 ;*M H2 ;*ɜ H2 ;*3 IT2 ;*  I2 @`&k :2/ N`*5 @2 ;&n J<2 N`(M J2 @`&k J3 @`+6$ K,3 ;+# K ;* K  ;* K ;+T L8 ;+T L8  ;+T L8  ;+T L8  ;+T L8 ;+T L8 ;+T L8 ;+T L8' ;+T L8 _+T L8 Dx+T L8 +T L8 E+T L8 A8+T L8 ?+T L8 @`+T L8 N`+T L8 ;+T L8 ;&ݍ L E+L& L Dx+ MX >*S M ?&{ N ;+1 N ;*0x *0 ;*0x *0 ;*0x *0  ;*0x *0 ;* O ;+} OP ;+} OP ;*? O ;+ P ;* P ;+*y P ;+^ Qt ;+ Q ;+ R, ;+C R ;+W S ;+>d Sl ;+Rp Td ;+ T ;+ U0 ;+Il U6 E+7 U ;+)a Vd ;*] V$ ;+f W<$ ;+1 Wd ;+#| W ;+r X, ;+K X N`+x Y4 Dx+F Y ;+d Y ;+L ZD ;* Z ;* Z ;+_ Z ;+_ Z  ;( [L ;+o \ ;+p \ E+ ] ;= ] ;+n ] ;+V ^h ;+ ^ ;+ ^ ;+{ _( ;+ _x  ;+ _x ;+ _ ;+D `8 ;+ ` ;+ ` ;+ aP ;+  a ;+8 b  ;+{ _(3 ;*f 8 ;*0x *0 ;+4 b ;+% c( ;+4 c ;+ d$ ;+Ĩ d# ;+Ĩ d ;+1 d >)  e\ ;+ e ;+׬ f< ;+׬ f< ;+ f ;+ g' ;+ gH ;+ g N`+1 g N`+1 g ;+ hl ;+ h ;+ iP ;+ i ;, j ; K 8% ;+ j| ;,  j ;, k| ;+׬ f< ;+׬ f< ;, F k ;)0 lh ;, l ;, l ?, mX/ N`+ m/ N`+ np/ N`,'Z n N`)uj o N`,)# p Dx,)` pp Dx,)` pp ;,*/ p ;,. q ;,9 q% ;,=v r/ N`*5 @ ;,A rh ;,DC r  ;,6g s( ;,. s ;+ t $ ;,QY tp ;,N\ t ;,Y> uX  ;,Y> uX ;,Jk u ;,g v ;+h v ;+h v ;+h v ;+h v ;,V v ;,,I w  ;,X w| ;,[ w ;,HV x| ;,_ y4/ N`*5 @ ;,U yd ;,q8 y ;,Ug z ;,k zd >+ z ;,p {, ; K 8 ;,h {x ;,h {x ;, {  ;,s2 |( ;,* | ;,hF | ;, }d ;,e } ;(! } ;+ ~D ;+ ~ ;,   ;,  ;,  ;, @ ;, @  ;, @  ;, @  ;, @ ;, @ ;, @ ;, @' ;, @ _, @ Dx, @ , @ E, @ A8, @ ?, @ @`, @ N`, @ ;, @ ;,  ;,+ H ;,(  ;,  ;, ` ;+8  ;,_  ;,_  ;,a t ;,a t ;,H  ;,˷ X ;,  ;+z  ;,M  ;,f  ;, t  ;,  ;,  ;, l ;,  ;,+  ;  ;,L  >) T ?,D  ;,   ;,  ;,   ;, 6 E, | ;,a  ;,#  ;, ` ;, ` ;, ` ;, ` ;,  ;,D D ;,  ;, , ;,t T ;,  ;, @ ;,  ;,  ;, @ Dx,  ;,  ;- \4 ;,  ;,ʌ D ;-   ;-l  ;-4  ;-   ;-$  ;-r  ;-$  ;,Ȼ h  ;,Ȼ h ;-  ;--  ;-Dq  ;)  ;-: x ;-T  ;-Y  ;-l  ;-U h% ;,Y  ;-A  ;-!K  E-{K  A8-u/  _-u/  ;-.g |  ;-.g | ;-|w  ;-e  ;,Q  ;- \ ;-)  ;- < ;->Y  ;-d  ;-t p ;-t p ;-t p ;-t p ;-Q  ;-p P ?-%  _!k D ;- t ;- t ;- t ;- t ;-y   ;-y  ;-$ 8 ;-; / N`,|  ;-c  ;-) L ; K 8 ;-V  ;-ر  ;-. P ;-u ( ;-0 < ;-  ;-  ;- d ;-T  ;-| < ;-9  ;-  ;-* L ?-  ;,  ;-  ;-  ;. | ;.   ;.t  E.  ;.e x ;.  ;. l \ ;.  ;."S t ;.*  ;.) \ ;.) \ N`-=  N`- / N`.!] l Dx-:  ;./  ;.Co  ;,  ;.4 L  ;.4 L ;.H=  >.  ;.J  ;& h ;-  ;.N8  ;-0  ;- l ;.0.  E.O L ;.E  ;-  ;-H  ;.av  ;.f <4 ;.k  ;.q  ;.q 4 ;.e  ;.e  ;.h   ;-Y @ ;.q  ;. T >.N< < N`.}  ;.[* 8 ;. x ;.yD  ;. | ;.W  ;.m X ;.C  @`&l  ;.+ ” ;. 8 ;. ] äL ;.  L ;.  L  ;.  L  ;.  L  ;.  L ;.  L ;.  L ;.  L' ;.  L _.  L Dx.  L .  L E.  L A8.  L ?.  L @`.  L N`.  L ;.  L ;.  |L ;.# L  ;.# V/ N`. \V E.v ŸV E. @V ?-% V ?. V ;.2 V ;.> DŽV ;- V ;. $V ;. ȘV ;.n V ;.f xV ;.҈ V ;.y lV ;.y lV ; K 8V ;.v ʸV ;.R ːW ;.G $W ;.) ̤W ;-s W ;.9 lW ;. W E., ,W ;.R ΨW ;. W/ N`.v ϔW/ N`.ԏ W ;& МW ;/K W ;-m `W ;. фW ;/J X ;/' ҄X ;. X ;-, 4X6 E/% ӘX ;/- X ;/* TX ;/;P ԸX ;/% (X ;. ռX ;/] ,X ;/) ִX ;/t (X ;/% לX  ;/% לY ;/@f Y ;/@f Y ;/@f Y  ;/@f Y ;/@f Y ;/? DY ;/E Y ;/= xY ;/3  Y ;&B @Y ;. ڸY ;. Y ;.v ۬Y ;/,5 Y >. hY ;/H7 Y ;/^ PZ ;.b Z ;.b Z3 ;.b Z ;/o $Z ;/fw ވZ ;. $Z ;/_ ߠZ ;. Z ;/y [ ;/fc $[ ;/q [ ;/u [ ;/u [  ;/u [ ;/ [  ;/ [ ;/V [ ;/b [ ;/n 4[ ;/ [ ;/| [ ;& x[ ;/ [ ;/ [ ;/C [ ;/i [ ;/u [  ;/u [ ;/u [ ;/u [ ;/u [ ;/u [ ;/l @[ ;/! [ ;/  [ E/ [ ;/Z [ ;/ @[ ;/ [  ;/ [ ;-A. \ ;/W \  ;/ \ ;/ \ ;/? 0\ ;/Ӓ \ ;/m \\ ;/G \ ;/> d\ ;/F \ ;/آ @] ;& ] ;/ ,] ;/[ ] ;/ ] ;/ ] N`/ ] N`. ] ;/{ D] ;/! ] ;/X ]  ;/X ] Dx.# \] Dx.5 ] ?&{ N]/ N`/n ,] ?ڀ M ;0  ^ >0 ^ >0 ^ ?0e ^ ;0 ^' ;0 ^ ;/C ^ ;/G ^ ;0 ^ ;0 L^ ;0" ^ ;0 4^ ;0)  ^ ;0 ^ ;0 ^ ;0l ^ ;0/a P^ ;I ^ ;% ^  ;$5 @^ ;0G ^ ;0X> ^ ;0X* p_  ;0[ _ ;/( (_ @`0[ p_ ;03 _ ;03 _ ;00 @_ ;0Q' _  ;0Q' _ >0ax _ N`0E t_ ;0 _ ;0 (_ ;0/U _ ;)@  _ ;0 H_ ;0. _ ;0C P_ ;0F p_4 ;0  ;0   ;0    ;0    ;0    ;0   ;0   ;0   ;0  ' ;0   _0   Dx0   0   E0   A80   ?0   @`0   N`0   ;0   ;0  ;0X>  ;0 ( ;0  ?&{ N ;0^   ;0  ;/% ( ;0 t N`0ɖ   ;0̜ < ;0"  ;0 < ;0ӽ  ;0a p ;01  ;0 T ;0  ;0W T N`/  ;1!  ;0 H ;1  ;+ɺ  / N`0L / N`/ $/ N`0L / N`1'  ;1&s H ;1#  ;1B    ;1B   E0   E1* H Dx1  Dx05 8 Dx05 8 ;0L?  ;02 P ;1*  ;1*  ;15 p ?1@+  ;1N? t ;1S  ;" T ?1`B  ;1X 0 ;-  ;0W T ;1U  ;-N ` ;-N `' ;-N ` E1|  ;1n X ;1^|  ;1m$ \ ;1  ;1G  ;1 l% ;/   @(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rel/saprel0.c#1 $ SAPUx@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgsmcc.c#1 $ SAP@(#) $Id: //bas/722_REL/src/krn/rslg/rslgsmcc.c#1 $ die with alarm @(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rstr/rstrw1.c#1 $ SAP--no-filename--@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rstr/rstrw2.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/sap/saptid.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgwai2.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgwai1.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rscp/rscpsc2.c#1 $ SAP 7-./  % <=2&?'@(#) Unicode@h,,.p...,0<0H01 1,1L0##(D(t((()4TtL 0(Hh,Hd  D `   (d?@@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rscp/rscpuerr.c#1 $ SAP, NOT thread safe@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgwra.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgtch.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgpr3.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/rslg/rslgpr4.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/sap/sapdir.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/krn/sap/sapdaem.c#1 $ SAP@(#) Unicode@(#) $Id: //bas/722_REL/src/proj/sapversion/sapversion.c#1 $ SAP?p@?p?p?p?p?p?p ?p `?p `?pK?pF?pG ?pG?pH`?pI?pI?pJ@?pJ?pv?pz?px?p|?p~?p`?p`?p@?p@?pC@?p\ ?p?p`?p ?p̀?p΀?p?p?p2?pJ?p;   H > >8>Px $(08@HPX`hpx (08<@HPX`hpx>h>]`$b8 %" "p #`%P%+ ,(%(,  -8 P---HPX.H..X `>>/8 /@    h00 0 %1 &2222222 'h3X *p4@4H` *x 6x 7h 75T 8 :x6H6P6X6`77  : 7 : ; ; 9<   ;@9@ 5P (.8>> 5//>?/ :/ <112 ?( <8 <23,306H =l =p =x8?@ = @ A A A0 AP AX989@ BX B` L  Y Z; Z4fMWW8; @@@ (@ 0@ 8@ @@ H@ Q@ Y@ `@ g@ o@ z@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @  @#@1@>@M@Y@`@ m@ v@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ #@ -@ 5@ >@ E@ M@ \@ e@ q@ z@ @ @ @ @ @ @ @ @ @ @ @ @ @ @  @ @ @ *@ 5@ >@ F@ P@ Z@ c@ l@ v@ @ @ @ @ @ @ @ @ @ @ @ @  @ @  @ (@ 1@ 8@ >@ H@ T@ _@ i@ r@ z@ @ @ @ @ @ @ @ @ @ @ @ @ @ @  @ @ #@ .@ 9@ @@ L@ V@ _@ g@ p@ @ @ @ @ @ @ @ @ @ @ @ @ @ @  @ -@ =@ M@ U@ i@ @@@ @@@@ @ @ @ @ @  @ ;E! ;? ? ? ? ?. ? ? H? ? ? ?????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????? ?(??? ?(?0? ? ? ? ?5?5?5?6?6?6?6?6 ?6(?60?68?6@?6H?6P?6X?6`?6h?6p?6x?6?6?6?6?6?6?6?6?6?6?6?6?6?6?6?6?7?7?7?7?7 ?7(?70?78?7@?7H?7P?7X?7`?7h?7p?7x?7?7?7?7?7?7?7?7?7?7?7?7?7?7?7?7?8?8?8?8?8 ?8(?80?88?8@?8H?8P?8X?8`?8h?8p?8x?8?8?8?8?8?8?8?8?8?8?8?8?8?8?8?@?@?@?@?@?A?A?A?A?A ?A(?A0?A8?A@?AH?AP?AX?A`?Ah?Ap?Ax?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?B?B?B?B?B ?B(?B0?B8?B@?BH?BP?BX?B`?Bh?Bp?Bx?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?C?C?C?C?C ?C(?C0?C8?C@?CH?CP?CX?C`?Ch?Cp?Cx?C?C?C?C?C?C?C?C?C?C?C?C?C?C?C?C?D?D?D?D?D ?D(?D0?D8?D@?DH?DP?DX?D`?Dh?Dp?Dx?D?D?D?D?D?D?D?D?D?D?D?D?D?D?D?D?E?E?E?E?E ?E(?E0?E8?E@?EH?EP?EX?E`?Eh?Ep?Ex?E?E?E?E?E?E?E?E?E?E?E?E?E?E?E?E?F?F?F?F?F ?F(?F0?F8?F@?FH?FP?FX?F`?Fh?Fp?Fx?F?F?F?F?F?F?F?F?F?F?F?F?F?F?F?F?G?G?G?G?G ?G(?G0?G8?G@?GH?GP?GX?G`?Gh?Gp?Gx?G?G?G?G?G?G?G?G?G?G?G?G?G?G?G?G?H?H?H?H?H ?H(?H0?H8?H@?HH?HP?HX?H`?Hh?Hp?Hx?H?H?H?H?H?H?H?H?H?H?H?H?H?H?H?H?I?I?I?I?I ?I(?I0?I8?I@?IH?IP?IX?I`?Ih?Ip?Ix?I?I?I?I?I?I?I?I?I?I?I?I?I?I?I?I?J?J?J?J?J ?J(?J0?J8?J@?JH?JP?JX?J`?Jh?Jp?Jx?J?J?J?J?J?J?j?j?j?j?j?j?j?k?k?k?k?k ?k(?k0?k8?k@?kH?kP?kX?k`?kh?kp?kx?k?k?k?k?k?k?k?k?k?k?k?k?k?k?k?k?l?l?l?l?l ?l(?l0?l8?l@?lH?lP?lX?l`?lh?lp?lx?l?l?l?l?l?l?l?l?l?l?l?l?l?l?l?l?m?m?m?m?m ?m(?m0?m8?m@?mH?mP?mX?m`?mh?mp?mx?m?m?m?m?m?m?m?m?m?m?m?m?m?m?m?m?n?n?n?n?n ?n(?n0?n8?n@?nH?nP?nX?n`?nh?np?nx?n?n?n?n?n?n?n?n?n?n?n?n?n?n?n?n?o?o?o?o?o ?o(?o0?o8?o@?oH?oP?oX?o`?oh?op?ox?o?o?o?o?o?o?o?o?o?o?o?o?o?o?o?o?p?p?p?p?p ?p(?p0?p8?p@?pH?pP?pX?p`?ph?pp?px?p?p?p?p?p?p?p?p?p?p?p?p?p?p?p?p?q?q?q?q?q ?q(?q0?q8?q@?qH?qP?qX?q`?qh?qp?qx?q?q?q?q?q?q?q?q?q?q?q?q?q?q?q?q?r?r?r?r?r ?r(?r0?r8?r@?rH?rP?rX?r`?rh?rp?rx?r?r?r?r?r?r?r?r?r?r?r?r?r?r?r?r?s?s?s?s?s ?s(?s0?s8?s@?sH?sP?sX?s`?sh?sp?sx?s?s?s?s?s?s?s?s?s?s?s?s?s?s?s?s?t?t?t?t?t ?t(?t0?t8?t@?tH?tP?tX?t`?th?tp?tx?t?t?t?t?t?t?t?t?t?t?t?t?t?t?t?t?u?u?u?u?u ?u(?u0?u8?u@?uH?uP?uX?u`?uh?up?ux?u?u?u?u?u?u?u?u?u?u?u?u?u?u?u?u?v?v?v?v?v ?v(?v0?v8?v@?vH?vP?vX?v`?vh?vp?vx?v?v?v?v?v?v?v?v?v?v?v?v?v?v?v?v?w?w?w?w?w ?w(?w0?w8?w@?wH?wP?wX?w`?wh?wp?wx?w?w?w?w?w?w?w?w?w?w?w?w?w?w?w?w?x?x?x?x?x ?x(?x0?x8?x@?xH?xP?xX?x`?xh?xp?xx?x?x?x?x?x?x?x?x?x?x?x?x?x?x?x?x?y?y?y?y?y ?y(?y0?y8?y@?yH?yP?yX?y`?yh?yp?yx?y?y?y?y?y?y?y?y?y?y?y?y?y?y?y?y?z?z?z?z?z ?z(?z0?z8?z@?zH?zP?zX?z`?zh?zp?zx?z?z?z?z?z?z?z?z?z?z?z?z?z?z?z?z?{?{?{?{?{ ?{(?{0?{8?{@?{H?{P?{X?{`?{h?{p?{x?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?|?|?|?|?| ?|(?|0?|8?|@?|H?|P?|X?|`?|h?|p?|x?|?|?|?|?|?|?|?|?|?|?|?|?|?|?|?|?}?}?}?}?} ?}(?}0?}8?}@?}H?}P?}X?}`?}h?}p?}x?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?~?~?~?~?~ ?~(?~0?~8?~@?~H?~P?~X?~`?~h?~p?~x?~?~?~?~?~?~?~?~?~?~?~?~?~?~?~?~????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x?€?ˆ??˜? ?¨?°?¸????????????? ?(?0?8?@?H?P?X?`?h?p?x?À?È?Ð?Ø?à?è?ð?ø????????????? ?(?0?8?@?H?P?X?`?h?p?x?Ā?Ĉ?Đ?Ę?Ġ?Ĩ?İ?ĸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ŀ?ň?Ő?Ř?Š?Ũ?Ű?Ÿ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ƀ?ƈ?Ɛ?Ƙ?Ơ?ƨ?ư?Ƹ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ǀ?Lj?ǐ?ǘ?Ǡ?Ǩ?ǰ?Ǹ????????????? ?(?0?8?@?H?P?X?`?h?p?x?Ȁ?Ȉ?Ȑ?Ș?Ƞ?Ȩ?Ȱ?ȸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ɀ?Ɉ?ɐ?ɘ?ɠ?ɨ?ɰ?ɸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ʀ?ʈ?ʐ?ʘ?ʠ?ʨ?ʰ?ʸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ˀ?ˈ?ː?˘?ˠ?˨?˰?˸????????????? ?(?0?8?@?H?P?X?`?h?p?x?̀?̈?̐?̘?̠?̨?̰?̸????????????? ?(?0?8?@?H?P?X?`?h?p?x?̀?͈?͐?͘?͠?ͨ?Ͱ?͸????????????? ?(?0?8?@?H?P?X?`?h?p?x?΀?Έ?ΐ?Θ?Π?Ψ?ΰ?θ????????????? ?(?0?8?@?H?P?X?`?h?p?x?π?ψ?ϐ?Ϙ?Ϡ?Ϩ?ϰ?ϸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?Ѐ?Ј?А?И?Р?Ш?а?и????????????? ?(?0?8?@?H?P?X?`?h?p?x?р?ш?ѐ?ј?Ѡ?Ѩ?Ѱ?Ѹ????????????? ?(?0?8?@?H?P?X?`?h?p?x?Ҁ?҈?Ґ?Ҙ?Ҡ?Ҩ?Ұ?Ҹ????????????? ?(?0?8?@?H?P?X?`?h?p?x?Ӏ?ӈ?Ӑ?Ә?Ӡ?Ө?Ӱ?Ӹ????????????? ?(?0?8?@?H?P?X?`?h?p?x?Ԁ?Ԉ?Ԑ?Ԙ?Ԡ?Ԩ?԰?Ը????????????? ?(?0?8?@?H?P?X?`?h?p?x?Հ?Ո?Ր?՘?ՠ?ը?հ?ո????????????? ?(?0?8?@?H?P?X?`?h?p?x?ր?ֈ?֐?֘?֠?֨?ְ?ָ????????????? ?(?0?8?@?H?P?X?`?h?p?x?׀?׈?א?ט?נ?ר?װ?׸????????????? ?(?0?8?@?H?P?X?`?h?p?x?؀?؈?ؐ?ؘ?ؠ?ب?ذ?ظ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ـ?و?ِ?٘?٠?٨?ٰ?ٸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ڀ?ڈ?ڐ?ژ?ڠ?ڨ?ڰ?ڸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ۀ?ۈ?ې?ۘ?۠?ۨ?۰?۸????????????? ?(?0?8?@?H?P?X?`?h?p?x?܀?܈?ܐ?ܘ?ܠ?ܨ?ܰ?ܸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?݀?݈?ݐ?ݘ?ݠ?ݨ?ݰ?ݸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ހ?ވ?ސ?ޘ?ޠ?ި?ް?޸????????????? ?(?0?8?@?H?P?X?`?h?p?x?߀?߈?ߐ?ߘ?ߠ?ߨ?߰?߸????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x??????????????????? ?(?0?8?@?H?P?X?`?h?p?x???? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?!?!?!?!?! ?!(?!0?!8?!@?!H?!P?!X?!`?!h?!p?!x?!?!?!?!?!?#?#?%P?,X?,h?,p?,x?,?-?-?.`?.h?.p?.x?.?.?.?.?.?1?1?1?1?1?1?1?1?1?1?1?1?2?2?2?2?2 ?2(?20?28?2@?2H?2P?2X?2`?3?7?9x?9?9?9?9?9?9?9?9?:?:?:?:?: ?:0?:8?:@?:H?:P?:X?:`?:h?:p?:x?:?:?:?:?:?;8?;?;?<(??>?>?> ?>(?>0?>8?>@?>H?>P?>X?>`?>h?>p?>x?>?>?>?>?>?>?>?>?>?>?>?>?>?>?>?>?????????? ??(??0??8??@??H??P??X??`??h??p??x?????????????????????????????????@?@?@?@?@ ?@(?@0?@8?@@?@H?@P?@X?@`?@h?@p?@x?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?A?A?A?A?A ?A(?A0?A8?A@?AH?AP?AX?A`?Ah?Ap?Ax?A?A?A?A?A?A?A?B?B ?B8?BH?B`?Bp?B?B?B?B?B?B?C?C?C(?C8?CP?C`?Cx?C?C?C?C?C?C?D?D?D(?D@?DP?Dh?Dx?D?D?D?D?D?D?E?E?E0?E@?EX?Eh?E?E?E?E?E?E?E?F?F ?F0?FH?FX?Fp?F?F?F?F?F?F?F?G?G ?G8?GH?G`?Gp?G?G?G?G?G?G?H?H?H(?H8?HP?H`?Hx?H?H?H?H?H?H?I?I?I(?I@?IP?Ih?Ix?I?I?I?I?I?I?J?J?J0?J@?JX?Jh?J?J?J?J?J?J?J?K?K ?K0?KH?KX?Kp?K?K?K?K?K?K?K?L?L ?L8?LH?L`?Lp?L?L?L?L?L?L?M?M?M(?M8?MP?M`?Mx?M?M?M?M?M?M?N?N?N(?N@?NP?Nh?Nx?N?N?N?N?N?N?O?O?O0?O@?OX?Oh?O?O?O?O?O?O?O?P?P ?P0?PH?PX?Pp?P?P?P?P?P?P?P?Q?Q ?Q8?QH?Q`?Qp?Q?Q?Q?Q?Q?Q?R?R?R(?R8?RP?R`?Rx?R?R?R?R?R?R?S?S?S(?S@?SP?Sh?Sx?S?S?S?S?S?S?T?T?T0?T@?TX?Th?T?T?T?T?T?T?T?U?U ?U0?UH?UX?Up?U?U?U?U?U?U?U?V?V ?V8?VH?V`?Vp?V?V?V?V?V?V?W?W?W(?W8?WP?W`?Wx?W?W?W?W?W?W?X?X?X(?X@?XP?Xh?Xx?X?X?X?X?X?X?Y?Y?Y0?Y@?YX?Yh?Y?Y?Y?Y?Y?Y?Y?Z?Z ?Z0?ZH?ZX?Zp?Z?Z?Z?Z?Z?Z?Z?[?[ ?[8?[H?[`?[p?[?[?[?[?[?[?\?\?\(?\8?\P?\`?\x?\?\?\?\?\?\?]?]?](?]@?]P?]h?]x?]?]?]?]?]?]?^?^?^0?^@?^X?^h?^?^?^?^?^?^?^?_?_ ?_0?_H?_X?_p?_?_?_?_?_?_?_?`?` ?`8?`H?``?`p?`?`?`?`?`?`?a?a?a(?a8?aP?a`?ax?a?a?a?a?a?a?b?b?b(?b@?bP?bh?bx?b?b?b?b?b?b?c?c?c0?c@?cX?ch?c?c?c?c?c?c?c?d?d ?d0?dH?dX?dp?d?d?d?d?d?d?d?e?e ?e8?eH?e`?ep?e?e?e?e?e?e?f?f?f(?f8?fP?f`?fx?f?f?f?f?f?f?g?g?g(?g@?gP?gh?gx?g?g?g?g?g?g?h?h?h0?h@?hX?hh?h?h?h?h?h?h?h?i?i ?i0?iH?iX?ip?i?i?i?i?i?i?i?j?j ?j8?jH?j`?jp?j?j?j?j?j?j?k?k?k(?k8?kP?k`?kx?k?k?k?k?k?k?l?l?l(?l@?lP?lh?lx?l?l?l?l?l?l?m?m?m0?m@?mX?mh?m?m?m?m?m?m?m?n?n ?n0?nH?nX?np?n?n?n?n?n?n?n?o?o ?o8?oH?o`?op?o?o?o?o?o?o?p?p?p(?p8?pP?p`?px?p?p?p?p?p?p?q?q?q(?q@?qP?qh?qx?q?q?q?q?q?q?r?r?r0?r@?rX?rh?r?r?r?r?r?r?r?s?s ?s0?sH?sX?sp?s?s?s?s?s?s?s?t?t ?t8?tH?t`?tp?t?t?t?t?t?t?u?u?u(?u8?uP?u`?ux?u?u?u?u?u?u?v?v?v(?v@?vP?vh?vx?v?v?v?v?v?v?w?w?w0?w@?wX?wh?w?w?w?w?w?w?w?x?x ?x0?xH?xX?xp?x?x?x?x?x?x?x?y?y ?y8?yH?y`?yp?y?y?y?y?y?y?z?z?z(?z8?zP?z`?zx?z?z?z?z?z?z?{?{?{(?{@?{P?{h?{x?{?{?{?{?{?{?|?|?|0?|@?|X?|h?|?|?|?|?|?|?|?}?} ?}0?}H?}X?}p?}?}?}?}?}?}?}?~?~ ?~8?~H?~`?~p?~?~?~?~?~?~???(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h?€??¨?¸????? ?0?H?X?p?À?Ø?è?????? ?8?H?`?p?Ĉ?Ę?İ??????(?8?P?`?x?ň?Š?Ű??????(?@?P?h?x?Ɛ?Ơ?Ƹ??????0?@?X?h?ǀ?ǐ?Ǩ?Ǹ????? ?0?H?X?p?Ȁ?Ș?Ȩ?????? ?8?H?`?p?Ɉ?ɘ?ɰ??????(?8?P?`?x?ʈ?ʠ?ʰ??????(?@?P?h?x?ː?ˠ?˸??????0?@?X?h?̀?̐?̨?̸????? ?0?H?X?p?̀?͘?ͨ?????? ?8?H?`?p?Έ?Θ?ΰ??????(?8?P?`?x?ψ?Ϡ?ϰ??????(?@?P?h?x?А?Р?и??????0?@?X?h?р?ѐ?Ѩ?Ѹ????? ?0?H?X?p?Ҁ?Ҙ?Ҩ?????? ?8?H?`?p?ӈ?Ә?Ӱ??????(?8?P?`?x?Ԉ?Ԡ?԰??????(?@?P?h?x?Ր?ՠ?ո??????0?@?X?h?ր?֐?֨?ָ????? ?0?H?X?p?׀?ט?ר?????? ?8?H?`?p?؈?ؘ?ذ??????(?8?P?`?x?و?٠?ٰ??????(?@?P?h?x?ڐ?ڠ?ڸ??????0?@?X?h?ۀ?ې?ۨ?۸????? ?0?H?X?p?܀?ܘ?ܨ?????? ?8?H?`?p?݈?ݘ?ݰ??????(?8?P?`?x?ވ?ޠ?ް??????(?@?P?h?x?ߐ?ߠ?߸??????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h???????? ? ? 0? H? X? p? ? ? ? ? ? ? ? ? ? 8? H? `? p? ? ? ? ? ? ? ? ? (? 8? P? `? x? ? ? ? ? ? ? ? ? (? @? P? h? x? ? ? ? ? ? ? ? ? 0? @? X? h? ? ? ? ? ? ? ?? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x??????? ? ? (? @? P? h? x? ? ? ? ? ? ?!?!?!0?!@?!X?!h?!?!?!?!?!?!?!?"?" ?"0?"H?"X?"p?"?"?"?"?"?"?"?#?# ?#8?#H?#`?#p?#?#?#?#?#?#?$?$?$(?$8?$P?$`?$x?$?$?$?$?$?$?%?%?%(?%@?%P?%h?%x?%?%?%?%?%?%?&?&?&0?&@?&X?&h?&?&?&?&?&?&?&?'?' ?'0?'H?'X?'p?'?'?'?'?'?'?'?(?( ?(8?(H?(`?(p?(?(?(?(?(?(?)?)?)(?)8?)P?)`?)x?)?)?)?)?)?)?*?*?*(?*@?*P?*h?*x?*?*?*?*?*?*?+?+?+0?+@?+X?+h?+?+?+?+?+?+?+?,?, ?,0?,H?,X?,p?,?,?,?,?,?,?,?-?- ?-8?-H?-`?-p?-?-?-?-?-?-?.?.?.(?.8?.P?.`?.x?.?.?.?.?.?.?/?/?/(?/@?/P?/h?/x?/?/?/?/?/?/?0?0?00?0@?0X?0h?0?0?0?0?0?0?0?1?1 ?10?1H?1X?1p?1?1?1?1?1?1?1?2?2 ?28?2H?2`?2p?2?2?2?2?2?2?3?3?3(?38?3P?3`?3x?3?3?3?3?3?3?4?4?4(?4@?4P?4h?4x?4?4?4?4?4?4?5?5?50?5@?5X?5h?5?5?5?5?5?5?5?6?6 ?60?6H?6X?6p?6?6?6?6?6?6?6?7?7 ?78?7H?7`?7p?7?7?7?7?7?7?8?8?8(?88?8P?8`?8x?8?8?8?8?8?8?9?9?9(?9@?9P?9h?9x?9?9?9?9?9?9?:?:?:0?:@?:X?:h?:?:?:?:?:?:?:?;?; ?;0?;H?;X?;p?;?;?;?;?;?;?;?<?< ?<8??>?>(?>@?>P?>h?>x?>?>?>?>?>?>??????0??@??X??h???????????????@?@ ?@0?@H?@X?@p?@?@?@?@?@?@?@?A?A ?A8?AH?A`?Ap?A?A?A?A?A?A?B?B?B(?B8?BP?B`?Bx?B?B?B?B?B?B?C?C?C(?C@?CP?Ch?Cx?C?C?C?C?C?C?D?D?D0?D@?DX?Dh?D?D?D?D?D?D?D?E?E ?E0?EH?EX?Ep?E?E?E?E?E?E?E?F?F ?F8?FH?F`?Fp?F?F?F?F?F?F?G?G?G(?G8?GP?G`?Gx?G?G?G?G?G?G?H?H?H(?H@?HP?Hh?Hx?H?H?H?H?H?H?I?I?I0?I@?IX?Ih?I?I?I?I?I?I?I?J?J ?J0?JH?JX?Jp?J?J?J?J?J?J?J?K?K ?K8?KH?K`?Kp?K?K?K?K?K?K?L?L?L(?L8?LP?L`?Lx?L?L?L?L?L?L?M?M?M(?M@?MP?Mh?Mx?M?M?M?M?M?M?N?N?N0?N@?NX?Nh?N?N?N?N?N?N?N?O?O ?O0?OH?OX?Op?O?O?O?O?O?O?O?P?P ?P8?PH?P`?Pp?P?P?P?P?P?P?Q?Q?Q(?Q8?QP?Q`?Qx?Q?Q?Q?Q?Q?Q?R?R?R(?R@?RP?Rh?Rx?R?R?R?R?R?R?S?S?S0?S@?SX?Sh?S?S?S?S?S?S?S?T?T ?T0?TH?TX?Tp?T?T?T?T?T?T?T?U?U ?U8?UH?U`?Up?U?U?U?U?U?U?V?V?V(?V8?VP?V`?Vx?V?V?V?V?V?V?W?W?W(?W@?WP?Wh?Wx?W?W?W?W?W?W?X?X?X0?X@?XX?Xh?X?X?X?X?X?X?X?Y?Y ?Y0?YH?YX?Yp?Y?Y?Y?Y?Y?Y?Y?Z?Z ?Z8?ZH?Z`?Zp?Z?Z?Z?Z?Z?Z?[?[?[(?[8?[P?[`?[x?[?[?[?[?[?[?\?\?\(?\@?\P?\h?\x?\?\?\?\?\?\?]?]?]0?]@?]X?]h?]?]?]?]?]?]?]?^?^ ?^0?^H?^X?^p?^?^?^?^?^?^?^?_?_ ?_8?_H?_`?_p?_?_?_?_?_?_?`?`?`(?`8?`P?``?`x?`?`?`?`?`?`?a?a?a(?a@?aP?ah?ax?a?a?a?a?a?a?b?b?b0?b@?bX?bh?b?b?b?b?b?b?b?c?c ?c0?cH?cX?cp?c?c?c?c?c?c?c?d?d ?d8?dH?d`?dp?d?d?d?d?d?d?e?e?e(?e8?eP?e`?ex?e?e?e?e?e?e?f?f?f(?f@?fP?fh?fx?f?f?f?f?f?f?g?g?g0?g@?gX?gh?g?g?g?g?g?g?g?h?h ?h0?hH?hX?hp?h?h?h?h?h?h?h?i?i ?i8?iH?i`?ip?i?i?i?i?i?i?j?j?j(?j8?jP?j`?jx?j?j?j?j?j?j?k?k?k(?k@?kP?kh?kx?k?k?k?k?k?k?l?l?l0?l@?lX?lh?l?l?l?l?l?l?l?m?m ?m0?mH?mX?mp?m?m?m?m?m?m?m?n?n ?n8?nH?n`?np?n?n?n?n?n?n?o?o?o(?o8?oP?o`?ox?o?o?o?o?o?o?p?p?p(?p@?pP?ph?px?p?p?p?p?p?p?q?q?q0?q@?qX?qh?q?q?q?q?q?q?q?r?r ?r0?rH?rX?rp?r?r?r?r?r?r?r?s?s ?s8?sH?s`?sp?s?s?s?s?s?s?t?t?t(?t8?tP?t`?tx?t?t?t?t?t?t?u?u?u(?u@?uP?uh?ux?u?u?u?u?u?u?v?v?v0?v@?vX?vh?v?v?v?v?v?v?v?w?w ?w0?wH?wX?wp?w?w?w?w?w?w?w?x?x ?x8?xH?x`?xp?x?x?x?x?x?x?y?y?y(?y8?yP?y`?yx?y?y?y?y?y?y?z?z?z(?z@?zP?zh?zx?z?z?z?z?z?z?{?{?{0?{@?{X?{h?{?{?{?{?{?{?{?|?| ?|0?|H?|X?|p?|?|?|?|?|?|?|?}?} ?}8?}H?}`?}p?}?}?}?}?}?}?~?~?~(?~8?~P?~`?~x?~?~?~?~?~?~???(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p?€?˜?¨?????? ?8?H?`?p?È?Ø?ð??????(?8?P?`?x?Ĉ?Ġ?İ??????(?@?P?h?x?Ő?Š?Ÿ??????0?@?X?h?ƀ?Ɛ?ƨ?Ƹ????? ?0?H?X?p?ǀ?ǘ?Ǩ?????? ?8?H?`?p?Ȉ?Ș?Ȱ??????(?8?P?`?x?Ɉ?ɠ?ɰ??????(?@?P?h?x?ʐ?ʠ?ʸ??????0?@?X?h?ˀ?ː?˨?˸????? ?0?H?X?p?̀?̘?̨?????? ?8?H?`?p?͈?͘?Ͱ??????(?8?P?`?x?Έ?Π?ΰ??????(?@?P?h?x?ϐ?Ϡ?ϸ??????0?@?X?h?Ѐ?А?Ш?и????? ?0?H?X?p?р?ј?Ѩ?????? ?8?H?`?p?҈?Ҙ?Ұ??????(?8?P?`?x?ӈ?Ӡ?Ӱ??????(?@?P?h?x?Ԑ?Ԡ?Ը??????0?@?X?h?Հ?Ր?ը?ո????? ?0?H?X?p?ր?֘?֨?????? ?8?H?`?p?׈?ט?װ??????(?8?P?`?x?؈?ؠ?ذ??????(?@?P?h?x?ِ?٠?ٸ??????0?@?X?h?ڀ?ڐ?ڨ?ڸ????? ?0?H?X?p?ۀ?ۘ?ۨ?????? ?8?H?`?p?܈?ܘ?ܰ??????(?8?P?`?x?݈?ݠ?ݰ??????(?@?P?h?x?ސ?ޠ?޸??????0?@?X?h?߀?ߐ?ߨ?߸????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p???????? ? ? 8? H? `? p? ? ? ? ? ? ? ? ? (? 8? P? `? x? ? ? ? ? ? ? ? ? (? @? P? h? x? ? ? ? ? ? ? ? ? 0? @? X? h? ? ? ? ? ? ? ? ? ? 0? H? X? p? ? ? ? ? ? ? ?? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x??????? ? ? 0? @? X? h? ? ? ? ? ? ? ?!?! ?!0?!H?!X?!p?!?!?!?!?!?!?!?"?" ?"8?"H?"`?"p?"?"?"?"?"?"?#?#?#(?#8?#P?#`?#x?#?#?#?#?#?#?$?$?$(?$@?$P?$h?$x?$?$?$?$?$?$?%?%?%0?%@?%X?%h?%?%?%?%?%?%?%?&?& ?&0?&H?&X?&p?&?&?&?&?&?&?&?'?' ?'8?'H?'`?'p?'?'?'?'?'?'?(?(?((?(8?(P?(`?(x?(?(?(?(?(?(?)?)?)(?)@?)P?)h?)x?)?)?)?)?)?)?*?*?*0?*@?*X?*h?*?*?*?*?*?*?*?+?+ ?+0?+H?+X?+p?+?+?+?+?+?+?+?,?, ?,8?,H?,`?,p?,?,?,?,?,?,?-?-?-(?-8?-P?-`?-x?-?-?-?-?-?-?.?.?.(?.@?.P?.h?.x?.?.?/?6h?6p?6x?6?6?6?6?6?6?6?6?6?6?6?6?6?6?6?6?7?7?7?7?7 ?7(?70?78?7@?7H?7P?7X?7`?7h?7p?7x?7?7?7?7?7?7?7?7?7?7?7?7?7?7?7?7?8?8?8?8?8 ?8(?80?88?8@?8H?8P?8X?8`?8h?8p?8x?8?8?8?8?8?8?8?8?;?;?;?;?;?<?<?<?<(?<0?<@??>?> ?>(?>8?>@?>P?>X?>h?>p?>?>?>?>?>?>?>?>?>?>?>????????(??0??@??H??X??`?????????????????????@?/@?@?@?@ ?@(?.@0?@8?@@?'@H?@P?@X?&@`?@h?@p?@x?@?@?@?(@?@?\@?]@?@?@?@?+@?@?@?D@?J@?@?A?A?0A?=A?>A ?;A(?A0?A8?A@?,AH?XAP??AX?9A`?*Ah?)Ap?Ax?AA?A?NA?A?A?A?A?A?A?A?CA?2A?1A? A?A?A?B?B?B?B? B ?B(?B0?B8?B@?BBH?vBP?BX?YB`?Bh?aBp?`Bx?dB?cB?iB?~B?zB?{B?:B?B?B?B?3B?B?B?B?}B?gB?C?C?C?nC?C ?C(?C0?C8?C@?CH?CP?CX?C`?Ch?Cp?Cx?C?5C?C?C?C?C?C?C?C?C?C?C?C?C?C?C?D?D?D?D?D ?D(?D0?D8?D@?DH?DP?DX?D`?Dh?Dp?Dx?D?D?D?D?D?D?D?D?D?D?D?D?D?D?D?D?E?E?E?E?E ?E(?E0?E8?E@?EH?EP?EX?E`?Eh?Ep?Ex?E?E?E?E?E?E?E?E?E?E?E?E?E?E?E?E?F?F?F?F?F ?F(?F0?F8?F@?FH?FP?SFX?EF`?Fh?uFp?[Fx?F?F?F?F?|F?mF?F?F?F?F?F?GF?6F?!F?F?F?G?G?G?G?G ?G(?G0?qG8?tG@?rGH?sGP?RGX?G`?Gh?Gp?Gx?G?G?G?G?G?G?<G?HG?G?G?G?G?G?G?G?G?H?@H?H?H?bH ?H(?H0?H8?H@?HH?HP?HX?_H`?^Hh?eHp?Hx?H?H?H?H?-H?fH?H?H?H?H?H?H?H?H?QH? H? I?I?oI?I? I ?yI(?wI0?I8?I@?hIH?IP?IX?I`?Ih?KIp?FIx?I?LI?I?8I?I?I?I?I?I?I?I?I?I?I?I?I?J?J?J?J?J ?J(?J0?J8?J@?4JH?JP? JX?ZJ`?Jh?Jp?Jx?7J?J?UJ?J?VJ?J?J?J?J?J?kJ?jJ?TJ?J?J?J?K?K?K?K?K ?K(?K0?K8?K@?KH?KP?KX?K`?Kh?Kp?Kx?K?K?K?K?K?K?K?K?K?K?K?K?K?K?xK?K?L?L?L?L?L ?L(?L0?L8?L@?LH?LP?LX?L`?Lh?Lp?MLx?L?L?L?L?L?L?L?L?L?L?L?L?L?L?L?L?M?M?M?M?M ?M(?M0?M8?M@?MH?PMP?pMX?OM`?Mh?lMp?IMx?WM?/usr/lib:/usr/vac/lib:/usr/vacpp/lib:/usr/lib:/liblibc.ashr_64.olibC.ashr_64.olibC.aansi_64.olibpthreads.ashr_xpg5_64.o __rtinitenvironerrnoaccesschdirchmodchowncloseexecvefsynckilllinkmkdir readlinkrenamermdirshmatshmctlshmdtshmgetsymlinksyncumaskunameunlinksocketbindlisten setsockopt gethostname_system_configuration ___memcmp64 ___bzero64 ___memmove64 ___fill64_iob __mod_initmalloccallocreallocfreegetenvread_real_timeexitatexitstrlen freopen64fopen64open64lseek64fprintffclosegetuidstrtoulstrchrabortsprintfwritegetpidtimefputs gettimeofdayfflush vsnprintffdopenfwritetolower localeconv_filbufreadstrncmpfputcungetcstrtod __fd_selectsignalsetpgrpgetppidsleepfreadtoupper endpwent getpwnam getpwuidstrdupfgetcstatvfsfstat64stat64strspnstrpbrk localtime_r gmtime_rctime_r asctime_r localtimectimeasctimemktimetime_base_to_timesystemwaitpid setlocale xdr_free xdr_stringsendtoqsortgetcwdforkdupopendir readdir_r closedirreaddirmktemppopenexecvalarmexecvptempnamttynamebsearchputenvtmpnam getgrgidutime strerror strftime iswalpha iswcntrl iswlower iswprint iswspace iswupper iswalnumecvt mkstemp64dlclosedlopendlsymstrtolgetc_unlockedputc_unlockedremovemkfifogethostbynamenacceptrecvgetpasspausecreat64 funlockfile flockfiledlerror gethostentgethostbyaddr endhostentgetservbyportgetservbynamerexec__run_final_dtors__run_initial_ctors __n_pthreads sys_nerr__crt0v_DBLINFopterroptindoptopt__malloc_user_defined_name __pth_init __pthread__CleanupCatchV6a __ReThrowV6#__setUncaughtExceptionFlag__3stdFb__start P = G 4Ҍ B E E F8 Fh F G GT P ` `  x    {$ (@8`|,` H        @pp,`@h(`@h  L@ `x!T!!!" "`"x""# #8####$ $\$%D%&&@&x&&''T''((8(`() .\.242`22404`5d55556@66YYZ$Z`ZZ]^^t^bXbcde\ehhiTijj jjkkrsvvwtwwwyy@yz@{{@| |@|hPl,`  0 (`x    8` (`| \,` `D @l d` |PP4`@@<`00@\ H D     @  @ X   @ X 0  @   h  @4`l@,`P P D (`h#@###$|$%%@%%&&@&0` T@p(`H,@tx      @ L    \ ,` 8`@`  @& &@))@)H))))***@*D****+++@+D+++0001 112T2233334 4$4`4t44555@5D55556@67;;@AAAB B,B`BlBBCCC@CDCCCF@F`HHI$I`IJJdJKK@KKLDLLM MMN0N`QXQR  (`h (`h $`l (`hP@|  L  @     d     `     H P@`d (` @ @@P8`l0<8` <` 0`    @ T TPhP!" #$$% 3334 66677d788::@<\<<= ?h??@AA@BXBGH K@K`L8L`M4M`MMOtOQxQTTWWWX XHXXX``````aaabbff@fLffffgg g@ggptppq q4q`qqt t@tptuv ww@y,y`zpz}HDp`l    |   @     \   ` `PPP,`x 0 @ hP@p@\8`   8 ` x  ( ` L ` @$`x h    $ `<` P4`@HX@$%)))*@*T***+@+,\,/H\@< |`\H |  d  P ,` l @/T/00@12 34 567899;;==??AAAB B,B`JJ@f f@yy|<|Tt8`ֈx٠  ݀ hP  (` @ 4 @h  $`@ t       @h@ Hdl<`h,`d @,`d\@  h   "##$$$@$% %$%`'L''''(((@(T((()L)*@***,, ../\//0 33@34 566(6`6667 7H7778L888899999:X:::;0;`<<=0=`===>? ?@?D?@\@@@A4A`DxDF<FFFJ8J`JdJMM@MDMNN@NDNNNNOOO@ODOQ(Q`QhQR,R`RdRRS S$S`UV V(V`VW W(W`WX [[[\\\@\L\\\\]]]@^^@^T^^^___````aaa@aTaaabpbbbbc cddeeeffgghiiijkkllm@mn@nooXoq,q`r<rs(s`tDtu@uvX@@H4`l  h    p    $ ` d @Ht@@DD x    T    X    @$`@ DL@Td @    l   @@| h(`   @ D  0`H`p X@|8` t $`4`l''228 P4L7+l8 p"8Hd@| @dXX `$`|   8 `@ T < <`@X@<`@ $`   ` h     @     l P0`d`    @""%&)))* *x***+(+`+d+, ,@,D,-...@/ /@/D/0p01@@ H@p@HD X@xH D%\%<0%&H'D-J0.2l3':(h:)8&*h80P P1H&2x<4XP4=#4=$ @H  $@0`@D$`@D``  @ D ` X        4 `@H@ @H (` , ` h @Ht<`h@@| dp`H@0`p`p @D  @D@ 8@Hx @H`  @@    P@D@x `d(`p@H @D@H@H@HPph ` X `h@H , `<hl@HH!@D@L (`h (`@D0@ 8x8@Hp @D@@H0X 0` @L   @t@\(`` @ < !! !@!L!!""8"#X#$$$%+@HfhљB܏܏Npjnltv"z(H`p|"rJxr|~ϙə ϙ  f tE ~܏ ޏ  ܏ "܏ f tE  ܏    |     H  h  |  >   D  h        >ә@ә&B*JN>>ߙBә4әBB88$ .  N^>8әә,:T |bp |>8әәnFz>ϙϙϙϙ(ϙDϙPtϙϙϙϙϙϙϙ ϙ@ϙPϙϙϙϙϙϙϙFVZlϙ|ϙϙϙϙϙϙϙϙϙ0ϙDϙXϙlϙϙϙϙϙϙ"&>&*>>> fB n> >!&>!>!>"f>">#">#>$F>$>%>%%.%f>%>%&B>&b>&x &>&>' ' |'>'''>(F(^>(l (xU((8(ڙ)ә)J)Lڙ)\U)ә)ڙ*>*f>*x*>*>+B>+>,>,N>,`8,>,-&>-d.>.(.6>.>/B>/>/0 >0,0>0>1 ҙ1>3z3ә4 4ә44ә5Z5pә55܏56 ܏6(6L6d8666 7>8 ܏8<8X88f99ә9H9t>99ә9998::0ә:r:|ә:܏;X;f>;t*;:;Z;*;܏;;ә<< ә<:܏>f܏> > > ?R?F?T? 1? /?V? ?X@ @܏@"ޏ@&@*>@6@Xҙ@{@܏@@@ ™@ ƙ@@@E@@E@fAEA hAEAtA EA*A0EA:>A@ AL AX Al |AۙA A A A4ABDiB\ BliB CxC4CH C}C CxCD(D}DDE kEnlEvEEFTFfFlFFݙF MGG G6VGD |GRXG\ |GpGG =GG<GəG yGəH |H2H< =HXəHbHx yHəH =HəH yHəKK&LLOL~FLMFMPTәPәQdәQәQәQәRәR"R( =RDəR` yRtəRәR =RəS yS0әSx =SəSlSS ySəS =T əTlT"T*THϙT` yTtəT =TəT yTəT =TəUlU U8 yULəU`UrU| =UəUlUUUϙU yVVV =V<əVL yV`əVnVx =VəVlVV yVəVWW$ W< WpÙW,WWWҙWX&XP,XXX<YVZZ*lZ.Z\ yZpZ~Z =ZəZlZZ yZə[x[l[[ y[[H[\&\]l]]( y]<]T[]lҙ]]^4^X ^p ^~^l^^_ _ _, _T_v_ __>`ҙaa@ҙaaabFb`әbc>c Ùcc>cccc(d*dXdzdәee( |e@ ele e e =eəe yfəffg.܏gjg8ggg>ghthۙhhhh =iəi&iT yihəiziәiiәiiәijәj6jFjzjjәkN܏kVk^kxMkkkϙkkϙlMl>l܏lllMlmNm^mbmlϙmzmϙmMm>n܏nn8әn\әoptәpәpәpәqRr*r4әrsN܏sjsәsәstjtr܏tt{{{{ M{{||6|@ |J|Z܏|>| ||>|| ||>||i|| |>} i}>}"}8Ù}J}i}~i~~$ ~.>~F>~L~n~~~ ~~~ =~~ə y əZ8bRfF ә *DәX28FLZޏ"LϙXә :BLәV`np|?,#%x1 '8l'98'T10?8Y>Llcl8888=?pƙ@ƙLRdƙpƙi?*R FbJ`8FҦTtԂ4F.ՔՠլGոΙ4@LIXdЙԏ4ҙ؄K4ټQܙ,@\p~ԏڌڤڸ֙֙֙\֙t֙ی֙ۤڙܜܴQܙ (1H\zԏ݀ݖԏݜݰ֙)) (֙H)` ހ/1  D/\֙߀)ߘ)ߴ֙) /@9 ??+?U?8?,Vd|H8| 8l|<xv||8|h$6JXb*4|Hp|  |     1 :&&&0`1p+$2`l11&fďnƏ1b0>t(6^rv2DXp.ww1,&:Jl~ & !"!&"&"D"#$ܙ$$% %0%&1&&&x&&(J))*)`&**1+,,:,).*.`.../4P455t85F6HB6l86B787B7F8,B8TF8 ?99*9R9z::":( :X: ;2;6;@ =;N;də;r; y;;ə;x8>8> ??( ? }??@@f@| @@ @@@@ A^AABCTDfDtDDD+EEE0ϙEvEzEϙEEEEEF F$F<FTF^FpϙFG4GGϙHH\HI.I2ILϙIIJnJJKәK֙KR"KT+LLLM^MdMMMNrNϙNN8OVO8O8O8OPH8PzP8P8QnQvQϙQϙRR"R&R*R@ϙSSSSәS֙T""T$+TT8TUU8UYyZh֙Z֙ZZZZ[h\4\\\\ә] ]P]] =]]]]ϙ^B^^^b^f^^ϙ_B_____`z`"``` =```aBa*aBaTabacdee,e>eNeXejeze~eeәeeefϙff"f&f8ϙfLfffg g"g,֙g6g:gFgJgNgfgtygggh yhhDϙhRh"hi:iVifi|yiiiijZjϙjjyjk"kk"k+kklll"llmm6m^mdmvmؙmmmmmn =nn0n<nfnjnnnϙno<"oRodϙonoyop0"pdyppypq "q.qLyqZq"qrϙrr\"rjrzrϙr͙rrr =rrrrϙss$st tt t*t8tH tVtl֙tzttt"t+tu u<͙uJuNuXәuuuәvvvәw:w"w+xry,yFyNy`ϙyyyzϙz"z&z8ϙzPzfzjzϙzzzzϙzz{{ϙ{4{J{N{hϙ{{{{ϙ||.|2|6|Pϙ||}}}~$~2~T~j~~~"~"`z~ ϙt <88$8l8z888NRZpϙϙ"+rv"+"rv֙@ҙ֙"*t֙ ҙ.֙Jҙhjҙ"Nt J0Rhә|әBؙ&B.,H@ ,ә@d0ؙJT ޙjpϙ =ϙ(ϙp = =BN@BpBҙƙҙ:`י L\ tי ͙ Y0HYl͙|ϙ ͙ MYY,͙8͙BP֙n| Mי @יl |י י, <`י י  יL \י י @י|(@Xp,D\<H V\x @\xBHlƙ rϙn:T֙xϙ֙$<v֙,(6N4n .B†´äòHƦ(JǂǾjr| @ ˘t2̞2ʹ__* `<nϼLа|VtjҬJӈ?Ӥ?*lԐ6BPWZdtWՄ1DT^r4 ^ׄ ת&`F|F|$|٦ssڔڢ۔ۢܐܞܢlz݊ݺ~̙<̙55B!L`n&!P&fj(6r0`t(V`88ZV`fPl~zfx.j0˙>B(HVn4A^AFB0.Hb$<bbN28Pbbt,Nt (RH0h|0  d     ,  `™ |™ . DI  I*l  @\B4jx2H,P,7P7$`tXp`0BbRq^!@"0#$^$^%t%%%&&'R(R)B*B+, -NR-R-R-R..R.R00T0d0r022*2Tv33&3P44*4R4z44455B5j5556љ7љ7lՙ7ՙ8Lə8˙90˙9ə:Př;\ř< = > ? @třALřA?BB* BR BzBBBCCBCjCCC D "D2$DZ&D(D*D,D.E"2EJ4Er6E8E:E<F>F:@FDGBFGHHJI"LINJbPKRKBLTLrTLLVLșL1M M(șMT˙MbTM~MVMșM1MMșNN0șN`1N|NșNșO,{OT˙ObTOOVOșO1OPșP:PPșP1PPșPșQDQRTQ~QVQșQ1QQșR0˙R:VRBRPșR1RRșSHSXS8T.TTRVTVT`șTrTT1TTVTTșT\TVUU\U,U6\UV\U\UU\U\U\V0VTVTVZV`1Vn\VrV|șV1VVșVTW\W\W8WFTWJ\WfWpșW1WWșW\WXTX \X&X0șX`1X|XșX\XTX\Y0YDY~Y1YYVYșY1YYVZ șZjTZnVZZ.Z.[.[4.[J[X1[hș[1[[ș\jT\n\~V\\V\.\V\.\V\.\V] .], ]` ] ] ^ ^\^_BV_H_RT_b_fV_xș___1___V_ș_` `&^`r`vV`ș`1``V`ș`^abTafDa~FaHaJaLaNaPaRaBa`abadafahajalanapbb Vbșb@1b\bxșb^bVcDc"FcBHcbJcLcNcPcBdRd,˙d:Tddșd1ddșee,șe`1e|eșeeșf1ff8șfL˙fZTfvfșf1ffșggșgP1glgșggșg1h h(șh<˙hJThfhtșh1hhșhi și@1i\ixșiiși1ijșj,˙j:TjVjdșj1jjșjjșk01kLkhșkkșk1klșl˙l*TlFlTșl1llșllșm 1m<mXșmzmșm1mmșn ˙nTn6nDșnp1nnșnnșo1o,oHșojoxșo1ooșo˙p Tp&p4șp`1p|pșppșq1qq8șqZqhșq1qqșq˙qTrr$șrP1rlrșrrșr1s s(șsJsXșs1ssșs˙sTttșt@1t\txșttșt1tușu:uHșufu1uuuușvTvHvLv"Dv&Fv*Pv.Bv2Jv6Nv:Rv>`vJdvNbvZfv^hvjlvrjvpvnvTwlw6w:VwDșwp1wwVwșwVwșx1xx.Vx@șxLlxTxNyVyyșy2yP1ybypy~yșyTyyșyy1zzzz0șz<NzTzS{{V{$ș{P1{l{~V{ș{V{ș{1{|V| ș|,S|T|X|V||ș}}01}B}P}^}pș}zT}}ș}}1}}}~ș~X~T~]~~Vș01L^VpșVș1Vș ]TbVș1"0>PșZTjtș1șbTgVș1,>VPșjVpș1VșgTVș01BP^pșzTș1șnTVș@1\nVșVș1VșFTTT*V0R`ș1ș,ș`1|ș\6Dșp1șș01Lhșș1ș(ș`1|șș18șFPș1șVș18șFNVXșnr1VșVș01Lhș~1T^V2Rr˙Vdș1șș01R`ș1ș˙ș@1\xșș1ș@1\xș˙ș1 (șN\ș1ș1 (ș<˙bpș1ș ș@1bpș1ș˙ șP1lșș1 șP1lș˙ș18ș^lș1ș18șL˙rș1șșP1rș1ș˙"0ș`1|șș1"0ș`1|ș˙ș1,Hșn|ș1ș1,Hș\˙ș1ș,ș`1ș1ș ˙2@șp1șș12@șp1ș˙ș 1<Xș~ș1ș 1<Xșl˙ș1ș.<șp1ș1ș˙BPș1șș 1BPș1ș˙ș01Lhșș1ș01Lhș^VT>^~4˙BTș1ș,ș`1|șș18șBTP˙^Tzș1ș,ș`1|șș18șBTP˙^Tzș1ș,ș`1|șș18șBTP˙^Tzș1ș,ș`1|șș18șBTP˙^Tzș1ș,ș`1|șș18șBTP˙^Tzș1ș,ș`1|șș18șBTP˙^Tzș1ș,ș`1|șș18șBTP˙^Tzș1ș,ș`1|șș18șBTP˙^Tzș1ș,ș`1ș1ș TZ^^V~˙TVș@1\jV|șVș1VșP1lzVŒș^&VBJTÞ.Jh˙ĺș18ș^lșŠ1żșș@1\xșƌ˙Ʋș1 (șN\șǐ1Ǭșș01Lhș|˙ȢȰș1ș>Lșɀ1ɜɸșș 1<Xșl˙ʒʠș1ș.<șp1ˌ˨șș1,Hș\˙̂̐ș1ș,ș`1|͘șͺș18șL˙r΀șΰ1șșP1lψșϪϸș1 (ș<˙bpșР1мș ș@1\xșњѨș1ș,˙R`șҐ1Ҭșș01LhșӊӘș1ș˙BPșԀ1ԜԸșș 1BPșnՀ1Ւՠծș^V:NV^rVւ֖Vֺ֦VTVTV&V6JVZďnV~ƏגVעT׶VȏVʏV̏"V2TFVVTjVzΏ؎V؞Џغҏ˙T"V0ș`1|َVٜșVș1.V<ș^bVtșڠ1ڼVșT˙T"V0ș`1|ێVۜșVș1.V<ș^bVtșܠ1ܼVșT˙T"V0ș`1|ݎVݜșVș1.V<ș^bVtșޠ1޼VșT˙T"V0ș`1|ߎVߜșVș1.V<ș^bVtș1VșT˙T"V0ș`1|VșVș1.V<ș^bVtș1VșT˙T"V0ș`1|VșVș1.V<ș^bVtș1VșT˙T"V0ș`1|VșVș1.V<ș^bVtș1VșT˙T"V0ș`1|VșVș1.V<ș^bVtș1VșT˙T"V0ș`1|VșVș1.V<ș^bVtș1VșT˙T"V0ș`1|VșVș1.V<ș^bVtș1VșT˙T"V0ș`1|VșVș1.V<ș^bVtș1VșT˙T"V0ș`1|VșVș1.V<ș^bVtș1VșT˙T"V0ș`1|VșVș1.V<ș^bVtș1VșT˙T"V0ș`1|VșVș1.V<ș^bVtș1VșT˙T"V0ș`1|VșVș1.V<ș^bVtș1VșT˙T"V0ș`1|VșVș1.V<ș^bVtș1VșT˙T"V0ș`1|VșVș1.V<ș^bVtș1VșT˙T"V0ș`1|VșVș1.V<ș^bVtș1VșT"^FVbԏ֏؏ڏ܏ޏ˙&Tn|ș1șșP1lșș1 (ș<˙JTftș1ș ș@1\xșș1ș,˙:TVdș1șș01Lhșș1ș˙*TFTș1șș 1<Xșzș1ș ˙T6Dșp1șș1,Hșjxș1șBTJVzVVVV  V . BV R fV v V  ˙ T  V ș P1 l ~V ș  V ș 1  V ,ș N RV dș 1  V ș T ˙ T  V ș P1 l ~V ș  V ș 1  V ,ș N RV dș 1  V ș T ˙ TV șP1l~VșVș1 V,șNRVdș1VșT˙TV șP1l~VșVș1 V,șNRVdș1VșT˙TV șP1l~VșVș1 V,șNRVdș1VșT˙TV șP1l~VșVș1 V,șNRVdș1VșT˙TV șP1l~VșVș1 V,șNRVdș1VșT˙TV șP1l~VșVș1 V,șNRVdș1VșT˙TV șP1l~VșVș1V(șFJ`1|VșTB&TRVV`ș1VșZT~RVV`ș1șVș01LhșvzVș1Vș *T Z^ T T!T!JT"V#j#j$T$T$T%%V%$ș%P1%l%ș%T%&V& ș&@1&\&xș&&1&V&&ș&1' '(ș'T'V''ș''1((((0ș((((((ҏ((ޏ)VT)vV)T)\))ș*1*,*Hș*T**ș*1+ +(ș+:T+b+hș+1++ș+,ș,01,L,hș,zV,,,ș,T,1,-ș-&-*V-4ș-`1-|-V-ș-T--1.T.>T.nV.r.|ș...1..V..ș.T/BT/JV/z/V//V//V//V0 0V0.0J0`˙0nT00V0ș011 1V1,ș1R1VV1dș1111V1ș11V2ș2012L2^V2lș2vT2˙2T22V2ș213 3V3,ș3R3VV3dș3133V3ș33V4ș4014L4^V4lș4vT4˙4T44V4ș415 5V5,ș5R5VV5dș5155V5ș55V6ș6016L6^V6lș6vT6˙6T66V6ș617 7V7,ș7R7VV7dș7177V7ș77V8ș8018L8^V8lș8vT8˙8T88V8ș819 9V9,ș9R9VV9dș9199V9ș99V:ș:01:L:^V:lș:vT:˙:T::V:ș:1; ;V;,ș;R;VV;dș;1;;V;ș;;<1<<*<.V<@ș>,ș>`1>|>ș>>ș?1?"?0ș?`1?|?ș?˙??ș@1@,@Hș@n@|ș@1@@șA1A,AHșA\˙AAșA1AAșBB,șB`1BBșB1BBșC ˙C2C@șCp1CCșCCșD1D2D@șDp1DDșD˙DDșE 1E<EXșE~EșE1EEșF 1F<FXșFl˙FFșF1FGșG.G<șGp1GGșG1GHșH˙HBHPșH1HHșHHșI 1IBIPșI1IIșI˙IJșJ01JLJhșJJșJ1JKșK01KLKhșKTK^KTLTL>TLLMLMDNTO8OfOjVO|șO1OOșP șP@1P\PxșP8QXQ*ZQRrQztQvQxQzR|RB~Rj R RRS S2SZS TTU<UxUV|VWLWXƙXXX&XƏXďX(Y*YY4bY<dYHYYbYdY*YYbZpZxZdZƙ[[[*[\ b\ v\(d\]~]ƙ]]^^^"^6*^b*^b^v^d^^`ƙaaa*aabavadbBbbbc^cd d "d"dNdP"dfddƙeee:eee*f<bfPvfXdfvfffgp?g$g,g.h nh.4h\ hn4h h4h h4i i.4i` jd:jr8j4j k4k lJ4ld l4l m4mm8m4m m8n$ n0n<n8n4no.>oJ@oo4oϙoo@oBp>p2p64pHϙpb@p@p@qFBq4r r r<rr8r4s s*8ss4t$ tjt?u2u*6uR:uzDuFuHuJvLvw(,wL,xjxnRxRz"z^Rzhzb{2{h,{,|~ ~FR~P~hbH,l,RRB~RbR,,*fRpb?*NNNJNNP&P>PzPP>PP"PPP2PPPZPPPPĆTĔ ~T |ƲVXt ?Ȉ |ȖZȜ Z(>t>>>8>͘>ά>`>|> Tр8Ѹ88  Ҽ 8 P8|8$888݄ݔ>d ?\  ^ә^ә Tl    ™     .^8әF^Lә`  ?`` `  0@ hx  `` j"&8 |BT ^ |  `0ܙ>LW`r``8B`fjҙ,H`Wj&*`ҙ0J`P =`Wj`` =W&V`\ =lWv`zܙW(W2``(WxT ^jnϙ`$ "2`RV`ϙ@W` W&`fjvzW``NT p  Lixܙi =iWܙi,ə<` șxiܙi =iWNXܙxi >Hܙbh  0 BLZ``"`b`666,6H6d6666`jtҙd =W48@\hʙ| =W88( < P d x  J4z68:8әh8|88468: . < FP F ?T'' Y t  4a S S 4  a  B b r  ә  f c  f  @ę ™ c ә"jәTD?b*dfhNnRhfpr.t< \ p֙ rD\88 r848l , l nBnnfhLf hP |` r| | rrn t"pjppDL rVph (Td zp >>>(>P>^n>>>>$>@ X f2h r r rrt , @Vp   * X p  $  $!!*n!f!h","f"h#*#.p#n$r$n$&t$4 $Jp$d $t r$8% % r%8% % r%8& & r&48&H &X r&l8'&p'4'< r'Jt'X (($ r(h(8( r()8)8 r)x)8)* *P*p* *+Bf+fh+ r+r+t+ ,, ,D ,T r,h8,| , r,8, , r,8,,p,-, -` --. $.2.< $./f/h/l0f0>h0rr0n0t0p11 r2 (2x2n3 3jp3t 3n34>40>4X>4>4>4>4>5>5<>5d>5h5f60 r6:r6Nt6t ,6 667p74 7`77 $77 $8H;f;r;p;t; ;< <0 < =T = r=8==8>8> >l >>>>>>?>?8>?P>?x>?>?>?>@Fr@@fApA~fAB&fBBfBEfEhF,FhFfGpGBnGrGnGtHP HH HI8I, I8IX8Il I II (J@ JL Jh JJfK:hKlKvrKtKtL LM MD8MpMpMNP NftO0OP8O\O| OP8PjtPx 0PtP .P Q Q,QpQpRBpSfSBfSfhSrSnStS SpST T< TlT TT8T8UpU U"tU`UnrVfVNhVfrVztV VV8V WWpWl WztWrWXFhXJpXVnXvfXhXpXfXnYhYpYnYfZ&hZ*pZ6fZ:nZhZpZnZf[fh[jp[vf[zn\h\ p\n\6f\h\p\f\n]Ff]d]t^, r^:p^\^jp^^י^p^p^^p^p_Bp_L _p____י_p_י`p` `*p`< `Jp`T `bp`l`zpaHbfbjbf\b>blc>c>ccldϙd ϙd2d6ld@ϙdXϙdtϙdfe ?g"vgviL 4?ijzkzkәlәl( TlD TlRzlpәl Tlzlәn>znznnznәozoәozoәpzpәqjqzqqzqqzqәrzr$әrBzr`әr~zrәrzrәrzsәs&zs,әszzsәszsәwxx|x:|xDx|x|xy2y>|yZyf|y|yyzzzz{"{2{R{b{{ϙ{{||J|}|~|~.~R|||6F|N:||*n||||6|* |$ |.||||*|>BLϙv||"":| Q|4| 8||| &*0BFLF|d B26:|>BF^bj.`nv8> .f@~||||2|26|F|B|F| әә@| bjn~j0Pr .B|l zϙtDFJvj"FZr*nt"&*R- Ĥ J?*Ű =ďϙ&Ə<əHX ytљƌǙƮďƴϙď =ƏəD yXəfďl | ǘǼ֙HȀȎȤϙɆ( P˘ ,# }H#ͨ nϐ (t $ @t }Ӹ,Zx  }ְ },#ר# `ٔ }Lzژ @ p۸ P ܢ?*RzʏJ̏P `p ހގΏޤް Z8 =Tə߄ yߘə$Z@`xZjʏ26̏@Wn̏t K ϙtϙϙϙ*4 =>ΏTə yə̏ ̏ Ώ̏̏$ @ZJZ̏` ΏΏ̏  "̏( 6̏P h|̏ 88"̏0ϙ< ƙvz̏W |\FJ̏lϙv̏ϙ̏Ώ̏"bjj z ~ |jUj̏ =Ώə y əH8 ƙ,M8QHOTMQOz?~|,|||,|X||| |4|`|||<|h|xhh֏P;n֏v;֏;0$|8,Pl| @Ph|D|hH 0יH|,||,|||h||,0|t Lv ޏ , P,  ~ | 4 _ c h L| X~ a ~ ~ a aaDh80Џy6T?j?*Rz ,8`b@fDg?&nʏ ә | |j0әD |X |<l   $  4 D  T d  t   Z   Z!0K!:!Nj!Z!dϙ!p! ~"( "@ "PW"d" ~# #4 #L =#hə#x y#ə##ϙ# =#ə# y$ə$ =$4ə$D y$Xə$t$$$$W%&ʏ% %% |%%j%&ә&0 |&H ~&R&f&n&&P&&&ʏ&j'.'2'6'Dә'P ='Z'tə' y''ə''''P''(ʏ(j(.(4 |(B(L |(V))$ T+*-p?--./i/*/4 /Hi/// 00v0012145l556T67ʙ8Ù8F9Ù9Z9ʙ9Ù9::,̙:6:;;i;*;4 ;Di<>>??ʙ??@@2@D̙@N@Bd̙BnCHÙC'DBDʙDD̙DEFEt̙E~F"G̙HII(̙I2JJ̙JKK̙KMN0̙N:NXϙNlϙNϙNϙNϙNϙNϙNϙNϙOϙO4ϙOXϙO|ϙOϙOϙOϙOϙOϙP ϙP ϙP0ϙPDϙPXϙPhϙP|ϙPϙPϙPϙPϙQ ϙQϙRRRR̙RSFS`̙SjSS̙STFT`̙TjUUUV|ÙVV VWW WϙW WϙXLXT Xb XlәX X XәX Y Y ZϙZ ZϙZ(\ \ә\ \ә] ]ә] ] ә]2 ]8ә]J ]Pә]b ]hә]z ]ә] ]L] ] ] ^ ^ә^6 ^@ә^R ^Xә^j ^pә^ ^ә^ ^ә^ ^ә^ ^ә^ә^ _ _ϙbp c(c cZ crc?dd* dRdd dәd |e |e,әeHep |eәee?f\f4 |fFfNf` |fx fҙfKff |fcff fәf |gcg g g$g\ |gjgt |gg |gg g |g |g ~h ™h$ zh@ |hfhp |h~h |hh h |i iib\i\ij*\jD ~jN\jRj` |jj\jx |j\j ?kkl l hlll m2mP mm mm n>n` omo*oRozoooo op*pJpRph pvppp ppqq q&qbqfq qr4ՙrrs@ sNt8tt tu u:uT uu vfv vvwlЙx^xx xxxxy y"yyyy yzBzfz zzzz z{0{J{h |2|P |`ߙ||} }}} ~"~< ~~ ~ߙt֙ *љ@֙P^| *љ @֙L|g? ""$J&r(*,. w0ҙ8888 w00ҙP w ?2<<<p? | |&DD&D?H DҙLtfL<tphHZ0?Tv?j?NtNt0x,^?PdvPә<>?Z \0Tҙҙ\B"Z,D*BxBZZ,`l zZZ "Z,Ddx*Z4͙L͙X͙h͙x͙͙͙͙͙͙͙͙͙@͙|͙͙͙,͙`͙͙͙ZZV\z\VZl\ZBZP͙`͙t͙Z͙͙$͙P͙͙͙͙\B\\\.\2ddNd\ZD:BFTZ\\Jd~Z>.dBZL Zdd ʙ ʙ\Z ^hϙ Z0ә\Zd\P"d*\fdppsĄ֙Ĝ ĦZ $<`™X$P lDŽǔǬ™,< Tlәәә<әx™ʎ^ʜ ʪ0ʲ``6b˦`˸ә```J`b.`̞^̬ә͎h͜Eͪjʹ͙RlFnә p E(͙ΆpΔE΢jΨ͙ζRκlξjF.f<EJjT͙bRjlrFtE j͙"R*l2Fvi (i4Pd xќ.jϙjW0<HZj`͙pxd҄ҜҪjϙ-jә͙j$͙DəT yhəzjӀ͙ӌ MӤ =ӲjӼ<ə yəj0ә@͙\ənjtәԄ͙Ԕ yԨəjϙ =j< ə0 yDəT fjlәx՘հւrx$ 0>zFd8|W8B|Fzئzz"zLBZzٶz(x6\:ژ z$x2\6۔ zz z&z,:z@bzh܈ܒzz|x`irxzz݈ܙݒzݤiݶݾz zz*z4FJzT =^bxlWvz|ފzޚzްəz yzzʙz =*.x8WBzHVzfz|ə߆zߖߞzzbzrxWz yzzz6:zD =PiZ^xhWvzəzz yzz*zzz(6Xlz\H ™R~pz\Zx,~?܏,4V^dϙpE܏<D?"@0܏Z` =jə yəϙJJ0J r$088d+7FH yRV^nr y&6: yz| y*BJN&6: yBD yNR  yfvz y.>B y^jnFVZ y    f h y r v  * .     y  V^bzr y :NR y y" JL yVZ y BD yNR~RVbfjn y*.nr y6: yvz y&*nr y   !!!2!""b"d y"n"""## y##.#F#Z## y##$.$R$$%%f%h y%r%%%&& y&*&>&&'' y'*'>'''' y'(("($ y(.(()j)l y)v)))*2*4 y*>*R*j*~** y**+++,-->-N--.2.4 y.>.B///z/| y///////2F2R2N?33l |4 |444L |4 |447`J?777ϙ77ҙ88 ϙ8.84ϙ8D8f8pϙ8~8ϙ88M88ϙ88ϙ99ϙ99B9Pϙ9^9dϙ9t99ϙ99ϙ99ϙ9:ϙ::$ϙ:2:<ϙ:J:Tϙ:b:hϙ:x::ϙ::ϙ; ;ϙ; ;J;Tϙ;b;pϙ;;M;_?<4<\S<S=S=PS=S> r>( r>D>^ď>dϙ>vď>ϙ>ď>ϙ>ď>ϙ>ď>ϙ>ď?ϙ?ď? ϙ?2ď?<ϙ?Rď?\ϙ?jď?lϙ?~ď?ϙ?ď?ϙ?ď?ϙ?ď?ϙ@ď@ ϙ@:ď@Dϙ@T z@jď@tϙ@ď@ϙ@ď@ϙ@ď@ϙ@ď@ϙ@ z@ďA ϙAďA ϙA2ďA8ϙARďA\ϙAnďAtϙA zAďAϙAďAϙAďAϙAďAϙBďB ϙB zB.ďB<ϙBJďBPϙBbďBhϙBďBϙBďBϙBBQ?C` CpCCC֙CȏCCOCD ڙDiD, D8DFDNȏD\ DDDDEEE(EE8EE@EXJEhEEpEEEȏE =EE yEəEEEȏF =FF$əF0F@ yFTəF`FG GLH*ƏH4 HZƏH` HzƏH HƏH H ?II*IRIzIIJ^؏JtJYK,KrL,L rL@,L`rL,LrLYM$YM\͙MMNNN4YNl͙N؏NrNrNrNrOPJ? ? ? #? \? !? ? H? ? ? ?????????????? ?(?0?8?@?H?P?X?`?h?p?x?????????? Q? 1? 5? 9? =? A? E? I?( M? +? +? +?( +?0 +? ]? ]? ]? ]?5 ]?5 ]?5 ]?6 ]?6 ]?6 ]?6 ]?6 ]?6( ]?60 ]?68 ]?6@ ]?6H ]?6P ]?6X ]?6` ]?6h ]?6p ]?6x ]?6 ]?6 ]?6 ]?6 ]?6 ]?6 ]?6 ]?6 ]?6 ]?6 ]?6 ]?6 ]?6 ]?6 ]?6 ]?6 ]?7 ]?7 ]?7 ]?7 ]?7 ]?7( ]?70 ]?78 ]?7@ ]?7H ]?7P ]?7X ]?7` ]?7h ]?7p ]?7x ]?7 ]?7 ]?7 ]?7 ]?7 ]?7 ]?7 ]?7 ]?7 ]?7 ]?7 ]?7 ]?7 ]?7 ]?7 ]?7 ]?8 ]?8 ]?8 ]?8 ]?8 ]?8( ]?80 ]?88 ]?8@ ]?8H ]?8P ]?8X ]?8` ]?8h ]?8p ]?8x ]?8 ]?8 ]?8 ]?8 ]?8 ]?8 ]?8 ]?8 ]?8 ]?8 ]?8 ]?8 ]?8 ]?8 ]?8 ]?@ ]?@ ]?@ ]?@ ]?@ ]?A ]?A ]?A ]?A ]?A ]?A( ]?A0 ]?A8 ]?A@ ]?AH ]?AP ]?AX ]?A` ]?Ah ]?Ap ]?Ax ]?A ]?A ]?A ]?A ]?A ]?A ]?A ]?A ]?A ]?A ]?A ]?A ]?A ]?A ]?A ]?A ]?B ]?B ]?B ]?B ]?B ]?B( ]?B0 ]?B8 ]?B@ ]?BH ]?BP ]?BX ]?B` ]?Bh ]?Bp ]?Bx ]?B ]?B ]?B ]?B ]?B ]?B ]?B ]?B ]?B ]?B ]?B ]?B ]?B ]?B ]?B ]?B ]?C ]?C ]?C ]?C ]?C ]?C( ]?C0 ]?C8 ]?C@ ]?CH ]?CP ]?CX ]?C` ]?Ch ]?Cp ]?Cx ]?C ]?C ]?C ]?C ]?C ]?C ]?C ]?C ]?C ]?C ]?C ]?C ]?C ]?C ]?C ]?C ]?D ]?D ]?D ]?D ]?D ]?D( ]?D0 ]?D8 ]?D@ ]?DH ]?DP ]?DX ]?D` ]?Dh ]?Dp ]?Dx ]?D ]?D ]?D ]?D ]?D ]?D ]?D ]?D ]?D ]?D ]?D ]?D ]?D ]?D ]?D ]?D ]?E ]?E ]?E ]?E ]?E ]?E( ]?E0 ]?E8 ]?E@ ]?EH ]?EP ]?EX ]?E` ]?Eh ]?Ep ]?Ex ]?E ]?E ]?E ]?E ]?E ]?E ]?E ]?E ]?E ]?E ]?E ]?E ]?E ]?E ]?E ]?E ]?F ]?F ]?F ]?F ]?F ]?F( ]?F0 ]?F8 ]?F@ ]?FH ]?FP ]?FX ]?F` ]?Fh ]?Fp ]?Fx ]?F ]?F ]?F ]?F ]?F ]?F ]?F ]?F ]?F ]?F ]?F ]?F ]?F ]?F ]?F ]?F ]?G ]?G ]?G ]?G ]?G ]?G( ]?G0 ]?G8 ]?G@ ]?GH ]?GP ]?GX ]?G` ]?Gh ]?Gp ]?Gx ]?G ]?G ]?G ]?G ]?G ]?G ]?G ]?G ]?G ]?G ]?G ]?G ]?G ]?G ]?G ]?G ]?H ]?H ]?H ]?H ]?H ]?H( ]?H0 ]?H8 ]?H@ ]?HH ]?HP ]?HX ]?H` ]?Hh ]?Hp ]?Hx ]?H ]?H ]?H ]?H ]?H ]?H ]?H ]?H ]?H ]?H ]?H ]?H ]?H ]?H ]?H ]?H ]?I ]?I ]?I ]?I ]?I ]?I( ]?I0 ]?I8 ]?I@ ]?IH ]?IP ]?IX ]?I` ]?Ih ]?Ip ]?Ix ]?I ]?I ]?I ]?I ]?I ]?I ]?I ]?I ]?I ]?I ]?I ]?I ]?I ]?I ]?I ]?I ]?J ]?J ]?J ]?J ]?J ]?J( ]?J0 ]?J8 ]?J@ ]?JH ]?JP ]?JX ]?J` ]?Jh ]?Jp ]?Jx ]?J ]?J ]?J ]?J ]?J ]?J ]?j ]?j _?j ]?j _?j ]?j _?j ]?k _?k ]?k _?k ]?k _?k( ]?k0 _?k8 ]?k@ ]?kH ]?kP ]?kX ]?k` ]?kh ]?kp ]?kx ]?k ]?k ]?k _?k ]?k ]?k ]?k _?k ]?k ]?k ]?k _?k ]?k ]?k ]?k ]?k ]?l ]?l ]?l ]?l ]?l ]?l( ]?l0 ]?l8 ]?l@ ]?lH ]?lP _?lX ]?l` _?lh ]?lp ]?lx ]?l _?l ]?l _?l ]?l ]?l ]?l ]?l ]?l ]?l ]?l ]?l ]?l ]?l ]?l ]?l ]?m ]?m ]?m ]?m ]?m ]?m( ]?m0 ]?m8 ]?m@ ]?mH ]?mP ]?mX ]?m` ]?mh ]?mp ]?mx ]?m ]?m ]?m _?m ]?m ]?m ]?m ]?m ]?m _?m ]?m ]?m ]?m ]?m ]?m ]?m ]?n ]?n ]?n ]?n ]?n ]?n( ]?n0 ]?n8 ]?n@ ]?nH ]?nP _?nX ]?n` ]?nh ]?np ]?nx ]?n ]?n ]?n ]?n ]?n ]?n ]?n ]?n ]?n ]?n ]?n ]?n ]?n ]?n ]?n ]?n ]?o ]?o ]?o ]?o ]?o _?o( ]?o0 ]?o8 ]?o@ ]?oH ]?oP _?oX ]?o` ]?oh ]?op ]?ox ]?o _?o ]?o ]?o ]?o ]?o ]?o ]?o ]?o ]?o ]?o _?o ]?o ]?o ]?o ]?o ]?p _?p ]?p ]?p ]?p ]?p( ]?p0 _?p8 ]?p@ ]?pH ]?pP ]?pX ]?p` _?ph ]?pp ]?px ]?p ]?p ]?p _?p ]?p ]?p ]?p ]?p ]?p _?p ]?p ]?p ]?p ]?p ]?p ]?p ]?q ]?q ]?q ]?q ]?q ]?q( ]?q0 ]?q8 ]?q@ ]?qH ]?qP _?qX ]?q` ]?qh ]?qp ]?qx ]?q ]?q ]?q ]?q ]?q ]?q ]?q ]?q ]?q ]?q ]?q ]?q ]?q ]?q ]?q ]?q ]?r ]?r ]?r ]?r ]?r ]?r( ]?r0 ]?r8 ]?r@ ]?rH ]?rP ]?rX ]?r` ]?rh ]?rp ]?rx ]?r ]?r ]?r ]?r ]?r ]?r ]?r ]?r ]?r ]?r ]?r ]?r ]?r ]?r ]?r ]?r ]?s ]?s ]?s ]?s ]?s ]?s( ]?s0 ]?s8 ]?s@ ]?sH ]?sP ]?sX ]?s` ]?sh ]?sp ]?sx ]?s ]?s ]?s ]?s ]?s ]?s ]?s ]?s ]?s ]?s ]?s ]?s ]?s ]?s ]?s ]?s ]?t ]?t ]?t ]?t ]?t ]?t( ]?t0 ]?t8 ]?t@ ]?tH ]?tP ]?tX ]?t` ]?th ]?tp ]?tx ]?t ]?t ]?t ]?t ]?t ]?t ]?t ]?t ]?t ]?t ]?t ]?t ]?t ]?t ]?t ]?t ]?u ]?u ]?u ]?u ]?u ]?u( ]?u0 ]?u8 ]?u@ ]?uH ]?uP ]?uX ]?u` ]?uh ]?up ]?ux ]?u ]?u ]?u ]?u ]?u ]?u ]?u ]?u ]?u ]?u ]?u ]?u ]?u ]?u ]?u ]?u ]?v ]?v ]?v ]?v ]?v ]?v( ]?v0 ]?v8 ]?v@ ]?vH ]?vP ]?vX ]?v` ]?vh ]?vp ]?vx ]?v ]?v ]?v ]?v ]?v ]?v ]?v ]?v ]?v ]?v ]?v ]?v ]?v ]?v ]?v ]?v ]?w ]?w ]?w ]?w ]?w ]?w( ]?w0 ]?w8 ]?w@ ]?wH ]?wP ]?wX ]?w` ]?wh ]?wp _?wx ]?w _?w ]?w _?w ]?w _?w ]?w _?w ]?w _?w ]?w _?w ]?w _?w ]?w _?w ]?x _?x ]?x _?x ]?x _?x( ]?x0 _?x8 ]?x@ _?xH ]?xP _?xX ]?x` _?xh ]?xp _?xx ]?x _?x ]?x _?x ]?x _?x ]?x _?x ]?x _?x ]?x _?x ]?x _?x ]?x _?x ]?y _?y ]?y _?y ]?y _?y( ]?y0 _?y8 ]?y@ _?yH ]?yP ]?yX ]?y` ]?yh ]?yp ]?yx ]?y ]?y ]?y ]?y ]?y ]?y ]?y ]?y ]?y ]?y ]?y ]?y ]?y ]?y ]?y ]?y ]?z ]?z ]?z ]?z ]?z ]?z( ]?z0 ]?z8 ]?z@ ]?zH ]?zP ]?zX ]?z` ]?zh ]?zp ]?zx ]?z ]?z ]?z ]?z ]?z ]?z ]?z ]?z ]?z ]?z ]?z ]?z ]?z ]?z ]?z ]?z ]?{ ]?{ ]?{ ]?{ ]?{ ]?{( ]?{0 ]?{8 ]?{@ ]?{H ]?{P ]?{X ]?{` ]?{h ]?{p ]?{x ]?{ ]?{ ]?{ ]?{ ]?{ ]?{ ]?{ ]?{ ]?{ ]?{ ]?{ ]?{ ]?{ ]?{ ]?{ ]?{ ]?| _?| ]?| _?| ]?| ]?|( ]?|0 ]?|8 ]?|@ ]?|H ]?|P ]?|X ]?|` ]?|h ]?|p ]?|x ]?| ]?| ]?| ]?| ]?| ]?| ]?| ]?| ]?| ]?| ]?| ]?| ]?| ]?| ]?| ]?| ]?} ]?} ]?} ]?} ]?} ]?}( ]?}0 ]?}8 ]?}@ ]?}H ]?}P ]?}X ]?}` ]?}h ]?}p ]?}x ]?} ]?} ]?} ]?} ]?} ]?} ]?} ]?} ]?} ]?} ]?} ]?} ]?} ]?} ]?} ]?} ]?~ ]?~ ]?~ ]?~ ]?~ ]?~( ]?~0 ]?~8 ]?~@ ]?~H ]?~P ]?~X ]?~` ]?~h ]?~p ]?~x ]?~ ]?~ ]?~ ]?~ ]?~ ]?~ ]?~ ]?~ ]?~ ]?~ ]?~ ]?~ ]?~ ]?~ ]?~ ]?~ ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` _?h ]?p ]?x ]? ]? ]? _? ]? _? ]? _? ]? _? ]? ]? ]? ]? ]? _? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` _?h ]?p _?x ]? _? ]? _? ]? _? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 _?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? _? ]? _? ]? _? ]? _? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? _? ]? _?( ]?0 _?8 ]?@ ]?H ]?P _?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ _?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? _? ]? _? ]? _? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 _?8 ]?@ _?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? _? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? _? ]? _? ]? _? ]? _? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? _? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? _? ]? ]? ]? ]? ]? ]? ]? ]? ]? _? ]? _? ]? _? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? _? ]? _? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? _?( ]?0 _?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p _?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? _? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p _?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? _? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` _?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ _?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?€ ]?ˆ ]? ]?˜ ]?  ]?¨ ]?° ]?¸ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?À ]?È ]?Ð ]?Ø ]?à ]?è ]?ð ]?ø ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?Ā ]?Ĉ ]?Đ ]?Ę ]?Ġ ]?Ĩ ]?İ ]?ĸ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?ŀ ]?ň ]?Ő ]?Ř ]?Š ]?Ũ ]?Ű ]?Ÿ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?ƀ ]?ƈ ]?Ɛ ]?Ƙ ]?Ơ ]?ƨ ]?ư ]?Ƹ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?ǀ ]?Lj ]?ǐ ]?ǘ ]?Ǡ ]?Ǩ ]?ǰ ]?Ǹ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?Ȁ ]?Ȉ ]?Ȑ ]?Ș ]?Ƞ ]?Ȩ ]?Ȱ ]?ȸ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?ɀ ]?Ɉ ]?ɐ ]?ɘ ]?ɠ ]?ɨ ]?ɰ ]?ɸ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?ʀ ]?ʈ ]?ʐ ]?ʘ ]?ʠ ]?ʨ ]?ʰ ]?ʸ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?ˀ ]?ˈ ]?ː ]?˘ ]?ˠ ]?˨ ]?˰ ]?˸ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?̀ ]?̈ ]?̐ ]?̘ ]?̠ ]?̨ ]?̰ ]?̸ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?̀ ]?͈ ]?͐ ]?͘ ]?͠ ]?ͨ ]?Ͱ ]?͸ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?΀ ]?Έ ]?ΐ ]?Θ ]?Π ]?Ψ ]?ΰ ]?θ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?π ]?ψ ]?ϐ ]?Ϙ ]?Ϡ ]?Ϩ ]?ϰ ]?ϸ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?Ѐ ]?Ј ]?А ]?И ]?Р ]?Ш ]?а ]?и ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?р ]?ш ]?ѐ ]?ј ]?Ѡ ]?Ѩ ]?Ѱ ]?Ѹ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?Ҁ ]?҈ ]?Ґ ]?Ҙ ]?Ҡ ]?Ҩ ]?Ұ ]?Ҹ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?Ӏ ]?ӈ ]?Ӑ ]?Ә ]?Ӡ ]?Ө ]?Ӱ ]?Ӹ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?Ԁ ]?Ԉ ]?Ԑ ]?Ԙ ]?Ԡ ]?Ԩ ]?԰ ]?Ը ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?Հ ]?Ո ]?Ր ]?՘ ]?ՠ ]?ը ]?հ ]?ո ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?ր ]?ֈ ]?֐ ]?֘ ]?֠ ]?֨ ]?ְ ]?ָ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?׀ ]?׈ ]?א ]?ט ]?נ ]?ר ]?װ ]?׸ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?؀ ]?؈ ]?ؐ ]?ؘ ]?ؠ ]?ب ]?ذ ]?ظ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?ـ ]?و ]?ِ ]?٘ ]?٠ ]?٨ ]?ٰ ]?ٸ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?ڀ ]?ڈ ]?ڐ ]?ژ ]?ڠ ]?ڨ ]?ڰ ]?ڸ ]? ]? ]? ]? ]? ]? ]? _? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?ۀ ]?ۈ ]?ې ]?ۘ ]?۠ ]?ۨ ]?۰ ]?۸ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?܀ ]?܈ ]?ܐ ]?ܘ ]?ܠ ]?ܨ ]?ܰ ]?ܸ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?݀ ]?݈ ]?ݐ ]?ݘ ]?ݠ ]?ݨ ]?ݰ ]?ݸ ]? ]? ]? ]? ]? ]? ]? ]? ]? _? ]? _? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?ހ ]?ވ ]?ސ ]?ޘ ]?ޠ ]?ި ]?ް ]?޸ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]?߀ ]?߈ ]?ߐ ]?ߘ ]?ߠ ]?ߨ ]?߰ ]?߸ ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ]?( ]?0 ]?8 ]?@ ]?H ]?P ]?X ]?` ]?h ]?p ]?x ]? ]? ]? ]? ]? ]? ]? ]? ]? ]? ? ? ? ? ? ? ? ? ? ?( ?0 ?8 ?@ ?H ?P ?X ?` ?h ?p ?x ? ? ? ? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '? '? '? '? '? ('? 0'? 8'? @'? H'? P'? X'? `'? h'? p'? x'? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? ('? 0'? 8'? @'? H'? P'? X'? `'? h'? p'? x'? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? ('? 0'? 8'? @'? H'? P'? X'? `'? h'? p'? x'? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? ('? 0'? 8'? @'? H'? P'? X'? `'? h'? p'? x'? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? ('? 0'? 8'? @'? H'? P'? X'? `'? h'? p'? x'? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '?('?0'?8'?@'?H'?P'?X'?`'?h'?p'?x'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'? '? '? '? '? '? ('? 0'? 8'? @'? H'? P'? X'? `'? h'? p'? x'? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '? '?!'?!'?!'?!'?! '?!('?!0'?!8'?!@'?!H'?!P'?!X'?!`'?!h'?!p'?!x'?!'?!'?!'?!'?!'?#?#?%P?,X ?,h ?,p ?,x ?, ?- ?- ?.`?.h?.p?.x?.?.?.?.?.?1 (?12?12?12?12?12?12?12?12?12?12?12?22?22?22?22?2 2?2(2?202?282?2@2?2H2?2P2?2X2?2`2?3 ?7?9x?9?9?9?9?9?9?9?9?:?:?:?:?: ?:0?:8?:@?:H?:P?:X?:`?:h?:p?:x?:?:?:?:?:?;8?;?;?<(??>?>?> ?>(?>0?>8?>@?>H?>P?>X?>`?>h?>p?>x?>?>?>?>?>?>?>?>?>?>?>?>?>?>?>?>?????????? ??(??0??8??@??H??P??X??`??h??p??x?????????????????????????????????@?@?@?@?@ ?@(?@0?@8?@@?@H?@P?@X?@`?@h?@p?@x?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?A?A?A?A?A ?A(?A0?A8?A@?AH?AP?AX?A`?Ah?Ap?Ax?A?A?A?A?A?A?A?B?B ?B8?BH?B`?Bp?B?B?B?B?B?B?C?C?C(?C8?CP?C`?Cx?C?C?C?C?C?C?D?D?D(?D@?DP?Dh?Dx?D?D?D?D?D?D?E?E?E0?E@?EX?Eh?E?E?E?E?E?E?E?F?F ?F0?FH?FX?Fp?F?F?F?F?F?F?F?G?G ?G8?GH?G`?Gp?G?G?G?G?G?G?H?H?H(?H8?HP?H`?Hx?H?H?H?H?H?H?I?I?I(?I@?IP?Ih?Ix?I?I?I?I?I?I?J?J?J0?J@?JX?Jh?J?J?J?J?J?J?J?K?K ?K0?KH?KX?Kp?K?K?K?K?K?K?K?L?L ?L8?LH?L`?Lp?L?L?L?L?L?L?M?M?M(?M8?MP?M`?Mx?M?M?M?M?M?M?N?N?N(?N@?NP?Nh?Nx?N?N?N?N?N?N?O?O?O0?O@?OX?Oh?O?O?O?O?O?O?O?P?P ?P0?PH?PX?Pp?P?P?P?P?P?P?P?Q?Q ?Q8?QH?Q`?Qp?Q?Q?Q?Q?Q?Q?R?R?R(?R8?RP?R`?Rx?R?R?R?R?R?R?S?S?S(?S@?SP?Sh?Sx?S?S?S?S?S?S?T?T?T0?T@?TX?Th?T?T?T?T?T?T?T?U?U ?U0?UH?UX?Up?U?U?U?U?U?U?U?V?V ?V8?VH?V`?Vp?V?V?V?V?V?V?W?W?W(?W8?WP?W`?Wx?W?W?W?W?W?W?X?X?X(?X@?XP?Xh?Xx?X?X?X?X?X?X?Y?Y?Y0?Y@?YX?Yh?Y?Y?Y?Y?Y?Y?Y?Z?Z ?Z0?ZH?ZX?Zp?Z?Z?Z?Z?Z?Z?Z?[?[ ?[8?[H?[`?[p?[?[?[?[?[?[?\?\?\(?\8?\P?\`?\x?\?\?\?\?\?\?]?]?](?]@?]P?]h?]x?]?]?]?]?]?]?^?^?^0?^@?^X?^h?^?^?^?^?^?^?^?_?_ ?_0?_H?_X?_p?_?_?_?_?_?_?_?`?` ?`8?`H?``?`p?`?`?`?`?`?`?a?a?a(?a8?aP?a`?ax?a?a?a?a?a?a?b?b?b(?b@?bP?bh?bx?b?b?b?b?b?b?c?c?c0?c@?cX?ch?c?c?c?c?c?c?c?d?d ?d0?dH?dX?dp?d?d?d?d?d?d?d?e?e ?e8?eH?e`?ep?e?e?e?e?e?e?f?f?f(?f8?fP?f`?fx?f?f?f?f?f?f?g?g?g(?g@?gP?gh?gx?g?g?g?g?g?g?h?h?h0?h@?hX?hh?h?h?h?h?h?h?h?i?i ?i0?iH?iX?ip?i?i?i?i?i?i?i?j?j ?j8?jH?j`?jp?j?j?j?j?j?j?k?k?k(?k8?kP?k`?kx?k?k?k?k?k?k?l?l?l(?l@?lP?lh?lx?l?l?l?l?l?l?m?m?m0?m@?mX?mh?m?m?m?m?m?m?m?n?n ?n0?nH?nX?np?n?n?n?n?n?n?n?o?o ?o8?oH?o`?op?o?o?o?o?o?o?p?p?p(?p8?pP?p`?px?p?p?p?p?p?p?q?q?q(?q@?qP?qh?qx?q?q?q?q?q?q?r?r?r0?r@?rX?rh?r?r?r?r?r?r?r?s?s ?s0?sH?sX?sp?s?s?s?s?s?s?s?t?t ?t8?tH?t`?tp?t?t?t?t?t?t?u?u?u(?u8?uP?u`?ux?u?u?u?u?u?u?v?v?v(?v@?vP?vh?vx?v?v?v?v?v?v?w?w?w0?w@?wX?wh?w?w?w?w?w?w?w?x?x ?x0?xH?xX?xp?x?x?x?x?x?x?x?y?y ?y8?yH?y`?yp?y?y?y?y?y?y?z?z?z(?z8?zP?z`?zx?z?z?z?z?z?z?{?{?{(?{@?{P?{h?{x?{?{?{?{?{?{?|?|?|0?|@?|X?|h?|?|?|?|?|?|?|?}?} ?}0?}H?}X?}p?}?}?}?}?}?}?}?~?~ ?~8?~H?~`?~p?~?~?~?~?~?~???(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h?€??¨?¸????? ?0?H?X?p?À?Ø?è?????? ?8?H?`?p?Ĉ?Ę?İ??????(?8?P?`?x?ň?Š?Ű??????(?@?P?h?x?Ɛ?Ơ?Ƹ??????0?@?X?h?ǀ?ǐ?Ǩ?Ǹ????? ?0?H?X?p?Ȁ?Ș?Ȩ?????? ?8?H?`?p?Ɉ?ɘ?ɰ??????(?8?P?`?x?ʈ?ʠ?ʰ??????(?@?P?h?x?ː?ˠ?˸??????0?@?X?h?̀?̐?̨?̸????? ?0?H?X?p?̀?͘?ͨ?????? ?8?H?`?p?Έ?Θ?ΰ??????(?8?P?`?x?ψ?Ϡ?ϰ??????(?@?P?h?x?А?Р?и??????0?@?X?h?р?ѐ?Ѩ?Ѹ????? ?0?H?X?p?Ҁ?Ҙ?Ҩ?????? ?8?H?`?p?ӈ?Ә?Ӱ??????(?8?P?`?x?Ԉ?Ԡ?԰??????(?@?P?h?x?Ր?ՠ?ո??????0?@?X?h?ր?֐?֨?ָ????? ?0?H?X?p?׀?ט?ר?????? ?8?H?`?p?؈?ؘ?ذ??????(?8?P?`?x?و?٠?ٰ??????(?@?P?h?x?ڐ?ڠ?ڸ??????0?@?X?h?ۀ?ې?ۨ?۸????? ?0?H?X?p?܀?ܘ?ܨ?????? ?8?H?`?p?݈?ݘ?ݰ??????(?8?P?`?x?ވ?ޠ?ް??????(?@?P?h?x?ߐ?ߠ?߸??????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h???????? ? ? 0? H? X? p? ? ? ? ? ? ? ? ? ? 8? H? `? p? ? ? ? ? ? ? ? ? (? 8? P? `? x? ? ? ? ? ? ? ? ? (? @? P? h? x? ? ? ? ? ? ? ? ? 0? @? X? h? ? ? ? ? ? ? ?? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x??????? ? ? (? @? P? h? x? ? ? ? ? ? ?!?!?!0?!@?!X?!h?!?!?!?!?!?!?!?"?" ?"0?"H?"X?"p?"?"?"?"?"?"?"?#?# ?#8?#H?#`?#p?#?#?#?#?#?#?$?$?$(?$8?$P?$`?$x?$?$?$?$?$?$?%?%?%(?%@?%P?%h?%x?%?%?%?%?%?%?&?&?&0?&@?&X?&h?&?&?&?&?&?&?&?'?' ?'0?'H?'X?'p?'?'?'?'?'?'?'?(?( ?(8?(H?(`?(p?(?(?(?(?(?(?)?)?)(?)8?)P?)`?)x?)?)?)?)?)?)?*?*?*(?*@?*P?*h?*x?*?*?*?*?*?*?+?+?+0?+@?+X?+h?+?+?+?+?+?+?+?,?, ?,0?,H?,X?,p?,?,?,?,?,?,?,?-?- ?-8?-H?-`?-p?-?-?-?-?-?-?.?.?.(?.8?.P?.`?.x?.?.?.?.?.?.?/?/?/(?/@?/P?/h?/x?/?/?/?/?/?/?0?0?00?0@?0X?0h?0?0?0?0?0?0?0?1?1 ?10?1H?1X?1p?1?1?1?1?1?1?1?2?2 ?28?2H?2`?2p?2?2?2?2?2?2?3?3?3(?38?3P?3`?3x?3?3?3?3?3?3?4?4?4(?4@?4P?4h?4x?4?4?4?4?4?4?5?5?50?5@?5X?5h?5?5?5?5?5?5?5?6?6 ?60?6H?6X?6p?6?6?6?6?6?6?6?7?7 ?78?7H?7`?7p?7?7?7?7?7?7?8?8?8(?88?8P?8`?8x?8?8?8?8?8?8?9?9?9(?9@?9P?9h?9x?9?9?9?9?9?9?:?:?:0?:@?:X?:h?:?:?:?:?:?:?:?;?; ?;0?;H?;X?;p?;?;?;?;?;?;?;?<?< ?<8??>?>(?>@?>P?>h?>x?>?>?>?>?>?>??????0??@??X??h???????????????@?@ ?@0?@H?@X?@p?@?@?@?@?@?@?@?A?A ?A8?AH?A`?Ap?A?A?A?A?A?A?B?B?B(?B8?BP?B`?Bx?B?B?B?B?B?B?C?C?C(?C@?CP?Ch?Cx?C?C?C?C?C?C?D?D?D0?D@?DX?Dh?D?D?D?D?D?D?D?E?E ?E0?EH?EX?Ep?E?E?E?E?E?E?E?F?F ?F8?FH?F`?Fp?F?F?F?F?F?F?G?G?G(?G8?GP?G`?Gx?G?G?G?G?G?G?H?H?H(?H@?HP?Hh?Hx?H?H?H?H?H?H?I?I?I0?I@?IX?Ih?I?I?I?I?I?I?I?J?J ?J0?JH?JX?Jp?J?J?J?J?J?J?J?K?K ?K8?KH?K`?Kp?K?K?K?K?K?K?L?L?L(?L8?LP?L`?Lx?L?L?L?L?L?L?M?M?M(?M@?MP?Mh?Mx?M?M?M?M?M?M?N?N?N0?N@?NX?Nh?N?N?N?N?N?N?N?O?O ?O0?OH?OX?Op?O?O?O?O?O?O?O?P?P ?P8?PH?P`?Pp?P?P?P?P?P?P?Q?Q?Q(?Q8?QP?Q`?Qx?Q?Q?Q?Q?Q?Q?R?R?R(?R@?RP?Rh?Rx?R?R?R?R?R?R?S?S?S0?S@?SX?Sh?S?S?S?S?S?S?S?T?T ?T0?TH?TX?Tp?T?T?T?T?T?T?T?U?U ?U8?UH?U`?Up?U?U?U?U?U?U?V?V?V(?V8?VP?V`?Vx?V?V?V?V?V?V?W?W?W(?W@?WP?Wh?Wx?W?W?W?W?W?W?X?X?X0?X@?XX?Xh?X?X?X?X?X?X?X?Y?Y ?Y0?YH?YX?Yp?Y?Y?Y?Y?Y?Y?Y?Z?Z ?Z8?ZH?Z`?Zp?Z?Z?Z?Z?Z?Z?[?[?[(?[8?[P?[`?[x?[?[?[?[?[?[?\?\?\(?\@?\P?\h?\x?\?\?\?\?\?\?]?]?]0?]@?]X?]h?]?]?]?]?]?]?]?^?^ ?^0?^H?^X?^p?^?^?^?^?^?^?^?_?_ ?_8?_H?_`?_p?_?_?_?_?_?_?`?`?`(?`8?`P?``?`x?`?`?`?`?`?`?a?a?a(?a@?aP?ah?ax?a?a?a?a?a?a?b?b?b0?b@?bX?bh?b?b?b?b?b?b?b?c?c ?c0?cH?cX?cp?c?c?c?c?c?c?c?d?d ?d8?dH?d`?dp?d?d?d?d?d?d?e?e?e(?e8?eP?e`?ex?e?e?e?e?e?e?f?f?f(?f@?fP?fh?fx?f?f?f?f?f?f?g?g?g0?g@?gX?gh?g?g?g?g?g?g?g?h?h ?h0?hH?hX?hp?h?h?h?h?h?h?h?i?i ?i8?iH?i`?ip?i?i?i?i?i?i?j?j?j(?j8?jP?j`?jx?j?j?j?j?j?j?k?k?k(?k@?kP?kh?kx?k?k?k?k?k?k?l?l?l0?l@?lX?lh?l?l?l?l?l?l?l?m?m ?m0?mH?mX?mp?m?m?m?m?m?m?m?n?n ?n8?nH?n`?np?n?n?n?n?n?n?o?o?o(?o8?oP?o`?ox?o?o?o?o?o?o?p?p?p(?p@?pP?ph?px?p?p?p?p?p?p?q?q?q0?q@?qX?qh?q?q?q?q?q?q?q?r?r ?r0?rH?rX?rp?r?r?r?r?r?r?r?s?s ?s8?sH?s`?sp?s?s?s?s?s?s?t?t?t(?t8?tP?t`?tx?t?t?t?t?t?t?u?u?u(?u@?uP?uh?ux?u?u?u?u?u?u?v?v?v0?v@?vX?vh?v?v?v?v?v?v?v?w?w ?w0?wH?wX?wp?w?w?w?w?w?w?w?x?x ?x8?xH?x`?xp?x?x?x?x?x?x?y?y?y(?y8?yP?y`?yx?y?y?y?y?y?y?z?z?z(?z@?zP?zh?zx?z?z?z?z?z?z?{?{?{0?{@?{X?{h?{?{?{?{?{?{?{?|?| ?|0?|H?|X?|p?|?|?|?|?|?|?|?}?} ?}8?}H?}`?}p?}?}?}?}?}?}?~?~?~(?~8?~P?~`?~x?~?~?~?~?~?~???(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p?€?˜?¨?????? ?8?H?`?p?È?Ø?ð??????(?8?P?`?x?Ĉ?Ġ?İ??????(?@?P?h?x?Ő?Š?Ÿ??????0?@?X?h?ƀ?Ɛ?ƨ?Ƹ????? ?0?H?X?p?ǀ?ǘ?Ǩ?????? ?8?H?`?p?Ȉ?Ș?Ȱ??????(?8?P?`?x?Ɉ?ɠ?ɰ??????(?@?P?h?x?ʐ?ʠ?ʸ??????0?@?X?h?ˀ?ː?˨?˸????? ?0?H?X?p?̀?̘?̨?????? ?8?H?`?p?͈?͘?Ͱ??????(?8?P?`?x?Έ?Π?ΰ??????(?@?P?h?x?ϐ?Ϡ?ϸ??????0?@?X?h?Ѐ?А?Ш?и????? ?0?H?X?p?р?ј?Ѩ?????? ?8?H?`?p?҈?Ҙ?Ұ??????(?8?P?`?x?ӈ?Ӡ?Ӱ??????(?@?P?h?x?Ԑ?Ԡ?Ը??????0?@?X?h?Հ?Ր?ը?ո????? ?0?H?X?p?ր?֘?֨?????? ?8?H?`?p?׈?ט?װ??????(?8?P?`?x?؈?ؠ?ذ??????(?@?P?h?x?ِ?٠?ٸ??????0?@?X?h?ڀ?ڐ?ڨ?ڸ????? ?0?H?X?p?ۀ?ۘ?ۨ?????? ?8?H?`?p?܈?ܘ?ܰ??????(?8?P?`?x?݈?ݠ?ݰ??????(?@?P?h?x?ސ?ޠ?޸??????0?@?X?h?߀?ߐ?ߨ?߸????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p???????? ? ? 8? H? `? p? ? ? ? ? ? ? ? ? (? 8? P? `? x? ? ? ? ? ? ? ? ? (? @? P? h? x? ? ? ? ? ? ? ? ? 0? @? X? h? ? ? ? ? ? ? ? ? ? 0? H? X? p? ? ? ? ? ? ? ?? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x??????? ? ? 0? @? X? h? ? ? ? ? ? ? ?!?! ?!0?!H?!X?!p?!?!?!?!?!?!?!?"?" ?"8?"H?"`?"p?"?"?"?"?"?"?#?#?#(?#8?#P?#`?#x?#?#?#?#?#?#?$?$?$(?$@?$P?$h?$x?$?$?$?$?$?$?%?%?%0?%@?%X?%h?%?%?%?%?%?%?%?&?& ?&0?&H?&X?&p?&?&?&?&?&?&?&?'?' ?'8?'H?'`?'p?'?'?'?'?'?'?(?(?((?(8?(P?(`?(x?(?(?(?(?(?(?)?)?)(?)@?)P?)h?)x?)?)?)?)?)?)?*?*?*0?*@?*X?*h?*?*?*?*?*?*?*?+?+ ?+0?+H?+X?+p?+?+?+?+?+?+?+?,?, ?,8?,H?,`?,p?,?,?,?,?,?,?-?-?-(?-8?-P?-`?-x?-?-?-?-?-?-?.?.?.(?.@?.P?.h?.x?.?.?/?6h(?6p(?6x(?6(?6(?6(?6(?6(?6(?6(?6(?6(?6(?6(?6(?6(?6(?6(?6(?7(?7(?7(?7(?7 (?7((?70(?78(?7@(?7H(?7P(?7X(?7`(?7h(?7p(?7x(?7(?7(?7(?7(?7(?7(?7(?7(?7(?7(?7(?7(?7(?7(?7(?7(?8(?8(?8(?8(?8 (?8((?80(?88(?8@(?8H(?8P(?8X(?8`(?8h(?8p(?8x(?8(?8(?8(?8(?8(?8(?8(?8P?;?;d?;?;d?;?<d?<?<d?<(?<0d?<@? ?>d?> ?>(d?>8 ?>@d?>P ?>Xd?>h ?>pd?> ?>d?> D?>d?> h?>d?>0?>d?>,?>d?>.??d??2??d??(??0d??@J??Hd??XF??`d????N????b??`??????F?????@^?@?@H?@^?@ Z?@(\?@0\?@8J?@@N?@HX?@P?@XL?@`?@h?@p"?@x6?@4?@?@P?@?@?@?@g?@;?@)?@V?@?@?@?@?@?@?A?A`?Az?A|?A v?A(?A0?A8?A@X?AH?AP~?AXr?A`T?AhR?Ap?Ax?A?A?A ?A?A ?A ?A ?A ?A7?A?Ad?Ab?A8?AD?A9?A;?B?B&?B?B ?B &?B(?B02?B8?B@?BH?BP?BX?B`.?Bh?Bp?Bx?B?B?B?B?B?Bt?B?B?B8?Bf?B?B$?B?B?B?B?C?C?C?C?C ?C( S?C0 3?C8 7?C@ ;?CH ??CP C?CX G?C` K?Ch O?Cp -?Cx +?Cj?C?C /?C U?C W?C Y?C [?C ]?C _?C a?C c?C e?C g?C?C?C?D ?D ?D?D?D i?D( k?D0 m?D8 o?D@ q?DH s?DP u?DX w?D` y?Dh {?Dp }?Dx ?D ?D ?D ?D ?D ?D ?D ?D ?D ?D ?D ?D ?D ?D ?D ?D ?E ?E ?E ?E ?E ?E( ?E0 ?E8 ?E@ ?EH ?EP ?EX ?E` ?Eh ?Ep ?Ex ?E ?E ?E ?E ?E ?E ?E ?E ?E ?E ?E ?E ?E ?E ?E ?E ?F ?F ?F ?F ?F ?F( ?F0 ?F8 ?F@ ?FH?FP?FX?F`?Fh?Fp?Fx ]?F _?F b?F d?F?F?F f?F ?F?F?F?F?Fl?F:?F,?F?F?G?G.?GT?GR?G V?G(?G0?G8?G@?GH?GP?GXB?G`D?Gh?Gp?Gx?GL?G?G ?G?G?Gx?G?G?G :?G 4?G?G ?G ?G 8?G 6?G 2?H?H?H ?H?H ?H( ?H0 ?H8 ?H@ ?HH ?HP ?HX?H`?Hh?Hp ?Hx ?H ?H?H ?HZ?H?H ?H ?H ?H ?H ?H ?H?HB?H?H?H ?I?I?I?I?I ?I(?I0 ?I8 ?I@?IH ,?IP (?IX *?I`?Ih?Ip?IxP?I?I?Ip?IU?Ie?I$?I .?I 0?I 2?I 6?I?I 8?I :?I ?I ?I ?KH?KP.?KX\?K` C H N W ^ d j q w ~          )3>C N U \ d i p                        # * 2 = E J R X _ f r y                     " * 1 C J R \ e p w }                        ) 2 ; D M V [ e m t z                  , : @ R fs|        ?pk?|k?k?k?k? k? k?@k? k?)k@k@Ak@Rk@k@ k@(k@0k@8fk@@Ck@Hk@P k@X>k@`Ik@h k@pk@xk@k@Ik@Nk@ k@k@k@Ik@Ik@Ik@dk@ k@Ik@#k@Rk@Jk@ZkAIkAkAkAkA kA( kA0ikA8~kA@ikAHkAPkAXkA`\kAhUkApIkAx kAkArkAkAkAkAkA kAIkAIkAkAkAkAkA:kA kAkBCkB~kBNkB%kB kB(kB0kB8kB@kBHkBP^kBXkB`kBhkBpkBx"kBkBRkBkBkBkBkBmkBtkBkBkBWkBkBkBkBCkBkCkCkC}kCkC HkC(kC0kC8kC@kCHkCPkCX kC`)kCh2kCp kCxIkCkCekCkC;kCJkCXkCfkCtkCkCkCkCkCkCMkCkC kD)kD2kD;kDDkD kD(kD0kD8kD@kDH+kDPFkDX[kD`rkDhkDpkDxkDkDkDkDkD kD kD 6kD NkD dkD vkD ~kD kD kD kD kD kE kE kE kE kE +kE( :kE0 MkE8 ]kE@ lkEH kEP kEX kE` kEh kEp kEx kE kE &kE >kE QkE YkE pkE kE kE kE kE kE kE kE kE kE kF #kF 5kF EkF [kF pkF( kF0 kF8 kF@ kFHVkFPkFX*kF`[kFhkFpkFxIkF kFkF kFkFwkF kFkF kF kFIkF=kFkFkFkFIkFkGkGkGkGkG kG( kG0kG8kG@kGHkGPkGXIkG` kGhIkGpkGx kGskGIkG kGIkG kGkGEkG !kG ,kG :kGIkG kGkG DkG SkGIkHkHIkH kHkH IkH(kH0 ZkH8 ekH@ skHH ~kHP kHXkH`kHh*kHp kHx kH kH kH kHpkH1kH kHIkH kH kH kHIkH kHIkHkH>kH+kIIkIkIIkI1kI kI(kI0IkI8 kI@JkIHkIPIkIX kI`IkIhXkIp2kIxkI_kIzkIkI kIIkIwkIkI$kI<kIRkIdkI]kIjkI kIIkIkJIkJjkJqkJkJ  kJ(kJ0kJ8IkJ@kJHIkJP8kJXkJ`IkJhIkJpkJxkJIkJkJkJkJkJkJkJ,kJkJekJ\kJkJIkJkJkJkKkKkKkKkK kK(kK0IkK8kK@kKH/kKPIkKXIkK`IkKh>kKpOkKx`kKpkKIkK kKIkKkK kKkKkKkKIkKkKkKkKkKkK kLIkL kLkLIkL kL(kL0 kL8kL@kLHIkLPkLXkL`kLhkLpfkLxIkL kLkLkLkL kL kL#kL0kLIkLWkLmkLIkLkLkLkLkMkMkMkM kM IkM(IkM0IkM8IkM@IkMHkMPkMXykM` kMhpkMpJkMxkMIkg gk;  kh?x? ???p!;gA@Ik`)@  k H ke; ?? ?"?4%; gN@Ik)@     t k# k  k<@k <($k  gA)4444N;gsapversion.cJIk9 nJ C ZIk;X k]?X $;grslgcoll.c"<Ik}9 nR kS `[ S j kS x kS ` S  kS kS kS kS kS kS@ kS`  kS5 kS@C kSZ kS@k kS  kS  kS kS ` kS  kS!  kS!  kS!$ kS"`L kS"i kS#  kS# kS$@ kS$ kS% kS%` kS% kS&@) kS&@ kS'Q kS( f kS*w kS*` kS* kS+@ kS+ kS, kS,@ kS, kS- 8 kS.T kS.h kS/@ kS/ kS0 kS0 kS0 kS1 kS7   kS:" kS;@0 kS<G kS>N S>`` kS>q S?@w Sb@ kSb kSc` kSf kSg  kSk  kSl kSn kSq@ kSr kSr kSs@ kSt`" kS{3 kS`A kS T kS`e kS~ kS kS kS kSOIkC^ x ktkM< X< `X77  7/ > ` p/3,98/C;grslgsmcc.c̀Ik 9\ ǹ  )΀ ) & )5 )РD 7) 5IkX/ k> > > ? S;grslgpr3.c\v<Ik9 n< kH= H L Ik ^9 kSa;grslgpr4.c7Ik9 n7 X B`Ik :P kSq;grslgwai1.cIk9 n kf f <Ik2 kT;grslgwr1.c9Ik 9  nN kv b kv` v kv@ v v v v  v` v v v' v8 v Ik #` k4@6H6P6X6`;grslgwri2.cPjIk9 n  Ik6 kT;grslgwrcf.cPdIk9 nd  7hIk45 kT;grslgwren.cPÀIk9 nÀ ƀ  Ik" k\%k;grslgwrup.cIk9< n k  '  <  :Ik7( kT;grslgwra.cT3Ik9 n3i  BXIk9@ k[;grslgwai2.cIk9 n   <8Ik2 kT?( ;grslggfn.cT9<O;grslgtime.c)Ik9 n)  *pIk3 kT2;grslgtsub.c*Ik 9 n@ k!F k!@L k!`S !] ! :Ik8 kT@;grslgtdha.chIk9  n~ 7 ;Ik(8 kTL;grslgtch.c6Ik94 n6 E9 kS`;grslgtdad.cIk9H n kQ` kQ kQ Q ;Ik88 kTl;grslgtdec.cIk9 n  e7 kTx;grslgtinc.c Ik9 n 1 q7 kT;grslgmoni.c @ ZIk9 n p }  }  k}6h kT;grstrascs.c  %X kl%P !;grstrcc.c  bIk9 nb  d   Ik+ kR;grstrtime.c!!iIk9  ni!2 j!> m@!K t!Y t!d t!s u! v! v!  Ikj. k  n;grstrbfn.c!!UIk9  nU! W@! b!  6xIk4 kS ;grstrbfp.c!!.Ik'9  n." 1" 4 "0 5"Q 6 "j 6" :" =@" ?`" @" B" E@" F# H`# H# I#4 K #A K#U L #l L#v L# M # M`# M# M# Q# Q# kR$ kS@$2 kS$F kT@$X k *xIk 4H k[`k\F;grstrio.c!$kIk9  n$ %$ %@$ %$ % $ % `$ % $ % $ % $ % $ % $ % $ %`%  % Ik /H kRp;grstrw1.c%%2Ik9  n%F kK@%U kKؠ kK%e kK٠%{ kK% kK% K % kK% K@% K% K% K :Ik/ k k 11;grstrw2.c%%Ik9 t n&  u& u <Ik(1 kR/@  ;grstrwcal.c&*&DIkR9  n&Z @&d &n @& & & & & !& "& +@& /' /'  5' 8'" 9'+ 9@'? 9'T 9'i :' :@' :' :' ;' ;@' k@@' k@' A`( B (% B(= C`(Z C(y C( D ( D( D( E) E`)/ E)P F)Z J)e Q`)p Q)z Q) R@) R) R) S) S@) U) kX@) X* Y*& Z *9 Z*Q [`*e \*~ \* ]@* k]* ka * k Ik,( k%(ke <;gtrdumext.c*+eIk9l ne+$  e+,  e+:  f +H  f`+U  f+c  f+q  g +  g`+  g+  g+  h +  h`+  h+  h+  i +   IkD, k\ S, D% ,  ;gpfclock.c+,Ik9p n,#  A,-  A ,;  A,J  A@,X  A,f  A,w  A,  A@,  A,  A ,  A,  A,  A, k A`-  A-  A-( k A@-7 k A`-K  A-U k A -c  A-m  A-  A-  A@-  A-  A`-  A-  A-  A-  A`.   A.  A.'  A.0  A`.>  A .K  A€.`  A `IkT. k>  X >  /8  ;gsapdir.c.w.HIk9 nH.   YIk: kQ ;gsapgcpui.c..:Ik9 n:.  :.  <.  Ik k[ ;gsapgterm.c..Ik9  n/   :xIkT5 kP h;gsapparam.c/"/<?Ik~9  n?/R k @`/[ k A@/o k B/ k B/ k C@/ k C/ k C/ k J`/ k K/ k L/ k S/  T0 k U0  k Y0  Y@0' k \ 0: k \0E k ]0R k ^@0[ k _@0j k a0| k c0 k d0 k s`0 k s0 k v@0 k v0 k w 0 k x`1 k y1 k |1( k |1A k  1M  1X k 1e k 1r k 1  1  1  1  `1   1   1  @1 k @1  2   2  @2'  20  @2;  2F  @2Z  @2n  2{  2  @2  2  2  @2   2  3  3-  `3C  3Z   3o k 3 k 3 k 3 k  3 k Ik k nkd>h k > k ;gsapstr.c34ɀIk9 nɀ4  m`4  m 4'  m41  m@4:  m 4D  mР4O  m`4X  mӠ4b  m 4k  m4t  m@4~  mՠ4  m4  m`4  m4  mؠ4  mڀ4  m4  m@4  m`4  mހ4  m߀4  m4 k m! kN ;gsaptet.c5 5%Ik9 n59  / kQ ;gsaptid.c5 5XIk90 n5l  2  kY ;gtsstinit.c5|5fIk9D nf5  i5 k i`5  i5  j 5 k  7Ikb5 kP5T ;gtsstst.c5|5"p  ;gsapcscsa.c56Ik 9 n6(  % 69  %6K k  'hIk2 kc ;gsapdaem.c56cCIk9 nC6x  C@6  F6  G6  G@6 2   ZIkx; kR ;gsapsbgp.c66ŀIk9  nŀ7 F   hIk00 kR >;gsapscsa.c67#Ik 94 n78  7I   7Z  `7l  7~ k `7 k  Ik:0 kb022$2<+ :2R2]2j3X L;gsaptep.c67ÀIk9 nÀ7  C7 k C/ kQ ;gcontloct.c88xIk/9 nx84  Qx8D k Qy8S k Q|8g k Q|@8~  Q}`8 k Q~8 k Q8  Q8  Q`8  Q8  Q9 k Q9 k Q`9"  Q90  Q 9< k Q9C  Q9W k Q`9j  Q9|  Q@9  Q9  Q9  Q@9  Q9  Q9  Q:  Q@:  Q:6  Q:M  Q:h k Q: k Q PIk -8 kkt- Z- e- sH H ~P X .  ;gnlsui0.c::FIk 9 nF: k G : k G: k H`;  k I; k I;. k J@;@ k J;R k K;d k L ;v k O; k Q ; k S ; k T; k X; k Z`; k \`; k ^<  _ < kZ a`<0 k b<> k v  k '`>  (>+ k ) >5 k .>E k /@>V k <>h k K>| k L>  L>  M>  N@>  N> k Ik0 k:k )<:k <:k =:k =; k =0;k =H;/k  =`;Ak  )=x;Sk (2<;ek p;=Jk =Xk =fk =tk =k >k > k >8k >Pk x+F[r   6 N d v$ ~( 0 8 @ H P X ` h p +x : M ] l         & > Q Y p     ( 0 8 < @ H #P 5X E` [h pp x   =;gnlsui1.c>>Ikv9" n>  ?  ?   ?(  `?2  ?>  ?P  ?Z  @?f  À?t  `?  ŀ?  ?   ?  `?  ʀ?  ?   ?  @?  @?  ̀?  ΀@  @  Р@  @0  @@8   @B  `@K   @V  @@^  @h   @p  @z   @  @  @  @  @   @  @  `@  ٠@  @@  ڀ@  @@  ۀA  @A  ܀A  @A%  `A-   A7  `AB  AN  A\  Ae  Ap  Az  A  @A  A  A  A  @A  A  A  @A  A  @B   B  B"  B/  B:  BG  BX  @Bn  B  B  `B kx B  @B  B  @B  `B  B   C  C  `C  C%  `C.  C6  C@  CI  CT  @C]  Ch k @C~ k C  @C  C   C   C   C   C   C   @C   C   D    D  D"   D+  D6  D>  DH  DQ  D\  Dd  Dn  Dv  D k @D  D  D  D  @D  D  E  E  E"  @E2  @ED  EK  @ET  Ea  Eo  E|  @E   E   `E   E  !E k "E k #`E k $`F  k %@F# k &F; k '@FR k (Fl k )F k *F k +F k ,F k - F k .G  k 0G$ k 0G@ k 2G\ k 3Gq k Ik k~Mk;<k;gnlsui2.cGGkIk9,X nkG BkG BnG BoG BqG Br G BrH kBv H Bv`H* Bw H< Bw`HI BwHX Bx Hh B{Hz B|H B H B 8Ikp5X kNk@;gnlsui3.cGHhIk 9-\ nhH pjH pj@H pm@H pmH pnH pqH pqI prI prI psI* psI6 p`Ik/ kNk+8$ ;gnlsui5.cIDI^6Ik 9.  n6Ir 6I} 7`I 7I 8@I 8I 9I 9I :I :I ;I < I <`J =`J =J >J. >J> k?JV k@@Jm kA J k kN;gnlsui6.cJJɀIk9/d nɀJ J @J J  J ΠJ  K `K K `K' ҀK/ K9 KB `KM ؠKV Ka k Ik0P kN ;grscpsc2.cKsKIk90h nK k`K K  K K K @L  L 30 k#;grscpu84r.cL$L> @ A  A0  AX =xI =p0 A AP =l#B;grscpu86r.cLTLnIk990 nL (L ( L ( L (L ( L (L ( `M (+@M ( =Ik6H k1 nT;grscpuerr.cM6MP2Ik924 n2Mf kG2@Mz G8 ke?@mk 8W;gu16_aux.cMM Ik92X n M Y M kYM YM YN YN Y`N* YNK Y`N\ YNr YN YN Y`N Y@N Y N YN YN Y N Y O  Y O" Y! O: kY#OZ kY%Ox kY%O kY(@O kY@Ik k8X nk;gu16_put.cSjSIk 99l nS L@S LS LS L S LS L S L@S L`S LT L@T LT LIk k;gu16_get.cSjT*TIk9:0 nTT? pT`TQ pX@Ti pX`Tq pZT{ pZT p]@T p]`T p_T p_T p`T p` T p``T kpb@T kpdT kp]Ik! k ~i ;gu16_tol.cTUvIk9;$ nvU+ vU? zUJ {US ~U_ ~Ui Uu  U U  Ik! k;gu16_prnt.cUUIk9; nU  U U  U U V  @V V   V- V9  VG @ k;gu16_scan.cVTVnIk9 nl;gu16_InCS.cYYIk9? nY ]@Y ]Z k]@Z3 ]ZR ]1x k;gu16_InStrm.cYZqIk9?d nZ q`Z qZ q`Z qZ q[ q[" q@[@ q[^ kq %Ik1` k;gu16_LenMod.cY[Ik9? n[ @[ [ @[ k[ \  k\% @\B \^ \~ \ @\ \ \ ]  k;gu16_FrmOut.c]7]QIk9@ n]i ]~ ] ] ] k( k;gu16_OutCS.c]7]Ik9A@ n^ ^ ^6  ^V k^|  ^ k^ ^  _ `_0 _O k_l k _ k _ k _  _ k _  ` IkF k Bd n;gu16_OutFlg.c`D`^Ik9Bx n`v @` ` ` @` a a/  aM `an a a  a `a @ k?;gu16_OutStr.c`DaIk9CL nb  b!  b3  `bT  br k b k b  b  @b k c k c8  cS  pIk( kW;gu16_OutPrc.c`DcqIk9D nc D@c Dc Dc kD@c kD@c Dd kDp ki;gu16_InCon.cd0dJIk9D nda \dv \ d \ &Ik2 k;gsaprel.cddIk,9D nd n@d nd ne ne  ne ~n`e% ne8 n@eI neS n ef knew kne n@e ne ne kn e ne ne ne nf  kn@f nf- nfG nfV knfj nf n f n@f nÀf n ;@Ik9@ kh8k;gsaprel0.cffʀIk9F nʀg  `g g' @g1  5PIkf. kZ (k; g../../cdtors.Cg;gU hA;gg|gIk`)g   kU;g ?g;ggh4hNhU gh_k(h_hU g hek( hehU gHhxk(HhxhU gphk(phhU ghk(hhU ghk(hhU ghk(h hU gEhk(EhhU gEhk(Eh hU gFhk(FhhU g5@hk(5@h hU g(hk((h%hU ghk(h!*hU gd(ik(d(i&/hU gi k(i +4hU g4ik(4i09hU gF8ik(F8i5>hU g5ik(5i:ChU gDi)k(Di)?HhU gBPi1k(BPi1DMhU gi8k(i8IRhU g-i?k(-i?NWhU g-iGk(-iGS\hU giNk(iNXahU g4iVk(4iV]fhU gi_k(i_bkhU gUiek(UiegphU guilk(uilluhU gBisk(BisqzhU gi{k(i{vhU gik(i{hU g ik( ihU gik(ihU g4xik(4xihU gԀik(ԀihU g9(ik(9(ihU g9ik(9ihU g ik( ihU g.(ik(.(ihU gik(ihU g*ik(*ihU g4Pik(4PihU g4(ik(4(ihU gDik(DihU gdjk(djhU gQjk(QjhU ggjk(gjhU gkjk(kjhU gxj'k(xj'hU g/j0k(/j0hU gDj8k(Dj8hU g,8j?k(,8j?hU gjHk(jHhU g+jOk(+jOhU g,jWk(,jWhU g.j]k(.j]hU gwjdk(wjdhU g9Pjrk(9Pjr hU gBjzk(BjzhU g4jk(4j hU g)jk()jhU gRjk(RjhU gjk(j$hU ggjk(gj )hU g(jk((j%.hU gIjk(Ij*3hU g)(jk()(j/8hU gjk(j4=hU g(jk((j9BhU gjk(j>GhU g9xjk(9xjCLhU gIPjk(IPjHQhU gIjk(IjMVhU gPkk(PkR[hU gvkk(vkW`hU gRkk(Rk\ehU gkk(kajhU gk!k(k!fohU gk+k(k+kthU gIk5k(Ik5pyhU g.k=k(.k=u~hU gBxkDk(BxkDzhU gdPkMk(dPkMhU gS0kVk(S0kVhU gk^k(k^hU g,kfk(,kfhU gkok(kohU gk|k(k|hU gBkk(BkhU gBkk(BkhU gkk(khU gC@kk(C@khU gCkk(CkhU gkk(khU g(kk((khU gEHkk(EHkhU gxkk(xkhU gChkk(ChkhU gkk(khU gkk(khU gIxlk(IxlhU gSl k(Sl hU gElk(ElhU glk(lhU gI(lk(I(lhU guxl$k(uxl$hU gul-k(ul-hU gul8k(ul8hU gulBk(ulB hU gSlKk(SlKhU gB(lSk(B(lS hU gPlZk(PlZhU gրlak(րlahU g(lhk((lh#hU gClpk(Clp(hU gClyk(Cly$-hU gSXlk(SXl)2hU gE lk(E l.7hU gClk(Cl3<hU gu(lk(u(l8AhU g5lk(5l=FhU g5lk(5lBKhU gEplk(EplGPhU gQxlk(QxlLUhU gQlk(QlQZhU gQlk(QlV_hU gQlk(Ql[dhU gRlk(Rl`ihU gR@lk(R@lenhU gQPlk(QPljshU gRhmk(RhmoxhU gRm k(Rm t}hU gQ(mk(Q(myhU gD0m k(D0m ~hU gDXm(k(DXm(hU gPm/k(Pm/hU ggm7k(gm7hU gmFk(mFhU gDmUk(DmUhU g5hm]k(5hm]hU gmek(mehU gmtk(mthU gm}k(m}hU guPmk(uPmhU gmk(mhU g5mk(5mhU gPmk(PmhU g(mk((mhU gDmk(DmhU g mk( mhU gmk(mhU gmk(mhU gpmk(pmhU gHmk(HmhU g4nk(4nhU gn k(n nenvironerrnoaccesschdirchmodchowncloseexecvefsynckilllinkmkdirreadlinkrenamermdirshmatshmctlshmdtshmgetsymlinksyncumaskunameunlinksocketbindlistensetsockoptgethostname_system_configuration___memcmp64.___memcmp64___bzero64.___bzero64___memmove64.___memmove64___fill64.___fill64_iob__mod_initmalloccallocreallocfreegetenvread_real_timeexitatexitstrlenfreopen64fopen64open64lseek64fprintffclosegetuidstrtoulstrchrabortsprintfwritegetpidtimefputsgettimeofdayfflushvsnprintffdopenfwritetolowerlocaleconv_filbufreadstrncmpfputcungetcstrtod__fd_selectsignalsetpgrpgetppidsleepfreadtoupperendpwentgetpwnamgetpwuidstrdupfgetcstatvfsfstat64stat64strspnstrpbrklocaltime_rgmtime_rctime_rasctime_rlocaltimectimeasctimemktimetime_base_to_timesystemwaitpidsetlocalexdr_freexdr_stringsendtoqsortgetcwdforkdupopendirreaddir_rclosedirreaddirmktemppopenexecvalarmexecvptempnamttynamebsearchputenvtmpnamgetgrgidutimestrerrorstrftimeiswalphaiswcntrliswloweriswprintiswspaceiswupperiswalnumecvtmkstemp64dlclosedlopendlsymstrtolgetc_unlockedputc_unlockedremovemkfifogethostbynamenacceptrecvgetpasspausecreat64funlockfileflockfiledlerrorgethostentgethostbyaddrendhostentgetservbyportgetservbynamerexec__run_final_dtors__run_initial_ctors__n_pthreadssys_nerr__crt0v_DBLINFopterroptindoptopt__malloc_user_defined_name__setUncaughtExceptionFlag__3stdFb__CleanupCatchV6a__ReThrowV6__pth_init__pthreadTOCcrt0_data_$STATIC__C_runtime_termination_cdtorsu16_trace_levelu16_trace_funcno_fgetcU_errors_maxfgetcU_errors_intervalcatch_SIGUSR1zrslgdebuggingzrslgdebugdestcatch_SIGUSR2rslgcoll_stat_$STATIC_BSStoupperUisalnumUisalphaUiscntrlUislowerUisprintUisspaceUisupperUtolowerUlibicuucHandleisalnumU_7bitiscntrlU_7bitisalphaU_7bitislowerU_7bitisprintU_7bitisspaceU_7bitisupperU_7bittoupperU_7bittolowerU_7bitu_versionToString_FPTRu_errorName_FPTRu_getVersion_FPTRu_getUnicodeVersion_FPTRu_charType_FPTRu_getIntPropertyValue_FPTRu_charDirection_FPTRu_getPropertyEnum_FPTRu_getPropertyValueName_FPTRuenum_unext_FPTRuenum_count_FPTRu_strToUpper_FPTRIcuUtilubidi_open_FPTRubidi_setInverse_FPTRubidi_setPara_FPTRubidi_writeReordered_FPTRubidi_getLogicalMap_FPTRubidi_getVisualMap_FPTRubidi_getLevelAt_FPTRu_charMirror_FPTRIcuBiDiIcuShapingu_shapeArabic_FPTRunorm_normalize_FPTRunorm_isNormalized_FPTRunorm_compare_FPTRIcuNormubrk_open_FPTRubrk_openRules_FPTRubrk_safeClone_FPTRubrk_close_FPTRubrk_next_FPTRubrk_previous_FPTRubrk_first_FPTRubrk_last_FPTRubrk_following_FPTRubrk_getAvailable_FPTRubrk_countAvailable_FPTRubrk_getLocaleByType_FPTRuloc_getDefault_FPTRIcuBreakuidna_toASCII_FPTRuidna_toUnicode_FPTRuidna_IDNToASCII_FPTRuidna_IDNToUnicode_FPTRuidna_compare_FPTRIcuIDNAucal_getAvailable_FPTRucal_countAvailable_FPTRucal_open_FPTRucal_close_FPTRucal_set_FPTRucal_setDate_FPTRucal_get_FPTRucal_getMillis_FPTRucal_setMillis_FPTRIcuCollationIcuTransucol_open_FPTRucol_strcoll_FPTRucol_close_FPTRucol_setStrength_FPTRucol_getSortKey_FPTRucol_getLocaleByType_FPTRutrans_openU_FPTRutrans_close_FPTRutrans_openIDs_FPTRutrans_transUChars_FPTRCmpDsTablecmp_namesno_fgetcU_errorslast_fgetcU_erroroptargUtsststrstrswbptrtr_usr_switchsapscsPtrtr_initializedtr_admContLoctTfcltZoneMapTopcltZoneMapContLoctLowTimeContLoctHighTimeparam_valuecltZoneMapSizeclt_zone_mapmax_pfclock_valpfclock1pfclock2max_pfnanoclock_valrstrlc_link_countsapIdKnownsapscsaIdsapmrs_may_replace_scsasapsts_scsa_too_shortsapscsaPtrh_scsa_statesapesc_enforce_scsa_creationh_scsa_slgrslgshmptrpid_bufferMyTransIdFuncMyRootIdFuncMyConnIdFuncMyCcountFuncAlRslgCallbackFunctionsk__forget_senderssk__sender_scanerneed_fast_terminationzrslgcoll_exitneed_terminationzrslgdebugswitchterminate_msgp1terminate_msgp2catch_SIGTERMcatch_SIGINTterminate_reasonterminate_timecatch_SIGALRMcatch_SIGQUITrstridio_I_did_i_orstrec_entries_countrslgdcc_catch_clockterminate_msgidkMaximumUCS4rscpReplacementCharacterfirstByteMarkrscpHook_rscpe__errorrscph_rscpe__errorbytesFromUTF8kMaximumUCS2offsetsFromUTF8minValForLengthkMaximumUTF16bytesFromUTF8NoCCsk__senders_at_startcrt0_64.s.__startp_xargcp_xargvp_xrcfgp_xrc_malloc_user_defined_name.file../../../../../../../src/bos/usr/ccs/lib/libc/__threads_init.cTue Feb 12 10:03:12 2008 IBM XL C Enterprise Edition for AIX, Version 9.0.0.0 --- .__threads_init.__threads_init@AF2_1_bsd_init_routine_xti_tli_init_routine_nsl_init_routine__dce_compat_init_routine../../../../../../../src/bos/usr/ccs/lib/libc/POWER/crti.CTue Feb 12 10:03:08 2008 IBM XL C/C++ Enterprise Edition for AIX, Version 9.0.0.0.__User_sinit_begin.__C_runtime_termination.__C_runtime_startup.__4.__3__C_runtime_pstartupstrcat.s.strcatnoname.strcpystrcmp.s.strcmpstrncpy.s.strncpymoveeq.s.bcopy.ovbcopy._moveeq.memcpy.memmoveSun Sep 18 07:20:49 2022 IBM XL C for AIX, Version 11.1.0.25$tpo4900001sapversion.cfdpr.GetSAPFileVersionSun Sep 18 15:20:00 2022 $tpof8a6001rslgcoll.c.do_trc_.catch_SIGUSR1.protm_string.prot_end_line.catch_SIGUSR2.sk_learn_new_sender.sk_forget_senders.sk_init_sender_scaner.sk_step_sender_scaner.sk__write_sender_info.prep_own_entry.write_entry.sk_dump_sender_info.sk_print_all.sk_t_show_wait_reason.sk_t_show_needs.debug_INTERNET_addr.skc_focus_by_inst_id.skc_focus_by_cpu_id.skc_focus_by_INET_addr.skc_focus_on_sender_scanner.skc_sender_is_up.skc_waiting_for_something.skc_waiting_for_clock.skc_waiting_for_old_entries_or_wake_up.skc_still_needs_ask_for_old.skc_still_need_say_hello.skc_still_need_nothing_or_say_hello.skc_check_focus_by_inst_id.skc_show_wait_reason.skc_show_needs.skc_show_raw_hostname.skc_get_wait_reason.skc_get_last_send.skc_get_sender_behind.skc_get_inst_id.skc_get_listen_port.skc_get_hostent.skc_write_sender_info.skc_set_last_recive_is_now.skc_set_i_sender_state.skc_set_still_needs.skc_set_wait_reason.skc_reset_mod_since_read.skc_update_info.skc_can_decr_wait_ticks_then_do.skc_set_sender_disappeared.skc_set_wait_clock.skc_set_need_ask_for_old.skc_set_need_say_hello.skc_set_wait_old_entries.skc_set_wait_wake_up.skc_set_last_send.skc_check_and_set_last_send.skc_learn_sender.skc_set_raw_hostname.protm_number.skc_set_sender_behind.usage.i_writeprotokoll.prot_begin_line.main.nlsui_main.write_filenum.start_writes.flush_writes.ask_local_time.send_question_to_sender.acc_entry.acc_oldentry.acc_sup.acc_sdown.acc_stime.acc_all.acc_miss.dump_statistics.switch_files.store_local_entry.valid_timestamp.prot_begin_line@AF80_61.protm_string@AF81_3.prot_end_line@AF82_4.protm_number@AF83_57.i_writeprotokoll@AF84_60Sun Sep 18 15:19:59 2022 $tpo7380001rslgsmcc.c.catch_SIGINT.catch_SIGALRM.catch_SIGTERM.catch_SIGQUIT.rslgsm1_write_pid_fileSun Sep 18 07:27:05 2022 $tpo5903001rslgpr3.c.printtitle.rslgpr3Sun Sep 18 07:27:06 2022 $tpo4b52001rslgpr4.c.rslgpr4Sun Sep 18 07:27:07 2022 $tpo34da001rslgwai1.c.select.wait_on_inputSun Sep 18 07:26:58 2022 $tpo0ccf001rslgwr1.c.look_after_daemons.look_at_file_length_and_swap.rslgcscsa_create.reserve_slot_in_file.rslgascsa.rslginit.rslgnf_number_of_files.rslgnp_no_problem.rslgwrc_reset_cache.rslgwss_stop_sending.dump_to_2.rslgwr1.RslgGetPassport.RslgSetFunctionPointerSun Sep 18 07:26:59 2022 $tpo3b5f001rslgwri2.c.rslgwri2$tpo2eff001rslgwrcf.c.rslgwrcf$tpo3fa1001rslgwren.c.ModulnameFromWhatstring.rslgwrenSun Sep 18 07:27:00 2022 $tpo2e7b001rslgwrup.c.wrupdown.rslgwrup.rslgwdd_daemon_down.rslgwdp_daemon_problem$tpo2a89001rslgwra.c.rslgwra_assert_failedSun Sep 18 07:27:01 2022 $tpo2b34001rslgwai2.c.wait_for_interrupt.rslgdcc_catch_clock$tpo4ce7001rslggfn.c$tpo2df3001rslgtime.c.rslgtstampSun Sep 18 07:27:02 2022 $tpo6860001rslgtsub.c.sub9.sub5.sub23.rslgtsub.rslgtdsub$tpo2946001rslgtdha.c.rslgtdhalf$tpo2f79001rslgtch.c.rslgtch$tpo41c4001rslgtdad.c.add9.add5.add23.rslgtdaddSun Sep 18 07:27:03 2022 $tpo323a001rslgtdec.c.rslgtdecr_day$tpo37c1001rslgtinc.c.rslgtincr_daySun Sep 18 07:27:04 2022 $tpo2176001rslgmoni.c.AlRslgSupplyFunct.RslgMoniReport.RslgMoniReport@AF3_2Sun Sep 18 07:26:34 2022 $tpo4cf8001rstrascs.c$tpo3fb7001rstrcc.c.rstrcc.rstrca__auxSun Sep 18 07:26:35 2022 $tpo66f7001rstrtime.c.rstrtstamp.rstrt1print.rstrtd2print.rstrtdadd.rstrtdecr_day.rstrtdhalf.rstrtincr_day.rstrtsub.rstrtdsub$tpo4cf6001rstrbfn.c.rstrbfl_flush.rstr_prbin.rstrbs_syncSun Sep 18 07:26:36 2022 $tpo06e8001rstrbfp.c.rstrbopen.rstrboo_open_options.rstrbacb_allocate_control_block.rstrbab_allocate_buffer.rstrbfm_free_control_block_and_buffer.rstrbseek.rstrbropen.rstrbdopen.rstrbclose.rstrbread.rstrbifb_internal_fill_buffer.rstrbsnb_skip_to_next_block.rstrbwrite.rstrbtell.rstrbso_store_offset.rstrbaccess.rstrbsa_store_addr.rstrbmm_mark_modified.rstrbeof.rstrberrno.rstrbfn_fileno.rstrbbbs_best_block_size.rstrbbs_buffer_size.rstrbcs_controlblock_size.rstrbd1_dump.rstrbsc_self_check.rstrbsc_self_check@AF27_26.rstrbfn_fileno@AF28_21.rstrberrno@AF29_20.rstrbeof@AF30_19.rstrbtell@AF31_14$tpo5880001rstrio.c.rstrwriteR.rstrwriteU.rstrreadR.rstrreadU.rstrfreadR.rstrfreadU.rstrfwriteR.rstrfwriteU.rstrptc.rstrpteol.rstrpts.rstr_setlocale.rstr_sleepSun Sep 18 07:26:37 2022 $tpo848d001rstrw1.c.tracefilename.getlocalbuffer.clear_rest_of_buffer.prepare_next_buffer.end_up_buffer.rstrw1_write.i_rstrf_flush.rstr_control.rstrf_flush.rstrfn_flush_next.rstrclose$tpo47c5001rstrw2.c.rstrf2_fill_entry.rstrw2_writeSun Sep 18 07:26:38 2022 $tpo4058001rstrwcal.c.rstrcaut.rstrwaut.rstr_set_auth_delimiter_tab.rstr_set_auth_delimiter_default.rstr_get_auth_delimiter.rstrcdb.rstrw7db.rstrw8db.rstrcenq.rstrw1enq.rstrw2enq.rstrcbuf.rstrw1buf.rstrw2buf.rstrcio.rstrwso_start_open.rstrwfo_finish_open.rstrwsc_start_close.rstrwfc_finish_close.rstrwsa_start_action.rstrwfa_finish_action.rstrcitm.rstrwitm.rstrcmc.rstrwc_call.rstrwr_return.rstrwefb__enter_function_block.rstrwlfb__leave_function_block.rstrwcf__called_c_func.rstrwrf__return_from_c_func.rstrwefb_enter_function_block.rstrwlfb_leave_function_block.rstrwcf_called_c_func.rstrwrf_return_from_c_func.rstrwefb_enter_function_block_proc.rstrwlfb_leave_function_block_proc.rstrwcf_called_c_func_proc.rstrwrf_return_from_c_func_proc.rstrcrfc.rstrw1rfc.rstrw2rfc.rstrwrfc.rstr_set_ab_Where.rstr_set_ab_get_call_stack_st05.rstr_get_ab_Where.rstrw1th.rstrw2th.rstrcusr.rstrw2usrU.writeStatistic.rstrw1_rfc_server.rstrw1_rfc_server_dest.rstrw1_rfc_client.rstrw1_rfc_client_dest.rstrw1_http_server.rstrw1_http_server_dest.rstrw1_http_client.rstrw1_http_client_dest.rstrcusr@AF59_48.rstrwr_return@AF60_26.rstrwcf__called_c_func@AF61_29Sun Sep 18 07:26:40 2022 $tpo341f001trdumext.c.TrInit.TrStartTrace.TrFlushTrace.TrStopTrace.TrWriteEntry.TrInitRecord.TrRecCheckEyes.TrStrType.TrPrintRecord.TrDumpMemory.TrStrError.TrStackPush.TrStackPop.TrStackGet.TrStackPeek.TrStackDropSun Sep 18 08:22:53 2022 $tpoaa64001pfclock.c.pfclock1.init_globals.pfget5_adjust.pfinit_clock.adjust_clock.clock_null_time.pfset_adjust.pfget2_clks_per_mu10.pfget1_clks_per_mu.pfget4_clk_null_time10.pfget3_clk_null_time.pfget6_adjust10.pfclock.delay_of_gettimeofday.delay_usec.timeval_diff.PfGetSapClock.PfGetDefClockOrEnv.pfclock2.PfDebugClock.pfclock3.PfClock2Interval.PfSetClock.PfStatisticClock.PfGetStatisticClock.PfSetStatisticClock.PfRuntimeClock.PfSetRuntimeClock.PfGetRuntimeClock.PfIntervalSize.PfClock1Interval.PfTime.PfTime2.pfclock_diff.pfnanoclock.PfNanoClockInterval.PfNanoClockResolutionSun Sep 18 07:22:03 2022 $tpo221f001sapdir.c.sapdirSun Sep 18 07:22:04 2022 $tpo46cb001sapgcpui.c.saptcpuid.sapgcpuid.sapwcpuid$tpo1a6c001sapgterm.c.sapgtermnameSun Sep 18 07:22:05 2022 $tpoef7a001sapparam.c.statU16.SetSapparamVersion.SetSAPPARAMDefaults.abort_sapparam.shiftdown.CmpDsTable.Collate.GetDsSpec.sapfparam.replace_dollardollar.replace_dollarparam.sapgparam.takeacopy.store_value.ComposeDsSpec.ReadParameterLine.cmp_names.count_alloc.reserve.init_sapparam.read_static_data.replace_all_d_p.read_argv_env.read_file.replace_shares.read_DEFAULT_PFL.set_memmgn_default.set_j2ee_default.read_program_values.check_duplicate.check_consistence.check_consistence_11_21.AddDefPair.sapsystem.Arg_Present.Arg_Replace.replace_envparam.sapgfparam.sapgdefparam.sapgparam_usub.sapgaparam.sapgsparam.sapgsparam_usub.sapgnparam.real_sapgnparam_usub.sapgnparam_usub.sapgnparam_usub2.sapargrem.sapargv.sappardem.sapgetarg.sapparam_get_count.sapparam_get_param.sapsetparam.sapparam_set_bsearch.sapparam_get_cnt.sapparam_get_tupel.sapparam_set_shared_defaults.sapparam_readfile.sapargv_mergeprofiles.SapparamGetBoolParam.SapparamParseBoolParam.SapparamReadMemValue.SapparamParseMemValue.SapparamIsBoolValue.SapparamParseBoolParam@AF66_62.Collate@AF67_7.replace_dollardollar@AF68_10.sapsystem@AF69_34.ComposeDsSpec@AF70_15Sun Sep 18 07:22:08 2022 $tpo99f6001sapstr.c.strfcmp.strflen.strffcmp.strfeql.strffeql.strfempty.strfcpy.strffcpy.strfchr.strfall.strfallR.memtr.memctr.strzcpy.strz2cpy.strz2cpyR.strz3cpy.strca_.strct_.UcaFindUca.UcsFindRevUcs.MemFindMem.MemFindRevMem.strfeql@AF24_4Sun Sep 18 07:22:09 2022 $tpo1a0c001saptet.c.saptet_test_existence_of_task$tpo20f9001saptid.c.saptid_task_idSun Sep 18 07:22:10 2022 $tpo4b33001tsstinit.c.tsst2init.ask_OS.tsst3sa.tsst4updpid.tsst3sa@AF5_3$tpo2764001tsstst.cSun Sep 18 07:22:11 2022 $tpo7cff001sapcscsa.c.sapcscsa_create.sapdscsa_destroy.sapdscsa_destroy@AF3_2$tpo466e001sapdaem.c.sapdaem.sapdaem2.cannot_fdopen_for_stderr.cannot_grap_fid_2.cannot_reconstruct_stderrSun Sep 18 07:22:12 2022 $tpo33d1001sapsbgp.c.sapsbgp_start_background_proces$tpo6af7001sapscsa.c.sapescsa_exists.sapascsa_access.saprscsa_release.saposcsa_outdate.saposcsa_outdate@AF5_4.saprscsa_release@AF6_3$tpo11d5001saptep.c.saptep_test_exist_of_process.saptep_test_exist_of_process@AF2_1Sun Sep 18 07:19:08 2022 $tpo26b9001contloct.c.localtime_cont.getPPContTime.localtime_cont_old.ContLoctLocaltimeCont.localtime_cont_r.localtime_cont_r_old.ContLoctLocaltimeCont_R.R_gmtime.R_localtime.IsDoubleInterval_GetInterval.mktime_cont.mktime_cont_old.ContLoctMktime.ctime_cont_r.ctime_cont.IsDst.ContLoctGetAscTime.GetDoubleInterval.IsDoubleInterval.abSet_contloctime.abTest_contloctime.abGet_contloctime.ContLoctTmDiff.ContLoct_Init.ContLoctCreateTimeTable.ContLoctGetNextSwitch.ContLoctGetTimezoneIndex.ContLoctRegisterTrace.ContLoctSetTraceLevel.ContLoctGetTimeZoneOffset.ContLoctGetAscTime@AF31_17.ContLoctGetTimezoneIndex@AF32_27Sun Sep 18 07:19:12 2022 $tpo3fb0001nlsui0.c.isalnumU_wrapper.isalphaU_wrapper.iscntrlU_wrapper.islowerU_wrapper.isprintU_wrapper.isspaceU_wrapper.isupperU_wrapper.tolowerU_wrapper.toupperU_wrapper.nlsui_dlopen.nlsui_dlclose.nlsui_dlsym.nlsui_safe_strcat.nlsui_setPath.nlsui_resetPath.nlsui_initLoadIcuTrace.nlsui_initUfuncTrace.nlsui_addIcuSearchPath.icu7bitFallbackOrExit.setCtype7bit.mapCtypeFunctions.useFallBackCtype.isalnumU_7bit.isalphaU_7bit.iscntrlU_7bit.islowerU_7bit.isprintU_7bit.isspaceU_7bit.isupperU_7bit.tolowerU_7bit.toupperU_7bit.useICUCtype.getIcuLibList.openLibIcuUc.mapIcuUtilFunctions.mapUbidiFunctions.mapUshapingFunctions.mapUnormFunctions.mapUbrkFunctions.mapUidnaFunctions.mapUcalFunctions.checkIcuData.nlsui_traceIcuVersion.initIcuUc.nlsui_cpy_cmdline_par.nlsui_store_cmdline.nlsui_initialize.loadIcuDo.nlsui_set7bitUnicode.unsetIcu.openLibIcuI18n.closeLibIcuI18n.mapUcolFunctions.mapUtransFunctions.initIcuI18n.loadIcu.isgraphU.ispunctU.isxdigitU.nlsui_safe_strcat@AF60_13Sun Sep 18 07:19:18 2022 $tpo545a001nlsui1.c.fdopenU.fdopenU16.nlsui_U2sToUtf8s_checked.fopen64U.fopen64U16.nlsui_traceFopen.freopenU.freopenU16.gethostnameU.gethostnameU16.nlsui_Utf8sToU2s_checked.rexecU.rexecU16.dirnameU.dirnameU16.basenameU.basenameU16.linkU.linkU16.symlinkU.symlinkU16.readlinkU.readlinkU16.nlsui_malloc_error.chownU.chownU16.mkfifoU.mkfifoU16.utimeU.utimeU16.creatU.creatU16.perrorU.perrorU16.strerrorU16.popenU.popenU16.rmdirU.rmdirU16.statvfsU16.unlinkU.unlinkU16.asctime_rU.asctime_rU16.ctime_rU.ctime_rU16.asctimeU.asctimeU16.ctimeU.ctimeU16.strerrorU.Utf8sToU2s.setlocaleU16.tmpnamU.tmpnamU16.tempnamU.tempnamU16.mktempU.mktempU16.mkstempU.mkstempU16.ttynameU.ttynameU16.ConvertSCCSID_w.nlsui_wcsar2mbsar.U2sToUtf8s.nlsui_alloc_mbsar.wcstowcs.UcnToFileLenR.Utf8snToU2n.U2nToUtf8.U2snToUtf8n.nlsui_set_trace.nlsui_set_trace_func.nlsui_internalErrorMsg.nlsui_array_short.nlsui_utf8conv_error.cast_raw2ucChkFailed.nlsui_cast_raw2uc.dlopenU.dlopenU16.dlsymU.dlsymU16.dlerrorU.dlerrorU16.vopenU16.openU.openU16.fopenU.fopenU16.renameU.renameU16.removeU.removeU16.cleanup_putenv_table.cleanup_getenv_table.getenvU.getenvU16.putenvU.putenvU16.systemU.systemU16.strcasecmpU.strcasecmpU16.strncasecmpU.strncasecmpU16.strftimeU.strftimeU16.accessU.accessU16.chdirU.chdirU16.getcwdU.getcwdU16.chmodU.chmodU16.mkdirU.mkdirU16.nlsui_alloc_wcsarBase.nlsui_alloc_wcsar.nlsui_alloc_env.nlsui_getenvironU.nlsui_freeenvironU.strtoupperU16.strntoupperU16.strcpytoupperU16.strtolowerU16.strntolowerU16.strcpytolowerU16.ecvtU.ecvtU16.strcasecmpR.strncasecmpR.strtoupperR.strntoupperR.strcpytoupperR.strtolowerR.strntolowerR.strcpytolowerR.strntolowerR@AF140_138.strtolowerR@AF141_137.strntoupperR@AF142_135.strtoupperR@AF143_134.strncasecmpR@AF144_133.strcasecmpR@AF145_132.strntolowerU16@AF146_128.strtolowerU16@AF147_127.strntoupperU16@AF148_125.strtoupperU16@AF149_124.nlsui_freeenvironU@AF150_123.nlsui_alloc_env@AF151_121.strncasecmpU16@AF152_106.strcasecmpU16@AF153_104.nlsui_cast_raw2uc@AF154_79.nlsui_wcsar2mbsar@AF155_65.mkstempU16@AF156_61.mktempU16@AF157_59Sun Sep 18 07:19:22 2022 $tpod8e4001nlsui2.c.getpwnamU.getpwnamU16.getpwuidU.getpwuidU16.gethostbyaddrU.gethostbyaddrU16.convertToHostentU16.gethostbynameU.gethostbynameU16.gethostentU.gethostentU16.getservbynameU.getservbynameU16.getservbyportU.getservbyportU16.xdr_stringU16$tpo8ee8001nlsui3.c.unameU.getgrgidU.getgrgidU16.getpassU.getpassU16.getoptU.opendirU.opendirU16.readdirU.readdirU16.readdir_rU.readdir_rU16Sun Sep 18 07:19:23 2022 $tpo599b001nlsui5.c.vsprintfU.sprintfU.vsnprintfU.snprintfU.vfprintfU.vprintfU.printfU.fprintfU.sprintf_sU16.vsprintf_sU16.snprintf_sU16.vsnprintf_sU16.sprintf_sRFB.vsprintf_sRFB.snprintf_sRFB.vsnprintf_sRFB.vsnprintf_sRFB@AF17_16.vsprintf_sRFB@AF18_14.vsnprintf_sU16@AF19_12.vsprintf_sU16@AF20_10Sun Sep 18 07:19:24 2022 $tpoa700001nlsui6.c.vexeclU16.execlU.execlU16.vexecleU16.execleU.execleU16.vexeclpU16.execlpU.execlpU16.execvU.execvU16.execveU.execveU16.execvpU.execvpU16.vexeclU16@AF16_1Sun Sep 18 07:18:47 2022 $tpo4df4001rscpsc2.c.rscpsc2_c__no_more_malloc__abort.rscpuc_next_buff.UcsToU2s.UcnToU2n.NeutralUcnToUcn.UcnToNeutralUcn.UcnToUcmbn.UcmbnToUcnSun Sep 18 07:18:52 2022 $tpodd88001rscpu84r.cSun Sep 18 07:18:54 2022 $tpo35b1001rscpu86r.c.Utf16nToUtf8n.Utf16nToUtf8nNoCC.Utf16nToUtf8nGD.Utf16nToUtf8nSubst.Utf16nToUtf8nSubstAll.Utf8nToUtf16nGD.Utf8nToUtf16nSubst.Utf8nToUtf16nNoCCSubst.Utf8nToUtf16nSubstAllSun Sep 18 07:18:56 2022 $tpo225c001rscpuerr.c.rscph_rscpe__error.rscpSetHook_rscpe__errorSun Sep 18 07:02:17 2022 $tpob9fe001u16_aux.c.ascii7bitToU16.u16_trace_to_stderr.u16_set_trace.u16_traceMsg.u16_endTraceMsg.u16_set_trace_func.u16_set_fgetcU_error_parameters.u16_set_cmdline.u16_internalErrorMsg.u16_traceFopen.u16_rawDump.u16_rawStrDump.u16_charDump.u16_rawAndCharDump.u16_rawFileDumpOpt.u16_utf8conv_error.u16_malloc_error.u16_array_short.u16_unknownFormatStr.dbgAlignCheckStringU16.dbgAlignCheckStringU16@AF21_20.u16_unknownFormatStr@AF22_19.u16_array_short@AF23_18.u16_utf8conv_error@AF24_16.u16_internalErrorMsg@AF25_9Sun Sep 18 07:02:18 2022 $tpo7047001u16_str.c.strlenU.strlenU16.strnlenU16.strnlenRFB.strcatU.strcatU16.strcat_sU16.strcat_sRFB.strchrU.strchrU16.strcmpU.strcmpU16.strcpyU.strcpyU16.strcpy_sU16.strcpy_sRFB.strcspnU.strcspnU16.strdupU.strdupU16.strncatU.strncatU16.strncat_sU16.strncat_sRFB.strncmpU.strncmpU16.strncpyU.strncpyU16.strncpy_sU16.strncpy_sRFB.strpbrkU.strpbrkU16.strrchrU.strrchrU16.strspnU.strspnU16.strstrU.strstrU16.strtokU.strtokU16.strtok_rU.strtok_rU16.strtok_rRFBSun Sep 18 07:02:19 2022 $tpo5c7b001u16_mem.c.memcmpU.memcmpU16.memchrU.memchrU16.memsetU.memsetU16.mallocU.reallocU.callocU.memcpyU.memmoveU.memcpy_sRFB.memcpy_sU16.memmove_sRFB.memmove_sU16Sun Sep 18 07:02:20 2022 $tpofde0001u16_cty.c.isxdigitU16.isspaceU16.isalnumU16.isalphaU16.islowerU16.isprintU16.isupperU16.isgraphU16.ispunctU16.iscntrlU16.tolowerU16.toupperU16Sun Sep 18 07:02:22 2022 $tpo61be001u16_put.c.putc_unlockedU16.fputcU.fputcU16.fputsU.fputsU16.fwrite_unlockedU16.putsU.putsU16.fwriteU16_impl.fwriteU16.u16_fwriteU16.u16_fwriteU$tpoa4b4001u16_get.c.getc_unlockedU16.getc_unlockedU16_errno.fgetcU.fgetcU16.fgetsU.fgetsU16.getsU.getsU16.gets_sU16.gets_sRFB.freadU.freadU16.freadU16@AF13_12.gets_sRFB@AF14_10.gets_sU16@AF15_9Sun Sep 18 07:02:23 2022 $tpoa03b001u16_tol.c.tol_dummy_function.strtolU16.strtolU.strtoulU16.strtoulU.strtollU16.strtollU.strtoullU16.strtoullUSun Sep 18 07:02:24 2022 $tpo531f001u16_prnt.c.checkArgs.vvfprintfU16.vvfprintf_sU16.vfprintfU16.vprintfU16.printfU16.fprintfU16.vsprintfU16.sprintfU16.vsnprintfU16.snprintfU16Sun Sep 18 07:02:25 2022 $tpo4044001u16_scan.c.u16_enlar_nuspace.vvfscanf_sU16.vvfscanfU16.scanfU16.fscanfU16.sscanfU16.vsscanfU16$tpo6fe7001u16_OutCon.c.OutputConversionCtor.OutputConversionXtor.OutputConversion_setArgs.OutputConversion_parse.OutputConversion_toString.OutputConversion_output$tpo38c9001u16_FldWd.c.FieldWidthCtor.FieldWidthXtor.FieldWidth_parse.FieldWidth_isDigit.FieldWidth_atoi.FieldWidth_isDefined.FieldWidth_getValue.FieldWidth_isStatic.FieldWidth_setArgumentPosition.FieldWidth_setArgumentValue.FieldWidth_parse@AF11_3Sun Sep 18 07:02:26 2022 $tpo154c001u16_FrmIn.c.skipWhiteSpace.testForNANandINF.testForNIL.reallocbuf.copytobuffer.getLengthType.getCount.getFloating.getNumber.isBetween.getCharClass.getString.FormattedInputCtor.FormattedInputXtor.FormattedInput_input.reallocbuf@AF16_4Sun Sep 18 07:02:27 2022 $tpo297f001u16_InCS.c.InputConversionSpecCtor.InputConversionSpecXtor.InputConversionSpec_isValidSymbol__.InputConversionSpec_setSymbol.InputConversionSpec_getSymbol$tpo34be001u16_InStrm.c.InputStreamCtor.InputStreamXtor.InputStream_readSingleCharFromFile.InputStream_readSingleCharFromString.InputStream_readSingleChar.InputStream_EOF.InputStream_unreadSingleChar.InputStream_successfullyRead.InputStream_unreadSingleChar@AF9_7$tpo3b2d001u16_LenMod.c.LengthModifierCtor.LengthModifierXtor.LengthModifier_parse.LengthModifier_setValue.LengthModifier_isCharValue.LengthModifier_isValue.LengthModifier_isShortValue.LengthModifier_isLongValue.LengthModifier_isLongLongValue.LengthModifier_isIntMaxValue.LengthModifier_isSizeValue.LengthModifier_isPrtDiffValue.LengthModifier_isLongDoubleValue.LengthModifier_isLongLongI64Value.LengthModifier_isLongLongSun Sep 18 07:02:28 2022 $tpo4474001u16_FrmOut.c.FormattedOutputCtor.FormattedOutputXtor.OutputStream_writeNullTermination.FormattedOutput_parse.FormattedOutput_findNextSpec$tpoc350001u16_OutCS.c.OutputConversionSpecCtor.OutputConversionSpecXtor.OutputConversionSpec_setSymbol.OutputConversionSpec_isValidSymbol__.OutputConversionSpec_getSymbol.OutputConversionSpec_switchOnNegativeSign__.OutputConversionSpec_isNegative.OutputConversionSpec_getConvertedValue.OutputConversionSpec_isValid.OutputConversionSpec_toString.OutputConversionSpec_itoa__.OutputConversionSpec_dtoa__.u16_strnlenU16.OutputConversionSpec_ptoa__.OutputConversionSpec_isNumber.convertAsciiToWideChar.OutputConversionSpec_getWriteCountPointer.OutputConversionSpec_getConvertedValueSizeSun Sep 18 07:02:29 2022 $tpo388d001u16_OutFlg.c.OutputFlagsCtor.OutputFlagsXtor.OutputFlags_switchOnLeftJustifiedFlag.OutputFlags_switchOnSignConversionFlag.OutputFlags_switchOnSpaceFlag.OutputFlags_switchOnAlternativeFormFlag.OutputFlags_switchOnZeroFlag.OutputFlags_isLeftJustifiedFlag.OutputFlags_isSignConversionFlag.OutputFlags_isSpaceFlag.OutputFlags_isAlternativeFormFlag.OutputFlags_isZeroFlag.OutputFlags_parse$tpo524c001u16_OutStr.c.OutputStreamCtor.OutputStreamXtor.OutputStream_isFileOutputStream.OutputStream_writeSingleChar.OutputStream_writeSingleCharToFile.OutputStream_writeSingleCharToString.OutputStream_writeMultipleChar.OutputStream_writeString.OutputStream_writeStringToFile.OutputStream_writeStringToString.OutputStream_getMaxLength.OutputStream_getWrittenChars$tpo327d001u16_OutPrc.c.OutputPrecisionCtor.OutputPrecisionXtor.OutputPrecision_parse.OutputPrecision_isDigit.OutputPrecision_atoi.OutputPrecision_getValue.OutputPrecision_parse@AF7_3Sun Sep 18 07:02:30 2022 $tpo3550001u16_InCon.c.InputConversionCtor.InputConversionXtor.InputConversion_parseSun Sep 18 07:02:13 2022 $tpoef14001saprel.c.RelCompare.IsVersionRequested.IsLoadDbRequested.RelPrint.RelPrintNew.RelPrint2.RelPrintNewNoExit.RelPrint2NoExit.RelInfo2.GetExecutableName.PrintPatchLevel.PrintPatchInfo.RelSrcProtect.RelForCustomers.GetPatchLevel.GetPatchTextsAndNumber.RelInfo.get_sapreleaseno.saprelease2int.RunningCompatibly.PatchIsRelevant.GetPatchLevel2.GetInternalKernelVersion.GetPatchTexts.convert_patch_info.GetExecutableVersionCommand.GetPatchExecutableName.GetPatchArchiveName.CheckPatchExecutable.NotifyPatchHistorySun Sep 18 07:02:15 2022 $tpo2cdd001saprel0.c.db_describe.DbSlControl.db_dsql2.db_rtab0Wed Jan 18 11:53:03 2017 IBM XL C/C++ for AIX, Version 10.1.0.9../../../../../../../../src/bos/usr/ccs/lib/libpthreads/init.cTue Mar 4 11:08:27 2014 .call_pth_init__pth_init_routine../../../../../../../src/bos/usr/ccs/lib/librtl/64bit/rtld.cSat Apr 12 15:57:41 2008 __rtldglink64.s.exit.__run_final_dtors.atexit.__run_initial_ctors.__ReThrowV6.__setUncaughtExceptionFlag__3stdFb.__CleanupCatchV6a.access.chdir.chmod.chown.close.execve.fsync.kill.link.mkdir.readlink.rename.rmdir.shmat.shmctl.shmdt.shmget.symlink.sync.umask.uname.unlink.socket.bind.listen.setsockopt.gethostname.malloc.calloc.realloc.free.getenv.read_real_time.strlen.freopen64.fopen64.open64.lseek64.fprintf.fclose.getuid.strtoul.strchr.abort.sprintf.write.getpid.time.fputs.gettimeofday.fflush.vsnprintf.fdopen.fwrite.tolower.localeconv._filbuf.read.strncmp.fputc.ungetc.strtod.__fd_select.signal.setpgrp.getppid.sleep.fread.toupper.endpwent.getpwnam.getpwuid.strdup.fgetc.statvfs.fstat64.stat64.strspn.strpbrk.localtime_r.gmtime_r.ctime_r.asctime_r.localtime.ctime.asctime.mktime.time_base_to_time.system.waitpid.setlocale.xdr_free.xdr_string.sendto.qsort.getcwd.fork.dup.opendir.readdir_r.closedir.readdir.mktemp.popen.execv.alarm.execvp.tempnam.ttyname.bsearch.putenv.tmpnam.getgrgid.utime.strerror.strftime.iswalpha.iswcntrl.iswlower.iswprint.iswspace.iswupper.iswalnum.ecvt.mkstemp64.dlclose.dlopen.dlsym.strtol.getc_unlocked.putc_unlocked.remove.mkfifo.gethostbyname.naccept.recv.getpass.pause.creat64.funlockfile.flockfile.dlerror.gethostent.gethostbyaddr.endhostent.getservbyport.getservbyname.rexec.__pth_init