Ugx*[(x" 1L6aIhqX.text6a=\y .dataI6dXLAq@.bsshhh.loader38h.except=*.info=+BH= ,&2 PБ8A(A | S*~CxN!A(b9}{x~xH`@,AbDHA(| @__start, M H4N @__threads_init!|A(d| DN!A(b,#Ac| CN!A(b ,#Atc| CN!A(b(,#Ac| CN!A(b0,#Ac| CN!A(8!p}N b(,#AK A__threads_init@AF2_1p|X!|HMA(8!p}N A, call_pth_inith`A( L| N N @__User_sinit_begin|!HA(8!p}N A$__C_runtime_termination|8b8X8!a`?xpH5A(8bsHIA(!}N 8`HQA(|p88`sHaA(K8`cHyA(8`HA(!}N (ap__C_runtime_startupKdN @__4KTN @__3xA( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N `;|}&aA!`,;;`;@aA!xp8!bA"b>y8x8cy, |`x$|*AxpAb , @THi9`| @b , @$: 8ø80bHYA(@8uHx$|0*x&|"H%A(bHl9`Pb0|#@AX|#@@ b`p0bh|$@@8b8,0@9::`:]: *,b8Ȱ@ H!`bH` ,/@, -@P8@{C$8X|}*HЍ`,@;b~P.=@{C$8h|}*HU`,@;b~P.@{C$8`|}*H`,@;b~P. @H{C$8h|}*H`,@;b~P.@{C$8x|}*Hϭ`,@;b~P. @{C$8p|}*Hu`,@;b~P. @{C$8x|}*H=`,@;b~P Kl!8~}*bcH`,A8bcH`,A@({C$8H}*ccH`,@,8;|~Px$|*Kcc8LHΉ`,@8;|~Px$K8cHQ`,@tb@88cH)`,@0b@c|b|Pz.`AK$x.|(Pxd||8P|HkQA(H@8bx&|" Hk)A(8bH;=`~*8XbcH`,@p8b::@:w@@```!b@x&|w(*, @ h:: :s (6A~*8dbcHe`,@h8H@b: :b:D :$``!x&|p(*, @ \:: :1 (7A~*8bcH`,@X8|x$|*HA(8|`~x$|*HeA(p`dH`,ADK8bcH}`,@(8|x$|*HA(H`K8bcHA`,@H5`8|x$|*,#@P<`;Q8|x$```!|*HA(HE`H5`;{|;@AK4H}A(,@$|}K8pbcH`,@ brd , ,AA(8|z$~*~y@8`88|ep|bdx$|*`HMu`,A~*8bcH`,@brd , ,AAL8|z$~*vH A(,A8|bx$~ *HiA(`e8p|| P8b|bdHWe`,A4~*8bcHi`,@`8|x$|*,%A8|x$*8~8|ccfxc$|x$|*| *Hm,A~*8bcH`,@D8|8x$8|x$|x$|*| *|(*H,Ah~*8bcH`,A8 bcH`,@48~8|cxc$|x$|*| *H,A~*8(bcH=`,@48|8xc$|x$|*| *H ,A~*84bcH`,@ 8cH,A~*8@bcH`,@ 8|8888||x$xc$|x$|x$x$|0*|*| *|(*|8*H,A|K8K; 8ø8pccHe9A(H@z$8}|*|(*x&|"He A(cH5`P|>@AX|>@@ b`bh8K; 8ø8pccHdA(H@8}8|*x&|"HduA(cH4`P|>@A|Kl@H88|8z$~*bHA(.Ap8b8HA(,A8b8HA(,At8b8HA(,AX8b8HA(,A<8b8HuA(,A 8b8HYA(,@Tb88H=A(,AAT8b8HA(,A8wHMA(,@$; 8ø8pccHc A(H@z$8}|*|(*x&|"HbA(cH2`P|>@AKЈwHA(,A|AKDbc8Hq`,A\8bcHY`,AD8bcHA`,A,8bcH)`,A8bcH`,A8bcH`,A8bcH`,@dKȈvHA(,A8|z$~*,4A48tbH`,A8bH`,@ ,9\Ax,#@bpA , @ 8;"08øc#H@yA(@8ybHx$|0*x&|" H@EA(c#HY`Pb0|#@AX|#@@p|#@@X8bH `", yA$p`Ä , @H i`| @ , @ !8;08øcH?A(@8~8Hx$|0*x&|" H?UA(cHi`Pb0|#@AX|#@@p|#@Ax88~XHAA(8~H5A(8`KA(|pH u`K$H i`K|` @KKH I`KH]A(,@8K8_c&9bP"yJ$|P*H)e`!x,@8:Kp~8K`"@H8bx&| *H}`8bH `H `xPb0,,~#@AH@Ј, @x8b!8x&0|8øQH=A(8bH `AXb0|#@@pb0|#@@8KpKdx&8b!80|8øQH=A(8bH -`AXb0|#@@Kx&8b!80|8øQHp@@ @ ,#@; ; K8yظHeA(; ; K,bc@8yx.|H!A(8ycccfH A(88y|x.HA(8y8HA(8yx8٘HA(8y٤8HA(8y8HA(8y8HA(x8XHrA(8HrA(b@88`K!A(|p8ycccfHIA(8yXH=A(Kd8yؠH-A(KT;K<zZ$|*HlA(|d,AD:$b:9```!|*|cHmA(:o9|1@A8؀bHne`,@D8y؈H~A(8yؐH~A(8yؐH~mA(8yؔH~YA(x8XHqeA(8HqYA(b@88`KA(|p8y$H~A(8y8H~ A(8yڌH}A(8yڜH}A(8yڴH}A(8yH}A(8yH}A(8y8H}A(8y\H}A(8yxH}A(8yۘH}A(8yH}A(8yH}A(8y$H}yA(8yHH}mA(8yhH}aA(8y܄H}UA(8yܸH}IA(8yH}=A(8yH}1A(8yH}%A(8y4H}A(8y\H} A(8y|H}A(8yݤH|A(8yH|A(8yH|A(8ypK 8b8ø8bH#A(@H8|*8b|֐*8cx&}"H#A(8bH`AKa8Hge`,A88$aHgM`,@d|P;,Ap, -ApzC$~?*b#HeA(,A,Ab#HeA(;~Ka8(Hf`,A80aHf`,@d|P;,Ap, -AzC$~?*b#He5A(,A\,'ATb#HeA(;~Ka84HfE`,A8x$| *H`~|*Ha1`Ka8@Hd`,A8HaHd`,@|P;,Ap, -Ax$~?*b#HbA((#;A >KT 8b8ø8bH A(@H8|*8b|֐*8cx&}"H ]A(8bHq`A`K|a8LHd`,A88aHd`,@t;K8TaHc`,@;K8\aHc`,@ ;Kh8aHc`,@F;KD8 aHcq`,@E;K 80aHcM`,@ ;K88aHc)`,@ ;K8@aHc`,@;K8HaHb`,@ ;K8PaHb`,@>;Kl8XaHb`,@=;KH8`aHbu`,@ ;K$8haHbQ`,@;K8paHb-`,@ ;K8xaHb `,@ ;K8׀aHa`,@H|P,;Ap, -Ax$|*H`aA(@;dK\8׈aHa`,@L|P,;A,p, -Ax$|*H`A(L;dK8אaHa)`,@L|P;,A,p, -A;x$|*PKb PKa8הH``,A8רaH``,A;b , -@h8b8ø8bHA(@HbF|*8b8cx&|" HiA(8bH}`Al|7@@lK`8b8ø8bH5A(@HbF|*8b8cx&|"@HA(8bH`LRPBA Kax,:AKa8\H_`,A;AKЈKHE`K4H9`K|` @K C option_read;;aA;`!``x`aA!xpb|Bh>$c}&8D,#|xc$8x!|*ApAb , @H`| @b , @: 8ø80bH%A(~z$|*,'@8@8vHx$|0*x&|"HA(bH`Pb0|#@AX|#@@ b`p0bh|$@@8c$bH8,pAbc ,#A8\H`A(,#d @89B"xg$bp|8*H`8pbc,#AlpAb , @HH]`| @b , @; 8ø80cH}A(@8~8Hx$|0*x&|" HIA(cH]`Pb0|#@AX|#@@ b`p0bh|$@A8`8@:(8!0|} hp!xAa!AaN H%`KH`K| @tK`8pHpu`,A8b8ppc Hq,A@!p,9ApPbHX@ ~ (@`h:"@:c"`} @:9````!ypHC`|ryAԀ,,A@88*9T>#y@,;Ab@"H,>@h8øp8b8cx&|<簀HIA(8bH]`P|>@AX|>@@ b`bhK$x&8b| *HU``w8bH `H` 8b8ø80HA(,H?2!2@x&8w|8<!x脰`xHA(8bH`bP0~ @A0X|$@@ `p0h}$@@8, ALapȈ [(A8` c H,Abc,#ApAb , @HI`| @b , @8b8ø80HqA(8w8x&x$||0* HEA(8bHY`AXb0|#@@ b`A8`8KH`KhH`K8| @K@H1`,@b@,@8KKtx&!8w|c<脰hH}A(K8ø88bpH]A(8px&| *HAA(8bHU`LRPBA;`Kt8ø8b8pHA(8ox&| *HA(8bH`LRPBAK@88`KϵKlKHE`K\~K H1`K$| @K,"C file_convert``aA`!|aA~?B"!88c!,$~|dx$px8|*A8pA} ,#A H)`H!`| @H | @Ј , A H`: 8ø80bH1A(@8w8tHx$|0*x&}"HA(bH`Pb0|#@AX|#@@b`8p0:bh|$@@ 8HH:P, A bx| @(@ @H`A`b8zHWA(|ty@,b|5@@8zcx`uHWA(`t,4b@X8>b9pcy)$|H*H`, AHB8<`ĐbbCHW-A(,#x$~:*@T8"9@ bpb'9cD`Ha`, ATHbCHQA(8888`zb$8|1H`bDHN`bHVA(,AX8~"b9pxg$c|8*H`, AHlbH\A(,Ap8>9@bp9cDy)$ |H*HI`, A<pA} ,#A Hڝ`Hڕ`pAH | @H| @ , A HU`;8ø80cH A(@8}8Hx$|0*x&}" H aA(cHu`Pb0|#@AX|#@@ b`bh0| @A8`8H , @8`88x$|0*H`x, @hr, A@ , A408ֆ|ֈ֊ H88/08H ֐08֒, @88`88x$|0*H `|8, @ 8| ,#A H`H<88`8x$| *Hء`| |(,#A HQ`H  (|H,#A H%`H  HX, A,8app H`ap|XH| c|X`, A,8app H`p`H|`, A,8app Hy`pHb, A,8app H9`pHb, A,8app H`pHb|,#A8֔HM`,@ 8, @ 8, @ 8, @ 8P, @ 8P0, @ 80, @8H, @ 8 p,@ 8p`,A`,A H,@ 8,A H,@ 8,A H,@ 8,?A8cHLq`,A48 cHLY`,A8cHLA`,@ 8cHL!`,A48$cHL `,A80cHK`,@ 8 cHK`,A8$cHK`,@ .8cHK`,A80cHK`,@ /8cHKa`,A48cHKI`,A8cHK1`,@ 8cHK`,A48cHJ`,A8cHJ`,@ 8cHJ`,A488>8`x$| *H`}`q8`x$|0*Hy``p8`x$|0*HE``q8p8`x$|0*H `q9`8?8`8?x$| *H`}`q#8`x$|0*H``p8`px$|0*Hi``q8`0x$|0*H5``p8`x$|0*H``q8`0x$|0*H``p8`Px$|0*H``q8`0x$|0*He`q8@8`8@x$| *H-`} `q9߳8`x$|0*H``p8`:?T0x$|0*H``q8`01x$|0*H``p8`px$|0*HU``q8p8`x$|0*H``p8`Px$|0*H``q8p8`x$|0*H``p9Կq8`x$|0*Hy``qp: b8`x$|0*HA``o9Կ0q8`x$|0*H ``q8`/x$|0*H~``o8`x$|0*H~``q8`/x$|0*H~m``o8`Ox$|0*H~9`o8A8A8`x$| *H~`}(`q8@8`x$|0*H}``oqb:?/8`x$| *H}``q8`/9Tx$|0*H}Y``o8`/x$|0*H}%``q8`/qx$|0*H|``o8`:4/x$|0*H|``q8`/Qx$|0*H|``o8`:4/x$|0*H|M``q8`/9x$|0*H|``o8`x$|0*H{``q8`/x$|0*H{``o8`x$|0*H{y``q8`/x$|0*H{E``o8`x$|0*H{``q8`/Qx$|0*Hz`q8B8B8`x$| *Hz`}0`q8H8`x$|0*Hzm``o8`:?/x$|0*Hz5``qo8`9Tx$|0*Hy``o8`/x$|0*Hy``q8`/qx$|0*Hy``s98`qx$|0*Hy]``q8`3Qx$|0*Hy)``s8`q:43x$|0*Hx``r:48`S2x$|0*Hx``s8`rx$|0*Hx``rbSx$|*8`HxQ``s8`rx$|0*Hx``r8`Sx$|0*Hw``s8`rx$|0*Hw``r8`SRx$|0*Hw`r8C8C8`x$| *HwI`}8`r8P8`x$|0*Hw``s8Xr8`x$|0*Hv``q:`b3x$|*8`Hv``r:thq8`rx$|0*Hvi``q9Կpr8`x$|0*Hv1``r8xq8`x$|0*Hu``q8r8`x$|0*Hu``r8q8`x$|0*Hu``q8r8`x$|0*HuQ``r8q8`x$|0*Hu``q8rb8`x$| *Ht``r8q8`x$|0*Ht``q8r8`x$|0*Htq``p:Tq8`Px$|0*Ht9``q8p8`x$|0*Ht``p8q8`x$|0*Hs``q8p8`x$|0*Hs``p8q8`x$|0*HsY``q8p8`x$|0*Hs!``p8q8`x$|0*Hr``q8p8`x$|0*Hr``p8q8`x$|0*Hry``q8`0x$|0*HrE``o8 q8`x$|0*Hr ``p:4o8`0x$|0*Hq``o8p8`x$|0*Hq``po8$8`x$|0*Hqe``o8,p8`x$|0*Hq-``p84o8`x$|0*Hp``o8<p8`x$|0*Hp``p8Do8`x$|0*Hp``o8Lp8`x$|0*HpM``p8Xo8`x$|0*Hp``o8`bx$| *8`Ho``p8ho8`x$|0*Ho``o9pp8`x$|0*Hom`o:x8D8`8Dx$| *Ho1`}@`oc8`x$|0*Hn``s8`o9x$|0*Hn``o8`:tox$|0*Hn``s8`ox$|0*HnY`s8E8`8Ex$| *Hn!`}H`s9`8`x$|0*Hm``o8`:tpox$|0*Hm``s8`o9xx$|0*Hmy``o8`:tox$|0*HmA``s8`o9x$|0*Hm ``o8`:tox$|0*Hl``s8`o9x$|0*Hl``o8`:t4ox$|0*Hla`o8F8F8`x$| *Hl)`}P`sc8`x$|0*Hk``{8`sx$|0*Hk`{:(8G8`8Gx$| *Hk`}X`|88`x$|0*HkM``{8|8`x$|0*Hk``|8`\x$|0*Hj``{8|8`x$|0*Hj``|{98`x$|0*Hjq``{8`|x$|0*Hj=``|8{8`x$|0*Hj``{8|8`x$|0*Hi`{88H8H8`x$| *Hi`}``|88`x$|0*HiY``{8|8`x$|0*Hi!``|8{8`x$|0*Hh``{|808`x$|0*Hh``|8h{8`x$|0*Hhy`|9߲`;I8`8Ix$| *Hh=`}h`{#8`x$|0*Hh ``y8`;x$|0*Hg``{8`yx$|0*Hg``y8`;x$|0*Hgm``{8`y[x$|0*Hg9``y{8`x$|0*Hg`y8`8Ix$| *Hf`}p`|:c8`x$|0*Hf``{:T8`|x$|0*Hfa``|8x{8`x$|0*Hf)``{8`|x$|0*He``|8`x$|0*He``{8`|x$|0*He``|b\x$|*8`HeY`8K8K|8`x$| *He!`}x`|88`x$|0*Hd``{8|8`x$|0*Hd``|8{8`x$|0*Hdy``{8`;T|[x$|0*HdA``|8{8`x$|0*Hd ``{8|8`x$|0*Hc`{88L8Lb8`x$| *Hc`}`|88`x$|0*Hc]``{8|8`x$|0*Hc%``|8{8`x$|0*Hb`|88`8M8Mx$| *Hb`}`{88`x$|0*Hby``|8{8`x$|0*HbA``{|;bx,n@MD8N8N8`x$| *Ha`}`{;?#8`x$|0*Ha``z;8`[x$|0*Ha``{8z8`x$|0*HaI``z8 {8`x$|0*Ha``y;z8`yx$|0*H``y:8O8`8Ox$| *H``}`y8 8`x$|0*H`e``zy8(8`x$|0*H`-``y84z8`x$|0*H_``z8<y8`x$|0*H_``y;Hz8`x$|0*H_``z8`Yx$|0*H_Q``y8Pz8`x$|0*H_``z8Xy8`x$|0*H^`z:߼8P8`8Px$| *H^`}`z8`8`x$|0*H^m``y8hz8`x$|0*H^5``z8`Yx$|0*H^``|8`\x$|0*H]``z|bx:A ,n@H8`x$|0*H]``|8xz8`x$|0*H]I``z8€|8`x$|0*H]``|8ˆz8`x$|0*H\``z8|8`x$|0*H\``|8˜z8`x$|0*H\i``z8`\x$|0*H\5``|z8 bx,n@F8Q8Q8`x$| *H[`}`|;?#8`x$|0*H[``z:8`\x$|0*H[u``|8°z8`x$|0*H[=``z8¸|8`x$|0*H[``|8`x$|0*HZ``z8`\x$|0*HZ`z88`8R8Rx$| *HZa``|8}8`x$| *HZ)``z8|8`x$|0*HY``|;8`x$|0*HY``z8|8`x$|0*HY``|:08`x$|0*HYI``z:88`\x$|0*HY``|:@8`|x$|0*HX``z8|8`x$|0*HX``|8z8`x$| *HXi``z8|8`x$|0*HX1`z88S8S8`x$| *HW`}`|8 8`x$|0*HW``z8|8`x$|0*HW``|8`x$|0*HWQ``z8`\x$|0*HW``|8`x$|0*HV`|c8T8T8`x$| *HV`}`|88`x$|0*HVy`|8 888`x$| *HV=`}`|:_C8`x$|0*HV``z8(|8`x$|0*HU``|80z8`x$|0*HU``z8`\x$|0*HUa`z8<8U8`8Ux$| *HU%`}`z#8`x$|0*HT``y;Dz8`x$|0*HT``x;_Ly8`Xx$|0*HT``y:Xx8`x$|0*HTI``x8`y8`x$|0*HT`x8h8V8V8`x$| *HS`}`yc8`x$|0*HS``{by[x$| *8`HSm``z8`[x$|0*HS9``{8`z;x$|0*HS`{888`x$| *HR`}`}8p8`x$|0*HR``|8x}8`x$|0*HR]``}8À|8`x$|0*HR%``|8È}8`x$|0*HQ``}b:߼x$| *8`HQ``|8Ð}8`x$|0*HQ}``}8Ü|8`x$|0*HQE`8W8à8};8`e;(`!|x$|0*Hb`;8|;d8`e(=A8`(x$| *Hb]`88X;;0d8`e````!|x$| *Hb`;8|;d8`e(=A8`0x$| *Ha`88Y;;H8d@8`e````!|x$| *HaQ`;8|;d8`e(=A8`8x$| *H``88Z;;@d8`e````!|x$| *H``;8|;d8`e(=A8`@x$| *H`M`88[;;@HdX8`e````!|x$| *H_`;8|;d8`e(=A8`Hx$| *H_`88\;,`,Pdx`!8`eLFA(x$|0*H_9`8| Иd;;(= ,@ ,K8`-Px$|0*H^`8e ,8` x$|0*H^`8e 8`x$|0*H^u`88];`Xd(8`ex$|0*H^%`8|`d````!;;(=,@ AK8`Xx$|0*H]`8e8`x$|0*H]`88^;;(`d8`e```!|x$| *H]1`;8|;d8`e(=A8` `x$| *H\`8e` 8`ex$|0*H\`8;;hhehd8`````!x$|0*H\Q`;8};8`(<A8_8;8`eh;xp```!|x$| *H[`;8|;d8`e(=A8`px$| *H[}`88;;xd8`e````!|x$| *H[!`;8|;d8`e(=A8` xx$| *HZ`8eH 8`ex$|0*HZ`8;;PePd8`````!x$|0*HZA`;8};8`(<A8;8`e;p`!x$|0*HY`;8|;d8`e(=A8`x$|0*HYy`88`;;d8`e```!|x$| *HY!`;8|;d8`e(=A8`x$| *HX`88a;;dȘ8`e````!|x$| *HXq`;8|;d8`e(=A8`x$| *HX`88b;;d8`e````!|x$| *HW`;8|;d8`e(=A8`x$| *HWm`88c;;dH8`e````!|x$| *HW`;8|;d8`e(=A8`x$| *HV`88d;`d8`ex$|0*HVm`8| d``!;;(= ,@ AK8` x$|0*HV`8e  8`x$|0*HU`88e;`d 88`ex$|0*HU`8|d`!;;(=,@ AK8` x$|0*HU1`8e 8`x$|0*HT`88f;,`,d0````!8`eLFA(x$|0*HT`8|pd;;(= ,@ ,K8`x$|0*HT5`8e8`x$|0*HS`8e8`x$|0*HS`88g;/`dИА````!,,A@8`eL3A(x$|0*HSM`8|d;;/(= A8`x$|0*HS`8eؘ8`x$|0*HR`8e8`x$|0*HR`8e8`x$|0*HRY`88h;,`,dА````!8`eLFA(x$|0*HQ`8|ؘd;;(= ,@ ,K8`x$|0*HQ`8e8`x$|0*HQ]`8e8`x$|0*HQ%`88i;,`,d8А```!8`eLFA(x$|0*HP`8|d;;(= ,@ ,K8`x$|0*HPe`8e8`x$|0*HP-`8e8` x$|0*HO`88j;`d 8`ex$|0*HO`8|d````!;;(= ,@ AK8`x$|0*HOA`8e 8`x$|0*HO `88k;,`,dHА````!8`eLFA(x$|0*HN`8|@d;;(= ,@ ,K8`x$|0*HNE`8ep8`x$|0*HN `8ex8`x$|0*HM`88l;; 8d8`e``!|x$| *HM`;8|;d8`e(= A8`x$| *HM-`88m;; d 8`e````!|x$| *HL`;8|;d8`e(= A8`x$| *HL}`89 n;`;0e ؘ8`e'```!x$| *HL!`;8|;d8`e(= A8o8;8`e; ```!|x$| *HK`;8};d8`e(< A8`x$| *HKM`88p;;xd (8`e````!|x$| *HJ`;8|;d8`e(=A8`x$| *HJ`88q;;Hd8`e````!|x$| *HJA`;8|;d8`e(=A8`x$| *HI`89 r;`; ( e8`e'```!x$| *HI`;8|;d8`e(= A8s8;8`e ;(```!|x$| *HI`;8};d8`e(<A8`(x$| *HH`88t;`0d8`ex$|0*HHm`8| pd``!;;(= ,@ AK8`0x$|0*HH`8e 8`x$|0*HG`88u;`8d А8`ex$|0*HG`8| Șd`!;;(= ,@ AK8`8x$|0*HG1`8e 8`x$|0*HF`88v;`@d А8`ex$|0*HF`8| d`!;;(= ,@ AK8`@x$|0*HFQ`8e 8`x$|0*HF`88w;; Hd Ș8`e```!|x$| *HE`;8|;d8`e(= A8`Hx$| *HEm`88x;;hPd p8`e````!|x$| *HE`;8|;d8`e(=A8`Px$| *HD`88y;;Xd8`e````!|x$| *HDa`;8|;d8`e(=A8`Xx$| *HD `8e8`x$|0*HC`88z;;`dȘ8`e``!|x$| *HC`;8|;d8`e(=A8``x$| *HC-`8e8`x$|0*HB`88{;; hd8`e``!|x$| *HB`;8|;d8`e(= A8`hx$| *HBM`88|;;pd 8`e````!|x$| *HA`;8|;d8`e(=A8`px$| *HA`88};; xd 8`e````!|x$| *HAA`;8|;d8`e(= A8`xx$| *H@`88~;;d H8`e````!|x$| *H@`;8|;d8`e(=A8`x$| *H@=`88;;dH8`e````!|x$| *H?`;8|;d8`e(=A8`x$| *H?`88;;dȘ8`e````!|x$| *H?1`;8|;d8`e(=A8`x$| *H>`8e8`x$|0*H>`88;; Pd 8`e``!|x$| *H>Q`;8|;d8`e(=A8` x$| *H=`88;;d  8`e````!|x$| *H=`;8|;d8`e(=A8`x$| *H=M`88;; d8`e````!|x$| *H<`;8|;d8`e(=A8`x$| *H<`88;;HdX8`e````!|x$| *HaA8!xp~B"8c~, !|`x$|*ApAԈ , @H`| @ , @x: 8ø80bHEA(@8v8Hx$|0*x&|"HEA(bH`Pb0|#@AX|#@@ b`p0bh|$@@80P8, 8c|`x$|*A8pA~ ,#A H `H`| @H | @̈ , A H`;b 8ø80ccH(A(@8{hHx$|0*x&}"H'A(ccH`Pb0|#@AX|#@@b`8bp0bh| @@ 8HHbpahcdH`,#AB8H8h#A2ȃ$ (C2,$$b!؁A b2ءPAj2a022%$$ 2AP22m2H2١a؁@paxف02A)2{22!١ہa!@H&UA("H@:bx&| H&)A(bH=` 4, @ 8|, A8p`A~ ,#A H}`Hu`| @H |` @ , A HI` b8ø08H%A(8w8x&x$||0* H%]A(bHq`Pb0|#@AX|#@@b`8bh0| @@ 8H8`8!8}!AaHt|, A8p`A~ ,#A H5`H-`| @H |` @Ĉ , A H`; 8ø80cH$=A(@8~8Hx$|0*x&}" H$ A(cH`Pb0|#@AX|#@@b`8bh0| @@ 8H8`p8!}a8N "A  disk_info| V3>8~#x$| *H`~ep`s8~2|ex$~#8~#|0*HY`aa8H]e`,@8XaH]M`,@8 ;b8ø8dbccH5A(H@8{8x$x&|0*|" HA(ccH `P|4@AX|4@@ b`bh8H:a8bH/`8|oyA.0@T,;A<`8H]``z8<`8x$| *H-``xa8ceH5`,#A? `w>KKH`K$bpKHԹ`K| @K"C rman_prepare|}&ۡہ:axAp!h<C0!"b?)aph8D8c,$|cxc$|*ApAp , @lH]`| @P , @8N1@dp0x$dZ|*,@8bcH%``u8bc8x$|0*H``tc8bH`,#A$`qcC8bH`,#@}, Adp`AЈ , @DHm`| @ , @; 8ø80cHA(@8~8Hx$|0*x&|" H]A(cHq`Pb0|#@AX|#@@ b`bh0| @A8`8zh`|ˡXˁP8!p} !hApax!AaN H9`KH-`K|` @pK~sacb$bbf8pbH u`Tr>,ATcCbbf8xbH I`T`>,A(ùÙ--`!bpbxx"x"|%@ta(A"(ȡpe(A(*$***@H,,@,2L2ApA8@cCbbf8xbH`,T`>AdKDcb$bbf8pbHU`,Tr>A4@ Kcb$bH(-`,AcCbH(`,A@0(x~,A.8Ac8XHF`|`4TA;cC8XHFu`|`4TA;Y; 8ø8nbcHaA(H@8x @ccHx&|"-HA(cH1`P|6@AX|6@@ b`bhKc8XHE`|`4TA;cC8XHE`|`4TA;Y@b HP}6@Ad8b8ø8mbHqA(8bccF8cx&|-HIA(8bH]`ADX|6@@@K48b8ø8mbHA(8bccF8cx&|-HA(8bH`AKԈ}, Ap`AЈ , @HI`| @ , @; 8ø80cHmA(@8~8Hx$|0*x&|" H9A(cHM`Pb0|#@AX|#@@ b`bh0| @A8`8KHu`KDHi`K|` @K .8KNK>`<`8HM``u8<`8x$|0*H!``tc8bH)`,#ALK(8a8ccFH%A(: 8ø80bHA(H@8v8x$x&|0*|"HA(bH`Pb0|#@AX|#@@ b`p0bh| @@8KKH `K@(KH`K| @K"C file_compare|}&HLNB`=`E0?C0?E0aA`!x=E0<C0!"Bb?`;8 aD8,%|x$|!*A pA , @ Hɵ`b| @b , @ 8a8`ccHA(;B 8ø80cCHA(@8z8Hx&x$|"|@*HuA(cCH̉`Pb0|#@AX|#@@ b`p0bh|$@@8,<@b#8a8ppHA`,ALaH@A(0beX,x$|*@c8Hm`88`z|8x$| *H9``ycp8HA`,#A`xa8pH!`|wyA!pW >"AD|pp@ccpcEc8H `T{>,A4ap|bc8xH`T`>,AÞ~9--``!cCc$xx"x"|%@a(A"(ȡe(A(*$***@@ bd, A`p`Ab , @AX@lK$ccpH `,A4pbaH`,A@$(,@Dbd, A p`Ab , @H`b| @b , @; 8ø80cH-A(@88Hx&x$|"|@* HA(cH`Pb0|#@AX|#@@ b`0pbh| @A8`8KH%`K4H`K|` @K c8XH:9`|`4TA;; 8ø8npcH%A(H@8| @cx&|"-HA(cH`Pbp|#@AXbp|#@@ b`bhK8XcH9q`|`4TA;; 8ø8mpcH]A(H@8|cx&|"-H1A(cHE`Pbp|#@AdKPHEA(`|KNK HEA(`|KHEA(`fap8x|bH`,A,Ax!pHEeA(|6@At8; 8ø8dpcHiA(@88Hx&x$|"|0* H)A(cH=`Pbp|#@A\X|#@@XKL?`<`8Hҥ``z88{8x$| *Hu``ycp8H }`,#AK| H@ V >N| L1|&T 6! 8@ @N| LB|`&a @8zH %A((,#A0@,#A/8HA`d8aH )`8ac$H+Y`,#A H8a X|,$|&| P@/lz$8z|w*`wHEA(|vy@9@9`"c#b9Dx $g|P*H`e, Axp`A؈ , @XH`| @b , @$; 8ø80cH A(@8}8Hx$|0*x&|" HA(cH`Pb0|#@AX|#@@ b`bh0| @A8`8xp|ˡhˁ`8!} PX`!hApax!AaN H`KH`K|` @dK8a8bHqA(,#A , Aa P|h APXbHh"@|9 @@@: :"@9~`&|9@~@&``!8a8 H A(8 8,#A8aH A(,#@ 8a888H ``d8a88H`8ac$H!`8ø ,#8c&Ad8b, @`HA(88nx&| *HDZA(8bH`V`>8a`~H | 88LB0BAHqA(88bx&| *HUA(8bHi`N18a8bHA(,#@4p AP8 "9` Bc#b9 x$i`|8*H`KPbHA(,@@8a (W> | 0,L,|&T 6MB,W>| M1L2|&T 6W>| LFMBSBMNSA P| Aa X,@; 8ø8c&cHA( X@8}8H,>(x&|"! ` HA(cH`P|9@AX|9@@ b`bhK$8a888Hm``d8aH}`8aH`,A,A@x-bAc 8| LPB|`&|h @4bH Hx@|:c |xxT  8 :O 8o :/ H IA(8|pyA:Pa H A(8a8H`b8@b%HA(,bA ,H -A(,8`@ H`8\u``wH A(,#A `H A(,8`@ ````!HQ`bc$H!`,#Ax8`, @8zup`wH EA(|vy8aA X8bH QA(,#@ b4p @ H YA(,b@ HHA(, ,*@ZD9 8bCz,A89 !xpH`,@`8a P8`| A48b&HA(88bx&| *HA(8bH `8*8a<$!2! HA(88bx&| *H¥A(8bH`8\uh`wH A(|vy8A@bb%HA(,0,AA 8 |8 c|y@4A @| Ab8\ch`wH yA(,#A0A$`v; 8 ``!8x H=A(|uy8b88 AHA(,,5A8 A}y@bH AA(,AL8$_c#b"9$yJ$|P*HU`K8`He`8\}``|H}A(,#@P8%"9`Bc#c9%x$i|8*H`K8HqA(,AL8&_"c#c9&yG$|8*H`K8``!H`cc$Ha`,#A8`, @}p8z`|HA(|xy@P_9`'8"c#c9'gyG$|8*H`K@8a8cHEA(,#A\x``!8a8LHi`8X-8aHU`,@lA8a8cHA(,#@4pp AP8*"9` Bc#c9*x$i`|8*H`KpcHA(,AL8+_c#c"9+yJ$|P*H`KcH A(,@4@e, A p`A؈ , @H`| @b , @; 8ø80cHA(@8}8Hx$|0*x&|" HA(cH`Pb0|#@AX|#@@ b`bh0| @A8`8KH `KDH`K|` @K8,9`"Bc#c9,x$i |8*H)`K8a8XH`8X,8aAdHA(,8|XA`HA(,A\9@)8"c#8ڳ9)Gyg$|8*H`K9@(8 "c#8ڳ9(Gyg$h|8*HM`K8#9`_c#b"9#yJ$ex|P*H`K\`vKL8"9`"Bc#b9"x$i|8*H`K8!9`_c#b"9!yJ$ex|P*Ha`K8 9`_c#b"9 yJ$e|P*H`Kp8p8b&HA(K8a8b%HA(88bx&| *HA(8bH`N1K89`_c#b"9yJ$e |P*Hm`K8_c#b9"yJ$|P*H%`K89` _c#b"9yJ$e`|P*H`K4```!8a8LHy`8X-8aHe`,@(A8a8bHA(,#AK8a8XH)`8X,8aAH A(,8xXAhHeA(,@ pK9@8"c#8ڳ9Gyg$|8*H`K@9@8 "c#8ڳ9Gyg$h|8*H`K89`_c#b"9yJ$e|P*HM`K8_c#"b9yG$|8*H`K`9@8"c#b9Gyg$|8*H`K8_c#b9"yJ$|P*Hq`K89`_c#b"9yJ$ex|P*H%`KbH: H@ P|: |xxT"```!8 :O 8o :/ HA(|py8A:Pa HIA(88aH]`,/* ZDz,89 9 apbCA8!xH`b&,@ 8a8`A8HA(88bx&| *HA(8bH`8a*8<$!2! HA(88bx&| *HA(8bH`,0A|c|y@ A @| @(K8p8H1A(K88a8b%HA(88bx&| *HA(8bH`N1Klb8\ch`wHAA(,#A- @`v| A`Axc; 8 ```!8u HA(|ty8b8@8 AHA(,,4A\8 A|y@bHA(,AL8 _c#b"9 yJ$|P*H`K`8`H`b8\c``|H-A(,#@P8"9`Bc#c9x$i|8*H`KH!A(,AL8_"c#c9yG$|8*H5`K8``!HA`cc$H`,#Ah8`, @b8zcp`wH1A(|vy@P9@9`"c#b9Dx $g|P*H`K8a8bHA(,#AXx`!8a8LH`8X-8aH`,@8A8a8bHA(,#@4p AP8"9` Bc#b9x$i`|8*H`K$bHYA(,AL8_c#b"9yJ$|P*Hm`KbHeA(,A8"9`Bc#b9x$i |8*H `Kh8a8XH`8X,8aAHHA(,8|XAlHA(,@ pK9@8"c#8ڳ9Gyg$|8*Hq`K9@8 "c#8ڳ9Gyg$h|8*H%`K8 9`_c#b"9 yJ$ex|P*H`K48 9`"Bc#b9 x$i|8*H`K; 8ø8r0cHEA(H@8|8x&|".@HA(cH1`Pb0|#@AX|#@@ b`bh0| @@8@KtK8 _c#b9 "yJ$|P*H`K8a888HeA(88bx&| *HIA(8bH~]`K88cHA(KXPbH@ b`|9 @Bh; :#"@~&|9@}&`!8a8 H=A(88,#A8a, ,%aA ,%b@@H`8a8 HA(,#@`8a888HE``d8a88H-``nc$H]`,#8øA88ac&, @8bH A(8ba8cx&| *HA(8bH|`V>a} | 8a8LB0BAHA(88bx&| *HA(8bH|`N18a8bHA(,#A@K|888HMA(88bx&| *H1A(8bH|E`K888a H `8a c$H`,#Al,Al8a8 88H``d8a H`K@8a88HuA(,@8b8øP8HA(H888b8cx&|HUA(8bH{i`P| @@ce,#AdpAȈ , @DHw`| @b , @8b8ø80HA(8H8b8cx&x$|"|0* HA(8bHz`0bP| @AbX| @@0| @A8`ˁ`xp88!} |PX`!hApax!AaN Hvi`KHv]`K| @hKĈKt88b8ø8dc&HA(8H8b8cx&x$|| * HIA(8bHy]`P|9@A|Kla (,#A P| A PbXH@ `|9@"h:d :D"@~&|9@}&``!8a8 H-A(8 8,#A8aH A(,#@8a888Hi``d8a88HQ``n8ac$H}`8ø,#8c&A8b, @H-A(8b88cx&| *H A(8bHx!`V>8} | 8a8LB0BAHA(88bx&| *HA(8bHw`N18a8bH)A(,#AdKa88)8HM``g8a888HQA(88bx&| *H5A(8bHwI`K88cHA(KpXPbH@ b`|9(@Bh; :#"@~&|9@}&````!8a8 HA(88,#A8a, ,%aA ,%b@@̘Hu`8a8 HA(,#@|8a888H%``d8a88H ``nc$H=`,#8øAې8ac&, @8bHA(8ba8cx&| *HA(8bHu`V>a} | 8a8LB0BAHA(88bx&| *HqA(8bHu`N18a8bHA(,#A K|88)8H ``g8a888HA(88bx&| *HA(8bHu `K888a H`8a c$H`,#A0,AP8a8 88Hq``d8a H`K$ P| APXbH0@b |90@"`:C 8"@h `95 h `} &|9(@! p}@&A x`!8a8 HmA(8 úD8,#A8aHIA(,#@T8a888H``d8a88H`a 8ac$Hй`c$,#A,.A@@Aa HЉ`|oyA8b0* 8ø8-MsAtH-A( h8b x&8c| *H A(8bHs`cP|@b0|5 @LB0B|@AA8aHA(8,=88|x$| *@8Ho``}`o,ۡ 8* 8oA8 HQA(8o8c H=`8a HA(8c 8x$| *Ho ``|o8 c8HA(8a8bHmA(,#@ Kڠ8Hn``o|K0ˣK0a 88)8Hi``g8a8(88HmA(88bx&| *HQA(8bHqe`K\8ø88bc&H%A(8 `8b8cx&| *HA(8bHq`8a x p88T>} | LB0BAHA(88bx&| *HA(8bHp`N1K88cH=A(KX0bH"P@ |((@Bh9c 9"@b` :5 " aw}&|9(@ }&|9H@ |`&a `!8a8 H]A(8Mq:8,#A8a,%aA ,%b@ ,& @H߭`8a8 HA(,#@8a888H]``d8a88HE`a c$Hu`c$,#A,/A9@$(8aA 9 8a H5`|pyAԌ8b0*8ø8, W>| LFA|HA(a 8bx&8c| *HA(8bHn`c0 PT>| |. @LB0BA|.@Arr8aHUA(`p8A(,=|x$| *@8;Hk%``}`p, 8* 8pA8 HA(8p88 8c AH`a 9HߵA(8c 8x$| *Hj``|p8 c8HA(8a8bHA(,#@` K88HQA(K89Hj9``p|K8a HA(|c8Ka 88)8H``g8a8(88HA(88bx&| *HA(8bHl`K88ø8b8c&HA( 8b 8cx&| *HuA(8bHl`8a 8 U>} | LB0BAH1A(88bx&| *HA(8bHl)`N1K888a H`8a c$H`,#AL,@cMrBK(8a8 88H``d8a Hۑ`cMrBKz$~*bHiA(88a|H]`8Kh8zHA((,#@8z8HA((,#@8zHHA((K8zHA((Kϴbc8H`,8|bc~&Hޱ`|`4bcT~8Hޙ`~ @@, 0,t-%|&T 6,8x H|`&Tf 6 @Kbc8|HE`-8|`4bcT~,|&T 6A @H`Albc8H`,AX8 ;8ø8dc&cHA(H@8|8x$x&|0*|" HA(cHi`P|9@AKb8Hi`-8|`4bT~HM`|`4bT~a 8H1`|`4bT~A (8H`Ab8H`-8|`4bT~a H`|`4bT~A (8H`Āb8Hܱ`-8|`4bT~A (Hܑ`APb8H}`,|`4T~ 0A8 ;88ø8dc&cHYA(H@8|8x$x&|0*|" H!A(cHh5`P|9@ATKD 8ø8d;c&cHA(H@8|8x$x&|0*|" HA(cHg`P|9@AX|9@@KĈKHd `K8"pKHc`K| @K"C8backint_executeۡہ;;;aA;`!`; `v`axAp!h`b?|XP}&MbBD8,$MjB|xc$8L!|*A`pAb , @,A, A 8aTa88H``o8a8pHЁ`,@0cD8aTH`,#A`, A`*acDHy`|nyA0, @$b, A8aTaHH`,@8b98ø8dcFHA(8T8bx&|8cx$ |8*HA(8bH[`~ LBPBA b`Mi8aT8cHA(,#@4p Ad"8 B9 bcC9  `x $|H*Hv=`b@;HKcHA(,@@,b@;H@ c8ø8cFHA(,?(8}8Px&|! H` HHA(cHZ`P|:@AX|:@@ b`bhK@b8\s`yHѭA(,#@X8 "B9bcCc&9  x $|H*Hu`KHљA(,AT8 "BbcCc&9  x $|H*Ht`Kl8a @8HmA(c8 @x&| HMA(cHYa`8``!Hq`c#cDHA`,#A8`, @,>AAl;8 Ü```!:~:  , *A:H́A(b\Db|,b9 pAxHm`,@8a @@088*@$ 2! X XHQA(8 @8bx&| *H5A(8bHXI`~y@4s8\`~HuA(,#@X8 "B9bcCc9  x $|H*Hr`KHaA(,AT8"BbcCc9 x $|H*Hrm`K48a @8lH5A(c8 @x&| HA(cHW)`8````!H1`ccDH`,#AĀ8`, @@Kۡ h8T x h xHA(KPMiKp;8 :Ü````!:~:  , *A:HA(b\Db|,b9 pAxH`,@8a @@088*@X$ 2! HA(8 @8bx&| *HA(8bHU`~yAK0ۡ 8T HA(KMiK8 "cCBb9   x $|H*HpM`b@;HK8aTH A(,>8|x$| *@28HQ``~`}},8*A8 ( 8 (HA(}8T8c Hĕ`9aHyA(8c8x$| *HQ]`}`}caHE`K8HQ1`}`}KT8b8ø80H A(8ba8cx&|5HA(8bHS`@,cn,@,.A*Y,KlK8b8ø8cFHA(8b8T8cx&|"@HeA(8bHSy`~ LBPBAK8b8ø8r0H-A(8ba8cx&|.@H A(8bHS`@cK$KaHlu`T`>,AK8a<8P88Hu``d8aT88Huu``oK@X|7@~:@Hb B`"h}:@|`&a `!8aT8 HǭA(,#A 88aT88)8Hu``d8a,AD, AL8aTa88Hs%``o8a8pH`,@0cD8aTH9`,#A, A`*acDH `|nyA, @b, A8aTaH8|x$| *@98HK``~`}},8*A8 8 8 8H~A(}8T8c H`9aHeA(8c8x$| *HKI`}`}caH1`K98HK`}`}KP8b8ø80H}A(8ba8cx&|5H}A(8bHM`|7@bX|@LB0BA | @,cn,@,.A*Y,KK8b8ø8cFH}QA(8b8T8cx&|"@H}-A(8bHMA`LRPBAK8b8ø8r0H|A(8ba8cx&|.@H|A(8bHL`|7@X|x@LB0BA | @cK@K4aHf!`T`>,ATK8a<8P88Ho9``d8aT88Ho!``oK8pH `|`4TMK;A`d8aH `K8aH`K;A8aH`b0CK8|HA(|dy@K(8b84K8|hHmA(|dy@b0,$@`8|xHIA(,#@,;Ah|ratb0CKp`d8a;AH5`b0CKP8aH`K@8|8HA((,#@8|HHA((K8|`HA((KcC8H`,A8 ;Bp8ø8dccFHzA(b@8}8Hx&x$||0* HzMA(cHJa`P|:@AKcC8H`.@,A@K 8ø8d;BpccF>HyA(b@8}8Hx&x$||0* HyA(cHI`P|:@AK  8ø8d;BpccFHyMA(b@8}8Hx&x$||0* Hy A(cHI!`P|:@AX|:@@KKHEu`KHEi`K| @K"CPsplitint_execute|`aA!!1bab, ?#~88c~|`x$|*ApA؈ , @HD`| @ , @;B 8ø80cCHwA(@8zHx$|0*x&|"HwA(cCHG`Pb0|#@AX|#@@b`8p0bh|$@@888ap8@HwA(8b8c`! 8c , A 8K|8at8ƬHvA(,?B@tyRHTVz 8XcCHA`cC8tH1`8pcCH!`cC8pH`8cCH`cC8tH`8cCH`cCH`8cCH`;cCHA(8c8x$| *HT`acDH`8`Bp88899 H5`,,| A8aA(pAԈ , @HB`| @ , @; 8ø80cHu=A(@8}Hx$|0*x&|" Hu A(cHE`Pb0|#@AX|#@@ b`0pbh| @Aa88!}!AaN HA`KHA `KA(pAԈ , @H@`| @ , @; 8ø80cHt A(@8}8Hx$|0*x&|" HsA(cHC`Pb0|#@AX|#@@ b`0pbh| @A8`8KH@`K@H@`K8yHc88Hf)``dcCH9``zKKH?`K@H?`K| @K A manif_create|}&?8!a,$axb8|xc$|*ApAb , @H>`b| @b , @dN@ax8\HyA(,#@8"B9b9xp cx $|H*H\`b, APbpAb , @$H>`bpAb , @; 8ø80cHq1A(@8~8Hx&x$|"|@* HpA(cHA `Pb0|#@AX|#@@b`8bh0| @@D88`} 88!|N KH=`K H<`Kb| @Ka<xb`cHA(,#Axb`!8XHA(,bxA 8cXH-A(,b@HA(x,A8dXHA(cx,b@H1A(x,#b@bx4p A|"8B9 b8߱9p c`x $|H*HZE`b, @|b| @`KaHA(,@lbd, AHp`Ab , @$H;U`b| @b , @; 8ø80cHnqA(@8~8Hx&x$|"|@* Hn5A(cH>I`Pb0|#@AX|#@@b`8p0bh|$@@@88`} 88!|N KH:A`K H:5`K|` @K8"9Bb9xp cx $|H*HXQ`b, AK89"Bb9xp cx $|H*HW`b, AK89 "Bb9xp chx $|H*HW`b, A@K8"8߳Bb9p) cy)$|H*HW`b, AKP89 "Bb8߳9p chx $|H*HV`b, AtK; 8ø80cHk]A(@8~Hxx&x$|"|@*Hk!A(cH;5`Pb0|#@AX|#@@b`8p0bh|$@@8KKH7Y`KNB@0KH7A`KX| @Kd C8input_duplicate`a`H)`bp8`888cj99 `H =`,Aah|*H A(,@pbd, ALp`Ab , @(H,E`b| @b , @; 8ø80cH_aA(@8Hhx&x$|"|@* H_%A(cH/9`Pb0|#@AX|#@@ b`bh0| @Aah88!}!AaN H+-`KH+!`K|` @K89@"9ccD |߸*x $|H*HIE`bd, A,p`Ab , @H*`b| @b , @; 8ø80cH]A(@88Hx&x$|"|@* H]mA(cH-`Pb0|#@AX|#@@b`8p0bh|$@@$88`8K@KH)`K(H)`K|` @K8ȰbHi`K4K8ap8ȰHM`KH)A`KXH)5`K$| @hK0 A dbv_call``|aA`b|!a>c~8B"8c, !!~|`x$`|*A,pAT , @ H(9`| @4 , @;|wp@hz$8~ P|8apb:````!H`8|Ap;8ap~|8@@:K; 8ø80cHZA(@8p8xHx$|0*x&|"HZA(cH*`Pb0|#@AX|#@@b`8p0bh|$@@8;8bHZ`,A@b8;`w|@\8|~P{$|*c:`!H`8|A;b~|8@@:KbؓdHA(8c8x$| *H8U`ahH`8`8`hH`,Ahap, AHpAԈ , @(H%`| @ , @; 8ø80cHXA(@8pHx$|0*x&|" HXA(cH(`Pb0|#@AX|#@@ b`cp0bh|$@Accap88!}a!AaN H$`KH$`K| @K܈y, Ap`A؈ , @H$u`| @ , @; 8ø80cHWA(@88Hx$|0*x&|" HWeA(cH'y`Pb0|#@AX|#@@b`8p0bh|$@@ 88`8KKH#`K4H#`K|` @K8ȰbHe`KK\8ap8ȰHI`KH#=`KH#1`K| @,K A  prog_detach;;aA``!`x:aA!b?|8}&,&|xc$8!|*ApAb , @H"`b| @b , @8, Y@ 8|p@PP{ $:|{:8ap`!:H`8Ȱ8apH`8ap:|4@A; 8ø80cHTA(@8p8|Hx&x$|"|@*HTA(cH$`Pb0|#@AX|#@@ b`p0bh|$@@p8bc`|HQA({#$88|{*H`:z,Ac; 8b|@,~`;T~Pb]x$|{:````!t:ccHA((#@, :A , =@{,#:A ,#=@Ԡ|u P,ApX|e P,A`\|e P,AP`|e P,A@d|e P,A0h|e P,A l|e P,Ap|e P,At|e P,Ax|e P,A࠽||e P,AР|e P,A|e P,A|e P,A|e P,A|e P,A|e P,Ap|e P,A`|e P,AP|e P,A@|e P,A0|e P,A |e P,A|e P,A|e P,A|r P,A䠽|e P,AԠ|e P,AĠ|e P,A|e P,A|e P,A|e P,A|e P,At|e P,Ad|e P,AT|e P,AD|e P,A4|e P,A$|e P,A|e P,@X,=A(A }X|P,A}\|P,A}`|P,A}d|P,A\}h|P,A0}l|P,A}p|P,Aؠ}t|P,A}x|P,A}||P,AT}|P,A(}|P,A}|P,AР}|P,A}|P,Ax}|P,AL}|P,A }|P,A}|P,AȠ}|P,A}|P,Ap}|P,AD}|P,A}|P,A }|P,A }|P,A }|P,A h}|P,A <}|P,A }|P,A }|P,A }|P,A }|P,A `}|P,A 4}|P,A }|P,A ܠ}|P,A }|P,A }|P,A X, =A 8c;|8@AbbؓHA(8c8x$| *H,M`a`H}`8`Bp88cGc(9=z`H`|zy@bd, Atp`Ab , @PH`b| @b , @; 8ø80cHLA(@88Hx&x$|"|@* HLA(cH`Pb0|#@AX|#@@ b`0pbh| @A8`88!|!} Aa!AaN Hu`KHi`K|` @xKb<cE`c$H5A(,#Alb.?:xb8X@HIA(,Ax8fXHA(cEc$,b@HA(,#@cC`pH``x8`HI`c8zHiA(|wy@T"B89`bpc9dx $|H*H5`KXbc$bH%A(,#Ahx.?b~:8Xb@`H9A(,A8vXHA(bc$,b@HA(,#@4p AT"8 9` Bcbp9 d `x $|H*H4`K|bHyA(,AP8"Bc9bp x $|H*H4`KcHA(,Ab|@P,Abd, A p`Ab , @H`b| @b , @; 8ø80cHHA(@8|cHx&x$|"|@* HHuA(cH`Pb0|#@AX|#@@ b`0pbh| @Ac8KH`K4H`K|` @K 8"9`Bc9bPd  x $|H*H2`Kp8 9`"B8ݳ9 bpd x $|H*H2y`K 89` "B8ݳ9bpd hx $|H*H2)`KHA(:``p}``!|/3,LIA,8~r`@ |@88vX@U88ؐHA(c,A UK8 9`"B8ݳ9 bpd xx $|H*H1U`K|~48|HiA(|,A~48T>K8 9`"B8ݳ9 bpd xx $|H*H0`KdAt8X~c|`HqA(,@<8 9` "B8ݳ9 bpd hx $|H*H0]`K8}(8XH A(K89`"B8ݳ9bpd x $|H*H/`K89` "B8ݳ9bpd hx $|H*H/`KK89`"B8ݳ9bpd xx $|H*H.U`KAxx~8X|`HA(,@89` "B8ݳ9bpd hx $|H*H-`Kp8}(x8XHA(Kx8ȰbH1`K84bH`tK82bH`tKl80bH`tK@8.bH`tK8,bH`tK8*bH`tK8(bH`tK8bHu`tKd8&bH]`tK88HbHE`tK 8$bH-`tK8bH`tK8bH`tK8"bH`tK\8 bH`tK08bH`tK8bH`tK8bH`tK8bHm`tK8bHU`tKT8bH=`tK(8bH%`tK8bH `tK8bH`tK8 bH`tKx8 bH`tKL8bH`tK 8XbH`tK8bH}`tK8bHe`tK8bHM`tKp8bH5`tKD8bH`tK8bH`tK8bH`tK8bH`tK8bH`tKh8bH`tK:uK܈KH i`Kp,>KpH U`K4| @K@ C pipe_execute``aA`{|!}&|;aA}B"8c}, !!|`>x$8|*ApA , @H I`| @p , @X:|rp@Xz$8~P~`8ap````!:sH`8Ȱ8apH`8ap:|5@A: 8ø80bH<A(@8p8uHx$|0*x&|"H;A(bH `Pb0|#@AX|#@@ b`p0bh|$@@ L8b:8|@8TNB|vPx$`!~;ccH}-A((#@ , :A , =@ {,#:A ,#=@ |t P,ApX|e P,A`\|e P,AP`|e P,A@d|e P,A0h|e P,A l|e P,Ap|e P,At|e P,Ax|e P,A࠶||e P,AР|e P,A|e P,A|e P,A|e P,A|e P,A|e P,Ap|e P,A`|e P,AP|e P,A@|e P,A0|e P,A |e P,A|e P,A|e P,A|s P,A䠶|e P,AԠ|e P,AĠ|e P,A|e P,A|e P,A|e P,A|e P,At|e P,Ad|e P,AT|e P,AD|e P,A4|e P,A$|e P,A|e P,@ ,=A A ȠvX|P,A v\|P,A pv`|P,A Dvd|P,A vh|P,Avl|P,Avp|P,Avt|P,Ahvx|P,A<v||P,Av|P,Av|P,Av|P,Av|P,A`v|P,A4v|P,Av|P,Aܠv|P,Av|P,Av|P,AXv|P,A,v|P,Av|P,AԠv|P,Av|P,A|v|P,APv|P,A$v|P,Av|P,A̠v|P,Av|P,Atv|P,AHv|P,Av|P,Av|P,AĠv|P,Av|P,Alv|P,A@v|P,A, =ANB:|5@AbؓHw9A(8c8x$| *H`a`Hu`8`Bp88899 `H-`,,| A\ahA(pAԈ , @4HQ`| @ , @; 8ø80cH4uA(@8hHx$|0*x&|" H4AA(cHU`Pb0|#@AX|#@@ b`0pbh| @Aah88!|Aa} !AaN H-`KH!`KA(pAԈ , @H`| @ , @; 8ø80cH3!A(@88Hx$|0*x&|" H2A(cH`Pb0|#@AX|#@@ b`0pbh| @A8`8KH%`K@H`K8ȰbHx`K84bHw`~K82bHw`~K80bHw`~K8.bHw`~KX8,bHw`~K,8*bHwy`~K8(bHwa`~K8bHwI`~K8&bHw1`~K|8HbHw`~KP8$bHw`~K$8bHv`~K8bHv`~K8"bHv`~K8 bHv`~Kt8bHv`~KH8bHvq`~K8bHvY`~K8bHvA`~K8bHv)`~K8bHv`~Kl8bHu`~K@8bHu`~K8bHu`~K8 bHu`~K8 bHu`~K8bHu`~Kd8XbHui`~K88bHuQ`~K 8bHu9`~K8bHu!`~K8bHu `~K8bHt`~K\8bHt`~K08bHt`~K8bHt`~K8bHt`~K8bHty`~Kb8$Hta`~KT8ȰbHtI`~K(8ȰbHt1`~|P,AK@bcdHt`NKb8ȰHs`~KԈKH`KrKH`Kp| @Kx CXcmd_run```}aA!b?|c8|,%!Ax$8|!*Ap`Ab , @H`b| @b , @;`|ap@P{@$8ZP 8ap``!;9Hr`8Ȱ8apHry`8ap;{|;@A;b 8ø80ccH,A(@8p8{Hx&x$|"|@*H,iA(ccH}`Pb0|#@AX|#@@b`8p0bh|$@@8bHl`a`8|@d8|;P8Ȱx$a````!Hqa`;a`8,H"-`;a`8Ȱ|?@A;a`HmuA(8c8x$| *H `ah`HkI`8`Bp88899 hHa`,,| ATapA0pAb , @(Hy`b| @b , @; 8ø80cH*A(@8Hpx&x$|"|@* H*YA(cHm`Pb0|#@AX|#@@ b`0pbh| @Aap88!}!AaN Ha`KHU`KA0pAb , @H-`b| @b , @; 8ø80cH)IA(@88Hx&x$|"|@* H) A(cH!`Pb0|#@AX|#@@ b`0pbh| @A8`8KHA`K4H5`KKpH!`KXK`H `K|` @K( A asmcmd_exec``~aA`b|!?8"}!8c}B, |`x$|*ApA؈ , @H!`| @ , @|: 8ø80bH'EA(@8w8tHx$|0*x&|"H'A(bH%`Pb0|#@AX|#@@b`8p0bh|$@@8:|AXbx( A`b8zHmA(|vy@b|4@A,6@8]9`bp"9cyJ$e|P*H=`, APpAԈ , @,H`pA , @; 8ø80cH%A(@8~8Hx$|0*x&|" H%A(cH`Pb0|#@AX|#@@b`8bh0| @@\88`8`8!P}!AaN KHu`KHi`KЀ| @K88ap8dbpHl1A(,#@l8]9` bp"9cyJ$e`|P*He`, @,| @KH8apHfA(8o8|bHkA(,A`9`}8bp"9xj$cd|P*H`, ApKbHqA(,@8|@88b|;Px$|";d`!HcQ`ab8LHdA(,#@bHqA(;,AHa|?@@;{Ky, Ap`A؈ , @Hy`| @ , @; 8ø80cH"A(@88Hx$|0*x&|" H"iA(cH}`Pb0|#@AX|#@@b`8p0bh|$@@ 88`8KKH`K4H`K|` @K89`]b9p"cyJ$e|P*H `, ALKp8pHaq`8L{Hc A(8aHf`Kp, A@8apHoA(,@,8]9`bp"9cyJ$e|P*H `, AK8]b9p"cyG$ |8*H `, AHKlx8zbHgA(`vK:~8Dx$~*bHd`,@8bpKb8אHc`,@`;{`x$~*KdK0H`KH}`KT| @K\ A \ pwd_print``~`aA!b?|8}&,$|xc$8!1|*A pAb , @ H`b| @b , @ d;b 8ø80ccHA(@8{8tHx&x$|"|@*HA(ccH`Pb0|#@AX|#@@b`8p0bh|$@@ 88~A Hbx( A`c8zHeiA(|{y@b|8@A,;@8"9Bcb9pcx $|H*H`b, AhbpAb , @@a@8;K8 9"Bb8ܳ9 p cx $|H*Hi`b, AK;}8z`x$|*axH_A(|zy@l"B89b9p cx $|H*xH`b, AK4b<cE`c$H_!A(,#APxb8X```!HiAA(,bcEc$A H^A(,#b8X@Р4p Al"8B9 b9xp c`x $|H*H`b, AKPcCH^uA(,@8;]~@,K8 "9Bb9 xp cx $|H*He`b, AK89 "Bb9xp chx $|H*H`b, AKX89"Bc9bpc x $|H*H`b, ADK89 "Bc9bpchx $|H*H-`b, AKx8zcH\UA(`{K;]|8Dx$*ccHX`,A@8אccHX`,@;x$*KKPH`KH `Kd| @4Kp C  L cmd_print|aA;@!!!axb?c8, 8c|`x$|*ATpA؈ , @4H%`| @ , @;" 8ø80c#HIA(@8yxHx$|0*x&|"HA(c#H)`Pb0|#@AX|#@@b`8p0bh|$@@`8ax8zHZ%A(|wy@_8"9"pxc#yG$D|8*H`, APpAԈ , @,H`pA , @; 8ø80cHA(@8~8Hx$|0*x&|" HA(cH`Pb0|#@AX|#@@b`8bh0| @@\88`88!}!AaN KHݽ`KHݱ`KЀ| @Kb<b`cDHXyA(,#A<bx;$B@8xx;8cXx``!|80@H^A(,AH8uXHWA(cDb,b@HWA(8,#;8vX@bHWA(,@0|, Ap`A؈ , @Hܩ`| @ , @; 8ø80cHA(@8~8Hx$|0*x&|" HA(cH߭`Pb0|#@AX|#@@b`8p0bh|$@@ 88`8K̈KH`K4H۹`K|` @K9@8"9"pxc#Gyg$|8*H`, @\| @,Kx9@8"8۳9"pc#Gyg$|8*Hu`, AK9@8"9"pxc#Gyg$x|8*H`, A@K8<8tXH\%A(,@H9@8"9"pxc#Gyg$x|8*H`, AKKH`KH`K| @K A  file_printnr;;aA;`;@!`; ``aA!xp`qb|h`}&8<?`!1c, D|x$8|*AF!x@N! N0:z :bbdcH7`,#AԀ, A6.2*&c"=xa]}bȡx.6>F!@N! N0:z :Ab`8b#HM`,@,8@bbc8b#HM`,@,8@bbcb#8HMu`,@,8@:bc8b#HMI`,@bbcb#8HM!`,@,8@L:bc8b#HL`,@ bbcb#8HL`,@,8@:bc8b#HL`,@Pbbcb#8HLy`,@,8@:bc8b#HLM`,@bbcb#8HL%`,@,8@:bc8b#HK`,@bbcb#8 HK`,@,8@\: bc8(b#HK`,@bbcP8@b#HK}`,@bcbX8Lb#HKU`,@bcb`b#8(HK-`,@,8@P:(bcb#80HK`,@,8@:0bcb#8bccHMA(,#Ax~:`11b:@12~:;|A<.:bHGA(`nA: ~````!|q/1,LډA8~0@ |@88vX@ 88ؐHSA(b,A K89"Bb8ݳ9bp bcxx $|H*H`bd, A|p`Ab , @XHI`b| @b , @$; 8ø80cHeA(@88Hx&x$|"|@* H)A(cH=`Pb0|#@AX|#@@ b`cbh0| @Acc8`88!|} `hp!xAa!AaN H`KH`K|` @lK|}8|HQ}A(|,A}8T>K|89"Bb8ݳ9bp bcxx $|H*H`KA~ b8X|cHT}A(,A,bccHJA(,#@4p A\8 "9 Bb9  bpbc`x $|H*H9`K8cHIA(,@Dbd, A p`Ab , @Hi`b| @b , @; 8ø80cHA(@88Hx&x$|"|@* HIA(cH]`Pb0|#@AX|#@@ b`cp0bh|$@Acc8`8KH}`K4Hq`K|` @K 8 9 "Bb bpibcx $|H*H`K89 "Bb8ݳ9bp bchx $|H*H9`K88}(8XHQA(KPbHAA(`n(#@Xxb؀c|dyA|b؀c|dyAhb؀c|dyATb؀c|dyA@b؀c|dyA,b؀c|dyAb؀c|`y@b؀氂~yA~yA|}~yAp}~yAd}~yAX}~yAL}~yA@}~yA4}~yA(}~yA}~yA}~y@4b؈ , :@$, :@(.Ab,/@ 801~y@ 802~y@ 803~y@ 804~y@ 805~y@ 806~y@ 807~y@ 808~y@ 809~y@ 810~y@a~y@Ab؈, @80`e8a8p HAE`,Acz,9@8vX8b%HKA(,AcybH?A(`nKp89"Bb8ݳ9bp bcxx $|H*H`KK(8 8cHBA(,#A,/@KcW>Kx"89Bb9 bp bcx $|H*HQ`KPbH>A(`wKbH>A(`wKcvHA A(,AxbH=A((#@db8ap8HKe`8r(8h}tv;@:ݲ` ; ~aAH K@:8`8x$| *Hm`b0B8Xss s XsssHsH ,`@,A,8@:TbcK4xH?A(,@Ps,$A c88Hi``tKHc88HI``tKcHA(,@Pt,$A c88H5``tK@c88H``tKcH;A((#AK8Kh8`8dx$| *H`0b8Xtt t XtttHtH *`@,Atc,#@X,8@bcKxbcH=IA(,AcH:A((#AbcH=!A(,AHcH9A((#@4c8ap8HG}`8}hr;@tva~K8<8Hy``tK<8KxH@|`4TA:@@,:@<2{4|a6ûL:8ax8|8H A(8ax8bH`,#AH.4`u: ````!abF8pbHy``sp,8axbAb,&AxHI`,p,AÛ{Đx" (@(**A|LB ADz@"AĐ (@(**@<=(H1mA(`rK(8axbbH`8x 8P,bAH aA(@8bx&| *H AA(8bHU`8ax8@c%H'A(8 ,#8axAH%iA(|uy8axAdbH$A(88ax8bH`8X|uyADaDH#`|`4>@TA:@@KûLH!A(8w8|K4"p AL?89@ bcF9Dy)$`|H*HI`K8 8b8ø8dbH A(@HcE8bx$8cx&|0*|" H A(8bH`P|6@AX|6@@ b`bhK :8|~H uA(KD@X b8P8xH EA(@H8bx&|" H A(8bH1`abH`,Axb8axbH`,A\}, Ap`AЈ , @HM`| @ , @ 8b8ø80H uA(@8H8b8cx$| *x&| H =A(8bHQ`Pb0|#@AX|#@@ b`bh0| @A8`8KXHy`KDHm`K|` @K ATK8ƬcCHIA(,#@(8zcCH#A(|yy@L"8BbcF9x$ |8*H]`K8ax8c%H#A(,#@4p AP8"9` BbcF9x$i`|8*H`KH8 8ø;"8dbc#H ەA(H@8ycEx$x&|0*|" H YA(c#Hm`P|6@AX|6@@K8ax8 H A(,#A`u8cHA(8,3@X<8`[Đa!!((*A :K H+uA(`r:K8@8`KûL8axH}A(8w8|K|8a|cDHe`,5@ ûLKbH A(KxKH`KpKH`K| @K"C \ file_chop|}&ۡہ=E0`HA`<`W$`e< b`8h@I|(}X*}J^p}Jy@dyKMyL&|XP| P|T |8|:a|.p|Zpx&|8Pxd|:xH ]A(H@8bx&|" H 5A(8bHI`K 89`"Bc#89ix$|8*H`K<(, @0@K(, AK8a b8c'|8 H`;Z,A8 x"a (@(**K8(K@Kt8a9|P|Ěp9|c||Px9!9AH``|,,Ah/A@H@8ø8b8Uc&x&|:<ʠH A(8bH `P|9@AX|9@@K8aH}A(,#@9`8Bc#"9dx$8|8*H`K?@8 KL>@8 KcHA(x`UdxwU,@Pc8/HA(,#~@ bK8cHA(x`UdxcU,A\TP*K\TP*K@@P: KH`K@: #K8b8XH`,A@A? @88|x$| *Hu`8`xb,@ T~:~8x$| *H1``v.5A8aHA(,#Aa c8 8cHHQ`,AP( A0( A|,5AL,A:|A-þÞ~:X ~:ZMJPB``!9 9 a }bE8cHH`/,A,4|x"A8|PpL*A|/ MJA@la!a(@(**A 8x88DH`,@:PbC8bdbb&p899!9^H``},A ,@a|A,A ,@a(bcGHܵ`,A *;@|xz|x*x",c x,A@:~|~@pH@8ø8Y8bcFx&|:< H A(8bH`P|:@AX|:@@ b`bhKcKH@8ø8X8bcFx&|:<H A(8bH`P|:@AKa cEH}`,Ada(cEHa`,A4@, A@bd, Ap`Ab , @H`b| @b , @; 8ø80cH A(@8}8Hx&x$|"|@* H qA(cH`Pb0|#@AX|#@@ b`bh0| @A8`8KLH`K8H`K|` @K; 8ø8cFcH A(H@8|x&|"C`H A(cH`P|:@AX|:@@K8aH %A(,#A aH A(8`!W8>Hy`<`W $`e< b`8@i|(}X*}J^p}Jy@dyKMyL&|XP| P|T |8|:a|.p|Zpx&|8Pxd|:xH A(H@8bx&|" H mA(8bH`K,8"9`BcC89 dx $|H*H-`K0, @$@K, AK 8Kl8|ÈPp|899!9^Ȑ|d|PH=``},A0,@Ԁa|c"a|*Ka||e"aK`}8Ka(bEbfcGH5`,A4;{a *KH@8ø8[8bcFx&|:<`H A(8bH`P|:@AK@KDH@8ø8W8bcFx&|:<H iA(8bH}`P|:@AxKhH@8ø8Z8bcFx&|:<@H A(8bH-`P|:@A(K:~KH@8ø8V8bcFx&|:<H A(8bH`P|:@AK8"9`BcC89 dx $|H*Hq`Kt:Kc8XH`,AcHA(x`UdxcUTv>,Ap,6@\b0\TP*b.c8/HEA(,#A8cHeA(x`UdxvU,Ab0\TP*K~.K|:T>K0c8X\`TP*TP*.HI`|`4T~hKlKXH`KBpKHH`KP|` @K\"Cfile_uncompress|`;aA!; ;aA!!!Bba`b>C~88c~, |`x$|*ApA , @H~`| @؈ , @(?8ҲAc8ap8`H A(: 8ø80bH A(H@8w8px$x&|0*|"H A(bH`Pb0|#@AX|#@@ b`p0bh|$@@8a`8zHA(,#AX`w,?@bx;:Xb<b`bHA(,#A"```!8bHA(,#@p4b؈, 'A(,9A; 8HMA(,#A,8A4;bbHaA(,AHbHA(,@bbbHA(,#@d4p A~9@8 "p9`cGyg$`|8*H`, APpAЈ , @,H|e`pA , @; 8ø80cH A(@8}8Hx$|0*x&|" H UA(cHi`Pb0|#@AX|#@@ b`bh0| @A8`88!}!Aa!AaN H{I`KH{=`KЀ| @KbH=A(,A\8^"9p`cyG$|8*HM`, AKK8HA(`s88|`*HU`|`4T~||8|tKc8\HA(,#A `vK$8^9`c9p"cyJ$e|P*H`, APK8^9"p`cyG$|8*H`, @| @xKȈK(Hw `KXHw`K,| @ K4 A log_purify|}&aA`!a?G8 a`b,$8|xc$|*ApAhb , @dHv1`b| @@b , @$NA(?8ڲAc8ap8`H EA(; 8ø80cH !A(@8~8pHx&x$|"|@*H A(cHx`Pb0|#@AX|#@@b`8p0bh|$@@H8a`8zHA(,#A`~,?@bx;;Xb<c`cHA(,#A;` bH)A(88T>|||8, @x8,#|0|2, L3BA(``!8T?, @x8@|d| , A88b|8|c!|)cbHiA(,cAHA(,bc@8cHA(,#@4p A"8B9 b9`p c`x $|H*H`b, A\bpAb , @0HsY`bpAb , @; 8ø80cH uA(@88Hx&x$|"|@* H 9A(cHvM`Pb0|#@AX|#@@b`8bh0| @@P88`88!|Aa} N KHr9`KHr-`Kb| @KcH)A(,Al8"B9b9`p cx $|H*H-`b, AxKcHA(,@Pbd, A,p`Ab , @HqM`b| @b , @; 8ø80cH iA(@88Hx&x$|"|@* H -A(cHtA`Pb0|#@AX|#@@b`8p0bh|$@@$88`8KKHpU`K(HpI`K|` @K89"Bc9bpcx $|H*He`b, AKT89"Bc9bpcx $|H*H`b, AHK89 "Bc9bpchx $|H*H`b, AK|Kc8\HA(,#A `}K89"Bc9bpcx $|H*H`b, APK8"9Bb9`p cx $|H*H`b, @b| @tKKHm`KNBAKHm`K| @K C  cut_blanks``|aA`!;:|aA}&!~B">8c!8~|cxc$,$8|*A pA8 , @Hl`| @ , @8`|`a@P~ Px$:`|:8a`!:HY`8Ȱ8aHI`8a:s|3@A: 8ø80bH uA(@88uHx$|0*x&|"H AA(bHoU`Pb0|#@AX|#@@ b`p0bh|$@@8b0H`8,ptx|A:b0bc ,#A4 H4i`b0c(,#@b0 (b0cH,#@b0 Hb0X, @ Xb0`, @H`b0, @ b0, @b0, @8aHA(,#A8aHA(B8p"b |v8 * | v8lH ]A(r~;P,@0zC$8|*H`,@;{r~;P:8`8x$| *H`08.8ְdd d XdddH@888.p@ 0t8.x@|88,7Axy, A\p`AԈ , @9@8ֳbp9Dy)$x|H*H}`K8XHߕA(,A8>8ֳ9bpy)$|H*H%`K,@HT`,A,08v$88H~`,A T>K:K;K8|x$|*H)A(0;{8`e8h8vH~I`~,AdzW 8b0c,#@Bx~8l8rXHuA(,@T8>9@8ֳbp9Dy)$x|H*H`8K8rXH A(,@|Pr.Kd8>8ֳ9bpy)$|H*H`8KHR`,8A088v8H}`~@,AT>K:K:@K8|x$|*HuA(08|8`eh8vtH|``r"x~8\8qXHA(,A~,;{Ax 8qXHܽA(,@|Pr.K8>8ֳ9bpy)$|H*H=`8K48K89@"8ֳ9bpx$Dx|8*H`8K8|x$|*H)A(08x8`eh8v8H{M``r"xz8L8qXHA(,A~,;{Ax 8qXHqA(,@|Pr.Kx8>8ֳ9bpy)$|H*H~`8|K8K|89@"8ֳ9bpx$Dx|8*H~`8|KzC$8,|*H!`,A8tAzC$8<|*H`,@8|x$|*HՑA(08|`rx$e| *HmA(0;{~E8t8h8vHy``rspH`,#A, @ s0| A`HA`~,A,Ax b0C ,2A|"0```!8s8H``d8aH`8apH`||ex|v,#A ,A|8R~@y@Bxv8@8rXHA(,@d8 >9@8ֳbp9 Dy)$x|H*H|}`8x|Kl8rXH}A(,@r~;PK8 >8ֳ9 bpy)$|H*H|`8x|K8v88t8Hw`~,A x K:K8K<8K,~,A||c#x|cv|8T>K8||c#x|cv|8T>K8|x$|*HҽA(08|`rx$e| *HҙA(0;{~E8p8h8vΰHv``rspH`,#A, @s0| A`HM`~,A,As088XH=``d8aHM`8apH]`,#A,A ||`x|v|8T>Bxr808rXHMA(,@h8 "~9@8ֳ9 xg$bpDx|8*Hy`8tx|K8rXHA(,@~;Pr.K88 >8ֳ9 bpy)$|H*HyM`8tx|K808vΰ88p8Ht`~,A x K:K:KT:KD~,A||c#x|cv|8K,8||c#x|cv|8KzC$8|*HU`,AP8AzC$8|*H-`,A8AzC$8|*H`,@8|x$|*HϝA(0;{@8`e8h8vHs`~,AtzW b0c,#@Bx8 8rXHA(,@l89@"8ֳbpx$9Dx|8*Hwy`8ptx|K`8rXHqA(,@r~;PK8 >8ֳ9 bpy)$|H*Hv`8ptx|K@HHE`,A08v88Hr]`~@,A T>K:K:@K8|x$|*HA(0;{dD ,2Ah"0```!rpH)`|,#A,A|`x|v|`8T>R~@y@b0c |`y@Bx88rXHA(,@p89@"8ֳbpx$9Dx|8*Hu`8ptx|Kd8rXHuA(,@~;Pr.K8>8ֳ9bpy)$|H*Ht`8ptx|KcHF=`,A088v8HpU`~,A x K:K8v88Hp`~,A x KL:KD8|x$|*HˡA(08`dfsH`Bx8`w8rXH!A(,@t89@"8ֳbpx$9Dx|8*Hs`8ptx|K88rX|4;{8THρA(,@~;Pr.K88ֳ"9bpx$|8*Hs`8ptx|K8>9@89bpDy)$|H*Hr`@88`KDYK 8aH!`b0K\ 8aH`b0K 8aH`b0K 8aH`b0`K 8aH`b0XK` Ha`K0 HM`K8`8x$| *HSI`0d K簈K8HR`K(HR`K| @K Cbrtlog_cleanup|``aA`;!`;`!1?F8(axb,$8|xc$|*A8pAb , @HQ`b| @b , @8ac8dxcH A(; 8ø80cH A(@8x8Hx&x$|"|@*H }A(cHT`Pb0|#@AX|#@@ b`p0bh|$@@8b0H%`:,pAb0c,#@b0c,#@8axHաA(,#A,8axHA(B8p"b |v8 * | v8lH yA(,9@axHA(88`y8`x$| *HyQ`088O8xx x XxxxHxdHu`8P8ddHu}`8Q8ddHuY`8R8ddHu5`8S8ddHu`8T8ddHt`8U8d dHt`8V8d(dHt`d0x8b88X8cHty`d@p,$@hbc,#A@,$@(`d%8z8p8Hh%``,A x , A\,$A `H=`,A8%8z8p`8Hg``,A x ,$@ <,$@ ,$@  ,$@ d(,$@ 0,$@ br, A8,$@ bcP,#A@8,$@ @`d%8z8p8Hg ``,A x e@,#@ bcx,#A4@,$@ dPH`,#A,A b0,?A\>````!pH`|,#A,A |`x|v|`8T>y@b0,?A`>``!8z88Hr``d8ahH!`8ahPH1`,#A,A8z88Hq``d8ahH`8ahPH`,#A,AD8z88Hqy``d8ahH`8ahPH`,#A,A8z88Hq-``d8ahH=`8ahPHM`,#A,A<8z88Hp``d8ahH`8ahPH`,#A,A8z88Hp``d8ahH`8ahPH`,#A,A48z88HpI``d8ahHY`8ahPHi`,#A,A8z88Ho``d8ahH `8ahPH`,#A,A,8z88Ho``d8ahH`8ahPH`,#A,A8z88Hoe``d8ahHu`8ahPH`,#A,A$8zL88Ho``d8ahH)`8ahPH9`,#A,Ay@xr88XH1A(,@8"B9b8ڳ9bp xx $|H*Hf`bd, APp`Ab , @,HG`b| @b , @; 8ø80cH { A(@88Hx&x$|"|@* H zA(cHJ`Pb0|#@AX|#@@ b`p0bh|$@A8`88!}!AaN HF`KHF`K|` @K8XHUA(,@L,;Axbd, A p`Ab , @HFe`b| @b , @; 8ø80cH yA(@88Hx&x$|"|@* H yEA(cHIY`Pb0|#@AX|#@@ b`p0bh|$@A8`8KtHEy`K4HEm`K|` @K 8"9Bb8ڳ9bp x $|H*Hc`K8z8hc8p8H_-``,A T>K8;`K08z8hc8p8H^``,A T>K;`K8z8hc8p8H^``,A T>K0;`K(8z8hc8p8H^``,A T>K;`K8z8hc8p8H^M``,A T>K(;`K 8z8hc8p8H^``,A T>K;`K8z8hc8p8H]``,A T>K ;`K8z8hc8p8H]``,A T>K;`K8z8hc8p8H]m``,A T>K;`K8z8hc8p8H]5``,A T>K;`K8z8hc8p8H\``,A T>K;`K8zc8p8H\``,A x Kd;`K\8z%8p8xH\``,A x K;`KH2%`,AbcxKPH`,#AT,@H8z%8p8@H\``,A x K;`K 8KH1`,AbPKK8z%8p8H[``,Ax KX;`KL8z%8p8H[u``,A x K;`K8z%8p8H[A``,Ax K;`K8z%8p8H[``,Ax Kt;`Kh8z%8p8HZ``,Ax K,;`K 8z%8p8HZ``,Ax K;`K8z%8p8HZQ``,Ax K;`K8Kt8KH/`,AbKK8z%8p8HY`8|48TKp8c#H`|`4bTA8KL8"8Bb9bp) y)$|H*H]`@88`K/UKx H!`KL H `K$KH>`KH>`K| @K A oratrc_cleanup```}`aA;`!aA!xpb?G|c8}&NB,&|x$8!|!*Ap`Ab , @H=`b| @b , @;" 8ø80c#H pA(@8y8tHx&x$|"|@*H pqA(c#H@`Pb0|#@AX|#@@ b`cp0bh|$@@8|@pbP"X;p:@Hb`} @Bh}@`!8֬z0$}}߀*aH`,@L~;|A@t , A , A, @,b8cx(A8b08bd, A|p`Ab , @XH;`b| @b , @$; 8ø80cH nA(@88Hx&x$|"|@* H nA(cH>`Pb0|#@AX|#@@ b`cp0bh|$@Acc8`8 8!|px} !Aa!AaN H:`KH:u`K|` @pK; 8ø8pccH mA(H@88װ8רx&|"@H mqA(cH=`P|=@AX|=@@ b`cbhc8bd, A p`Ab , @H9`b| @b , @; 8ø80cH lA(@88Hx&x$|"|@* H l}A(cH<`Pb0|#@AX|#@@ b`cp0bh|$@Acc8`8KH8`K4H8`K|` @K ; 8ø8pccH kA(H@88ל8רx&|"@H kA(cH;`P|=@A@X|=@@;K4a8XH`,@~=;Ka8`H`,@~ ;Ka8hHq`,@~;Ka8pHM`,@~ ;Ka8xH)`,@~ ;Ka8׀H`,@H|P,;A0o, -A x$|*HA("@;qK$a8׈H`,@L|P,;Ao, -Ax$|*H%A(wL;dKa8אHI`,@L|P;,A,o, -A;x$|*PKtb PKda8הH`,A;b , -@d8b8øp8H aA(8bb&|*x&8c| H aA(8bH1`Ap| @@K8b8ø8pH aqA(8bb&|*8cx&|@H aIA(8bH1]`LJpBAKKH-`KPH-`K|` @K( C conv_opt_read|`;aA;;!!!>8axb,$8|xc$|*ApAb , @H,`b| @b , @t;b 8ø80ccH _A(@8{Hxx&x$|"|@*H _A(ccH/`Pb0|#@AX|#@@ b`p0bh|$@@8ax8zHA(|{y@"B8b9xp) cy)$|H*HJ`b, A\bpAb , @0H+M`bpAb , @; 8ø80cH ^iA(@88Hx&x$|"|@* H ^-A(cH.A`Pb0|#@AX|#@@ b`bh0| @A8`88!}!AaN H*-`KH*!`Kb| @Kb8ceHA(,#Ap;@; ;`!,>A,,<b@8'bHqA(|wy@,7@\8bceHA(,#@4p A|"8B9 b9xp c`x $|H*HG`b, @b| @KccHA(,@Dbd, A p`Ab , @H(`b| @b , @; 8ø80cH [A(@88Hx&x$|"|@* H [A(cH+`Pb0|#@AX|#@@ b`p0bh|$@A8`8K`H'`K4H'`K|` @K 8"9Bbxp cx $|H*HE`b, AKdKd:!!}8@`"`"a"|` !| At, @~a"xdd8" | ., |&| "(A::`b:@: :pA , @!, 8 |@8y$h"`"0|p*HA(,#Ah"8A!-1"P"X`x$,*"`!"hb|*;!!"p`:^`n"8`o&!"@}`&a"H``!8a"@ZD`8:|ax9@p.H'`~`x,A$ar@pzؐ~`&~h @Pz$:(@T!, @Hb08ø8H EA(@H ؐbCa!Hx&|!HH EA(bH`Ab0X|#@@ b`c|.x@@c`b8ø08H E9A(@HbCx&| H EA(bH%`Ab0X|#@@ b`c|.x@@8c`,?@;,A!, A!| @;b`h:!a!:P8cP":cA!bcB````!HyA(,A|@D8;:|?@@s:sKA!a!!, dAp`A , @Hy`| @ , @b8ø08H CA(@bC8Hx$|0*x&|" H CiA(bH}`A0bX| @@ b`c|.x@Axx8`8KH`KXH`K(|` @K48 9bPx$|8*H-`K!p8G8H5``dbH`bPH)`,A!| Alt, @``8`8 b|8x$|0*H`,A 88a" !| |!.A Kl8 `8`|bx$8|0*H`" ,|dAKb@,@c`K0K̈KH8b8cd8l8H AuA(b8ø08H AYA(b@H~h x&|d@|:bC!!X8d!XH AA(bH%`Ab0X|#@@ b`c|.x@@c`}!K}!Kp K$KؐKKpb8ø08?H @A( ؐ@HbCbea!(!A!8@Аx&|!(!8H @EA(bHY`Ab0X|#@@K8 b889 "BbPx$|8*H*`K$Kl@K\: 8b89 "#bPx$|8*H*`KKbpP}#@KKpb8ø8H ?1A(@bCa"x&|脱 H ? A(bH`bpP|#@AX|#@@Kb@,@c`K!"Pz $~pHE`b:Up,@K`crVR>KTH9`KbH `KaH|qA(|"`|x|Aa"|PKbp"XP~# @pA`} ,#@H@Hb8ø8px&|:#`H 9A(bH `ATK@H}`Kb8øp8H 9A(@H8u;"8|*x&|""H 9A(bH `ApbX| @@ b`cxbH u`K,aH{=A(|`Hb@a}z, @,$ x&@,' |@@H 8A(bH`n, ^@ 8 ,#^@ 8 ,$^@8 @KH-`K8`pA} ,#@!, LJAb8ø08H 8=A(c|*@x&| *H 8A(bH1`0Pcqc`X`bp|&8@|@@`LB0BAe|$@AMKH]`KT,#LJAKT,A,@ctV>Kh,2A -1KXbp8ø8H 7aA(c|*@x&| *H 7AA(bHU`pXcrcqb`x| @LNBAc-1K, A -1KbP8ø8H 6A(c|*@x&| *H 6A(bH`c`csPpb`cq|$(@cAK09b8ø8ȑbH 6UA(@y$8u"H`8׸Bx$b} *x&|(*|H 6 A(bH`0bPX| @| @LB0BA b`cb0p|#@@c`KᘈKHI`Kl8, Kh8H-`,A\K`,@cdK$8 8ø;"p8dc#cH 55A(H@8y8x$x&|0*|" H 4A(c#H `|?@hALX|?@@HK<Pb`::@a!pA!x:P``!,?bdA48G8H'i``d`Htu`vPH`:,8`AH8H`;u,:A:||@@@Kd,@c`K9@~8"89bpGyg$|8*H`Kx8>89bpwy)$ |H*H`K8`H`K$!K|A!KKH`KH`K| @ۨK"C0& conv_process;;aA;`b|!}&; ?aA8ش(!xp~B8c~, !|`x$|*A8pA , A H`H`| @H | @Ј , A H`: 8ø80bH 1A(@8w8Hx$|0*x&|"H 1A(bH`Pb0|#@AX|#@@ b`p0bh|$@@ 8H}H}X8@<`ye0H@:cs: E: } @9DBh| @ xb,@ pƈpp,$A8dHU`H8axb88'8cH#q`8d`daxH`pHpm`pHp]`p, AƒƐHcp,A #HpHp `ppp,$A8dH`H8ab88'8cH"`8d`daHM`p Ho`p(Ho`p0, AƚƘHcp8,A #Hp@Ho9`pPppX,$A8dH~`H8ab88'8cH!`8d`daH~}`p`Hn`phHn`ppHn`px, AƢƠHcp,A #HpHnY`ppp ,$A8dH}`H8ab88'8cH `8d`daH}`p(Hm`p0Hm`p8Hm`p@, AƪƨHcpH08ƬH -A(pP,A #HpXHma`pHppP,$A8dH|`H8ab88'8cH`8d`daH|`pXHl`p`, AƲưHcphƸƺpp,A #HpxHl`p pp ,$A8dH| `H8ab88'8cH%`8d`daH{`p Hl!`p Hl`p Hl`p Hk`pHk`pHk`p, A HcpȈʰp ,A #Hp(Hki`p`pph,$A8dHz`H8ab88'8cH`8d`daHz`ppHj`pxHj`pHj`p, AҠаHcp؈ڰp,A #HpHju`p0pp8,$A8dHy`H8ab88'8cH `8d`daHy`p@Hj `pHHi`pPHi`pXHi`p`Hi`phHi`ppHi`pxHi`pHi`pHiy`ppp, AHcp8Ƭ0pH ) A(p,A #HpHh`ppp ,$A8dHxY`H8`nb88'8cHu`8d`daHx!`p(Hhq`p0Hha`p8HhQ`p@HhA`pHHh1`pPHh!`pXHh`p`Hh`phHg`ppHg`pxp, AHcp8Ƭ0 pH 'yA(p,A #HpHgM`8--<--b8-=|*8--8-JHNP,@8-QH 8+Qx b8x|" 8`88 8H899 HH`,A,A,@,H׽,A,A8+;`I@ K,@,H,Ad,At8+;`J@Kd,@,H,A4,AD8+;`K@K4,@,H-,A,A8+;`L@|K,@,H,A,A8+;`M@LK,@,H,A,A8+;`N@K,@,H ,At,A8+;`O@Kt,@Mc;@KX, b@b8x&| *He``uaH!`a09V@8ø8x&|8*H $A(aH`0P|.@LBpBA b`0bp| @@ cHbPH`8+QA,@8`888899 HF-`,A@,@,9@8+;`PHa8ø8dpH $A(8u8(bx&x$||0* H #A(aH`pbP| @AbX| @@H,;z,|` @A0p`AԈ , A H `H`| @ , A H`b8ø08H #%A(8u8x&x$||0* H "A(bH `0bP| @AbX| @@ b`0bp| @A8`8HA0p`AԈ , A H`H`| @ , A H`b8ø08H "5A(8u8x&x$||0* H "A(bH`0bP| @AbX| @@ b`0bp| @A8`8Hc}K,@08xDH(I,A,A8+;  @K,@08xLH(,AL,A\8+;  @KL,@08xĬH',A,A(8+;  @K,@08x H',A,A8+;  @\K,@08xH'y,A,A8+;  @(K8b8ø8dpH qA(8u8bx&x$||0* H =A(bHQ`pbP| @AbX| @@ b`z, A8p`A , A H}`Hu`| @H |` @ , A HI`b8ø08H A(8u8x&x$||0* H ]A(bHq`0bP| @AbX| @@ b`0bp| @A8`8`Z8!P|px} !Aa!AaN CD inst_man_menub;;;;|aA}&!?g;[aA!xp8, !|x$F*A@pAb , A H9`H1`b| @H | @b , A H`;" 8ø80c#H 9A(@8y8Hx&x$|"|@*H A(c#H`Pb0|#@AX|#@@ b`p0bh|$@@ 8H}H}X8@<`ye0"H@:#s:E: }@9D`bhB| @ b,@ rƈpr,$A8dHk`H8axb88'8cH`8d`daxHk`rH[`rH[`b, A{bd`H$r08ƬH A(r,A HrH[U`rpr,$A8dHj`H8ab88'8cH `8d`daHj`rHZ`rHZ`b, A{jdhH$r08ƬH A(r,A HrHZe`rpr,$A8dHi`H8ab88'8cH `8d`daHi`r HY`r(HY`b0, A{rdpH$r808ƬH A(r@,A HrHHYu`rpr,$A8dHh`H8ab88'8cH `8d`daHh`rHY`rHX`rHX`bЈ, A{zdxH$r08ƬH A(r,A HrHXu`r pr ,$A8dHg`H8ab88'8cH `8d`daHg`r HX`r HW`r HW`r HW`b , A{ՂdՀH$r (08ƬH A(r 0,A Hr 8HWe`rpr,$A8dHf`H8ab88'8cH `8d`daHf`rHV`rHV`rHV`b, A{ՊdՈH$r 08ƬH A(r(,A Hr0HVe`r0pr8,$A8dHe`H8ab88'8cH`8d`daHe`r@HU`rHHU`rPHU`rXHU`r`HU`rhHU`rpHU`rxHU`rHUu`rHUe`rՐՒrr, A՚՘H#r08ƬՠբrH A(r,A HrHT`rpr ,$A8dHd=`H8`ob88'8cHY`8d`daHd`r(HTU`r0HTE`r8HT5`r@HT%`rHHT`rPHT`rXHS`r`HS`rhHS`rpHS`rxըժr, AղհH#r08ƬոպrH YA(r,A HrHS-`8--b<--8-=|"9--206,@8-8H 8+88-=y bx8|"8`8880899 H4`,A,AL,@,HBA,Ax,A8+;1@K ,@,HM,AH,A8+;2@K,@,HY,A,A8+;3@xK,@,HeQ,A,A8+;4@HK|,@,Hqa,A,A\8+;5@KL,@,H},A,A,8+;6@K,@Mc;@K,b@b8x&| *HQ%``vaH5`a09V@8ø8x&|8*H A(aH`0P|/@LBpBA0bp| @@ cHbPH`8+8A<,@08`888899 H2E`,AX,@$,<@8+;7c}K,@08{TH,A,A8+;@xK,@8{\H,A,A8+;@DKxa8ø8dpH A(8vcEx&| x$|8*H qA(aH߅`pbP| @AH| @@DH<,=bd,|` @A8p`Ab , A Hۥ`H۝`b| @b , A Hu`b8ø08H A(8v8x&| x$|@*H A(bHޙ`0bP| @A | @@0bp| @A8`8H@A8p`Ab , A Hک`Hڡ`b| @b , A Hy`b8ø08H A(8v8x&| x$|@*H A(bHݝ`0bP| @A | @@0bp| @A8`8HD,@08{ĜH,A,A8+;@tK,@08{ĤH,A,A8+;@@Kt,@08{ռHu,A,AP8+;@ K@8b8ø8dpH mA(8v8x&| x$|8*H 5A(bHI`pbP| @A | @@bd, A@p`Ab , A Hq`Hi`b| @H |` @b , A H5`b8ø08H yA(8v8x&| x$|@*H EA(bHY`0bP| @A | @@0bp| @A8`8PJ8!@|px} !Aa!AaN C spac_man_menu;;aA;`b|!}&;>aA8H!xp~B"8c~, !|`x$|*A8pA , A H=`H5`| @H | @̈ , A H `: 8ø80bH EA(@8v8Hx$|0*x&|"H A(bH%`Pb0|#@AX|#@@ b`p0bh|$@@ 8H}H}X8@0<`exH`bc`H>`bchH>`bcpH>`bcxH>`bcH>`bcH>`bhjc, ArpHbx8ƬzcH A(b,cA8EH 8DbcH=`bpc ,$A8dHMM`H8`ob88'8cH i`8d`daHM`bc(H=a`bc0H=M`bc8H=9`bc@H=%`bcHH=`bcPH<`bcXH<`bc`H<`bchH<`bcpH<`bԀԂxc, AԊԈHbԐ8ƬԒcH AA(b,cA8EH 8DbcH<`b9--8--<--8-=|*<> B,@8-DH 8+Dby 8x|" 8`8888<99 HQ`,A,At,@0Hs,A,A8+b;`=@K,@0H,A,A8+b;`>@K,@0H,A,Ap8+b;`?@K\,@0Hu,AL,A<8+b;`@@XK(,@0H,A,A8+b;`A@$K,@0H,A,A8+b;`B@K,@Mc;@K,bo@8`d bcx&| *H9``saH`a09V@8ø8x&|8*H A(aHɹ`0P|/@LBpBA b`0bp| @@ cHbPHձ`8+bDA,@8`888899 H`,A,@(,8@8+b;`Cc}Kt,@48wdH,A`,AP8+b;@lK<,@8wlHQ,A(,A8+b;@4Ka8ø8dpH IA(8s8Hx&x$||0* H A(aH-`pbP| @A| @@H,;y,|` @A0p`Ä , A HY`HQ`| @ , A H1`bc8ø08H uA(8s8x&x$||0* H IA(bcH]`0bP| @A | @@ b`0bp| @A8`8HA0p`Ä , A Hq`Hi`| @ , A HI`bc8ø08H A(8s8x&x$||0* H aA(bcHu`0bP| @A | @@ b`0bp| @A8`8H,@48wtH,A,A|8+b;@Kh,@48w|H},AT,AD8+b;@`K0,@48wĄHE,A,A 8+b;@(K,@48wČH ,A,A8+b;@K,@48wĔH,A,A8+b;@K8bc8ø8dpH A(8s8Ԕx&x$||0* H A(bcHĭ`pbP| @A | @@ b`y, A8p`A؈ , A H`H`| @H |` @ , A H`bc8ø08H A(8s8x&x$||0* H A(bcH`0bP| @A | @@ b`0bp| @A8`8`Z8!P|px} !Aa!AaN C\ seg_man_menu;;;aA!aA!b?|xp}&8,$|xc$8!|*xA%pA%pb , @%hH`b| @%Hb , @%,;b 8ø80ccH A(@8{8Hx&x$|"|@*H A(ccH`Pb0|#@AX|#@@ b`p0bh|$@@$8}8@`uH0PH.e`uP0H.Q`P8bH2`,@ h|pPb8H1`,@  |ĐpPb8HH1`,@<|DpuXH-`b0`,.Ax8 aH2A(,#AH8"08bu`H q`u`8H3`uhH-Q`upH-A`ux u #u , Au 0u 0H,`u  "(*02<8u :u u #u ,Au (H,a`ut|pu,$A8dH;`u0JLuH,`8bH/`,@<|pb8H/`,@ |Đpb8HH/y`,@<|Dpb0,.A\8 aH0A(,#A,8"08buH 5`u8H0`uH+`u08ƬH A(uܸt|uuPuX, AB@u`0HJuh0H*`up08ƬrH iA(uxPRu,A uH*1`u 00H*`u 8p,$A8dH9`u @H)`u HH)`u P0H)` P8bH-`,@|p Pb8H-e`,@ |Đp Pb8HH-9`,@t<|Dpb0 X,.A<8 aH.A(,#A 8"08bu XH `u X8H.`u `H(`u h08ƬH A(u pXZt|u xuu, Ahb`u0hju0H(A`uؠpru,AuH( `u pcCpu x,$A8dH7}`u H'`u 0H'`u u , A@xzu 08ƬҀ҂u rH ]A(u ҈Ҋu ,Aزu H'%`u cCpu ,$Al8dH6`u H&`u 0H&`u u , AҐҒu 08ƬҘҚu rH }A(u ҠҢu ,Au H&E`u cCpu ,$AD8dH5`u H& `u ܼJLܸu u , A䈜ҪҨu ҰҲҸҺu u ,Au H%q`u #pu (,$A(8dH4`u 0H%5`u 80H%!` 88bH(`,@|p 8b8H(`,@` |Đp 8b8HH(`,@<|Dpu @ u HH$y`b P, A|ʘdȰu XЈҠ؈ڰu `u h,A`u pH$ `up#pux,$A8dH3}`u24u, Au,AuH#`ucCpu,$A$8dH2`u\|CcuH#)`b, AЈ|du,A0u|#yAH"`uH"`u#pu,$A 8dH25`uCcuH"u`b, AĈ|du,A0u|#yAtH"`uH" `8-=:`--b8--8-<--|*uZTV\,@8-]8-=zd bu&x8|*" 8`8 8 8T899 Ha`,A ,A p,A p,A ,,A ,AX,A,A,A,@8McxAx,@8`8 88 899 H`,A,@$,=@8+;\x}K,A`,A,A,A,A,A\,@H,A ,Ad8+;'@HKTbd, Alp`Ab , @HH`b| @b , @cC8ø08H A(8z8Hx&| x$|@*H ߱A(cCH`0bP| @AbX| @@ b`0bp| @A8`80*8! |px} !Aa!AaN H`KH`K|` @pK8cC8ø8dpH ީA(8z8Hx&|x$ |8*H mA(cCH`pbP| @AbX| @@ b`KH,A,A8+;&@KH,A,A8+;%@KHz,A,A8+;$@KHg,AX,A8+;#@KHZ,A0,At8+u!,#-"@8`=u!;@DKPHM,A,A88+u",#-!@8`=u";@K, cS@cC:@"HDx&| *H``zbcH`bc0:V@8ø8x&|8*H ܱA(bcH`b0PX|3x@|p@LB0BA b`0bp| @@(cbPH`8+]AHK4Kbc8ø8dpH !A(8z8Hx&|x$ |8*H A(bcH`pbP| @AbX| @@KxH,AT,A8+;[@|Ku X8bcH]`,@|su X8bcH1`,@ |Đsu X8HbcH`,@<<|DsH,A,A8+;Z@KU P8\bCH`,A8hbCH`,@Kbc8H}`,@dKLbc8Ha`,@Ku P8bcHA`,@|su P8bcH`,@ |Đsu P8HbcH`,@<<|DsH,A,A8+;Y@Kbc8\H`,A8hbcH`,A8xbcHi`,@Kbc8HM`,A<8bcH5`,@8K bc8H`,A8bcH`,A8bcH`,@Ku P8bcH`,@<|su P8bcH`,@ |Đsu P8HbcHq`,@d<|Dsb, @u 8`H,A,A08+;X@K bc8\H`,A8hbcH`,At8xbcH`,@lKXbc8H`,A8bcH`,@Kbc8Hy`,A8bcHa`,@Ku P8bcHA`-8bcH-`@,A|s˜ b, Au 8u 8bcH`,@ 8`H1,At,A8+;W@Kbc8H`-8bcHm`@,A\K@bc8HM`,A@8bcH5`,A(|sKH,A,AU, -@8=U8+;V@Ku P8bcH`,@|su P8bcH`,@| |Đsb, Au 88`H,A,AX8+uV,#-U@8`=uV;@(K4bc8H `,@Kpbc8H`,@@K(,>bd,|` AA0p`Ab , @Ha`b| @b , @cC8ø08H ԅA(8z8Hx&| x$|@*H MA(cCHa`0bP| @AbX| @@ b`0bp| @A8`8KH`KDHy`KA0p`Ab , @HQ`b| @b , @cC8ø08H uA(8z8Hx&| x$|@*H =A(cCHQ`0bP| @AbX| @@ b`0bp| @A8`8KHu`KDHi`K8+]KH`K𐲃KhKL`qb88'8cH Y`8d`db#H"`KHU`KK\K@`sb88'8cH `8d`dbcH!`KKtKX`pb88'8cH Ĺ`8d`dbH!e`K貃KK`b8\H`,A8hbHi`,@Kb8HM`,@Kb8H1`,AH8bH`,@DK,`pb88'8cH `8d`dbH `K봲KpK,`pb88'8cH å`8d`dbH Q`K꘲KTK`nb88'8cH ]`8d`daH `KpK,K`pb88'8cH `8d`dbH`KDKKba8dH`KbH`Kb8\H`,A|8hbH`,@tK`b8H}`,@0Kb8Ha`,@K`pb88'8cH 5`8d`dbH`KHKKba8dH`KbH`Kb8\H`,A\8hbH`,@TK@b8H`,@Kb8H`,@K`pb88'8cH U`8d`dbH`K4KKTba8dH`KbH%`Kb8\H`,A08hbH`,@(Kb8H`,@Kb8H`,@ߜK߄`pb88'8cH u`8d`dbH!`KK޼K$b8H` KݼbH A`Kb#b8dH`Kb#H `K`qb88'8cH `8d`db#H}`KKۄHi`K}KxHU`Kڔ| @Kڠ C&Dback_copy_menu;aAb|!}&NB?CaA8!xp~b8c~, !|`x$|*A bd,|` @(A0p`Ab , @HY`b| @b , @; 8ø80cH A(@8~8Hx&x$|"|@* H yA(cH\`0bP| @Ab0X|#@@ b`p0bh|$@A8`8KHX`K0HX`KA0p`Ab , @HXu`b| @b , @; 8ø80cH A(@8~8Hx&x$|"|@* H UA(cH[i`0bP| @Ab0X|#@@ b`p0bh|$@A8`8KHW`K0HWy`KKPHWe`KHWY`Kh| @4Kt C @prof_logs_menu;;aA;`b|!}&?aA8 !"}B8c}, |`!рx$|*A8pA , A HVm`HVe`| @H | @Ĉ , A HV9`: 8ø80bH uA(@8w8Hx$|0*x&|"H AA(bHYU`Pb0|#@AX|#@@ b`p0bh|$@@ 8H8`--8~~8~~8-~8-(9~~a<`~~9 --|g<~~a<`--|*|ia@ H 8`#aw Ha`b0,@P 8/bH͡A(|tyA4b88HA(,A8t8*bH `<`-p<: `ë.--A0A@,>@w`w` HY`w88Hˉ`,@8w`H1`w@8Ha`,Al8xw`H `@8cH5`,@8|w`H`@8cH `,@8DŽw`H̱`wP8H`,A$8Ĵw`H̉`w`PHy`w`8Hi`w`XHY`w`8HI`w , A$w`8ĴH)`w` H`w , A$w`8H`w` H`w Ȉ, A$w`8ŤH`w` H˹`w Ј, A$w`8H˙`w` Hˉ`w ؈, ATw`8Hi`w` HY`w ؈, A$w`8H9`w` H)`w , A$w`8ļH `w` H`w؈, A$w`8H`w`H`w, A$w`8Hʩ`w`Hʙ`w, A$w`8Hy`w`Hi`w, A$w`8ŬHI`w`H9`w, A$w`8 H`w`H `w, A$w`8H`w`H`w, A$w`8Hɹ`w`Hɩ`wH8tH`,@8w`HɁ`c8`88888909 H`,A ,A,@488x8d8 Ha`T`>,A H,@4@8xǨ8d88H)`T`>,A H`,@4H8x8d8 H`T`>,A XH(,@4P8xX8d8H`T`>,A H,@4X8x8d8H`T`>,A H,@4`8x888HM`,A ,@|cKh8`8788899 H`,A |,AD,@08x,8b8H)`T`>,A DH,@08x88b8H)i`T`>,A H,@08xD8b8H)5`T`>,AH,@08xL8b8H)`T`>,AHx,@08xT8b8H(`T`>,AtHD,@08x\8b8H(`T`>,A@H,@t8xd8b8H(e`T`>,A H8`868 88 9 9 Hq`,A,A,@0 8x88d8H=`T`>,AHt,A,@0 8x<88d8H`T`>,AhH8,@0 8xȀ8b8H'`T`>,A4H,@0 8xȈ8b8H'Y`T`>,AH,@0 8x8b8H'%`T`>,AH,@0 8xȐ8b8H&`T`>,AHh,@0 8xȘ8b8H&`T`>,AdH4, @ 8xh8b8H&`T`>,A0, @;AAxK 8x<88=8H`,A,Aw w 8/HA(,#@Dbc8H$`,#A48aw H`w H`w |bdH-`w 8/bcH}A(,#AD:#8cHA(0`r8@eb#H!A(,#AHA(|P0`bc8/HA(,@`q~Rbc88HaA(,A8q8*bEH `KA0;`KxA;`KlAP`8x888899 9@pxH2`,Al,A$y, A\p`A , A0HI`H$cK;`K8b0KHIY`| @H |` @ , A HI-`; 8ø80cH |iA(@8~8Hx$|0*x&|" H |5A(cHLI`Pb0|#@AX|#@@ b`p0bh|$@A8`8H<8 8ø;bp8dccbH {A(H@8{8x$x&|0*|" H {iA(ccHK}`P|7@AxX|7@@tHh8 8ø;bp8dccbH { A(H@8{8px$x&|0*|" H zA(ccHJ`P|7@AH 8ø8d;bpccbH zA(@8{8ȠHx$|0*x&| H zQA(ccHJe`P|7@A`HPH@8ø8p8bbx&|:!H zA(8bHJ`P|7@AX|7@@ b`bhHy, A8p`A , A HF=`HF5`| @H |` @ , A HF `; 8ø80cH yEA(@8~8Hx$|0*x&|" H yA(cHI%`Pb0|#@AX|#@@ b`p0bh|$@A8`8Hy, A8p`A , A HE%`HE`| @H |` @ , A HD`; 8ø80cH x-A(@8~8Hx$|0*x&|" H wA(cHH `Pb0|#@AX|#@@ b`p0bh|$@A8`8@:8!0|!A} a!AaN C@brc_clean_menu;;;aA!b?|8}&a,$|xc$80!|*A@pA b , A HC`HC `b| @H | @b , A HB`;b 8ø80ccH vA(@8{8Hx&x$|"|@*H uA(ccHE`Pb0|#@AX|#@@ b`p0bh|$@@ 8H8--8~~b8-~8~9-<~~|:(@ H 8#bcH `b0[,@T8/cHIA(|yyA4c88HA(,A8y8*cEH `<-p<`"B; <`wë`.-A@,>@`ddH`b8cpH%`,@8bcH`b8cxH`,A8xbcH`b8xcH`,@ 8|bcHe`bx8cH`,@8DŽbcH1`b8cH]`,A,8ĴbcH`dH`b8cH`dH`b8njcH`bc, A,b8ĴcH`dHu`bc, A@b8cHM`dH9`b8ǖcH%`bc, A,b8cH`dH`bc, A@b8ǘcH`dH`b8cH`bc, A@b8ǠcHq`dH]`b8cHI`bc, A@b8cH!`dH `b8cH`bc, A,b8cH`dH`c8`8:8889h9 H`,A ,A0,@4 8|8d8pH`T`>,AH,@488|Ǩ8d8xHa`T`>,AH,@4x8|8d8H)`T`>,AlHx,@48|X8d8H`T`>,A4H@,@48|8d8H`T`>,AH,@8|888H`,A,@cK8`89888 99 HA`,A,AH,@48|88d8H `T`>,ALHX,Ad,@48|<88d8H`T`>,A H,@48|8b8HQ`T`>,AH,@48|8b8H`T`>,AH,@4`8|x88H!`T`>,AdHp,@4h8|88H`T`>,A,H8,@p8|88H`T`>,A, @<;A0K48|<88=8Hq`,A,A8/eHA(,#@P8bH`,#A8aeH`bcH`bbbcH`b8/bHMA(,#A8:8cHA({`sb8@HA(,#AHA(|P`b8/HA(,@`t~sb88H9A(,A8t8*beH `KAD;KAP8|888899 9@pxH `,A(,Ahbd, AXp`Ab , A$H8Y`HcK$8KH89`b| @H |` @b , A H8`; 8ø80cH kAA(@8~8Hx&x$|"|@* H kA(cH;`Pb0|#@AX|#@@ b`p0bh|$@A8`8H8 8ø;bp8dccfH jmA(@8}8ǰHx&x$|"|0* H j-A(cH:A`P|;@AX|;@@H 8ø8d;bpccfH iA(@8}8Hx&x$|"|0* H iA(cH9`P|;@A`HPH@8ø8bp8bcfx&|:!H iEA(8bH9Y`P|;@AX|;@@ b`bhHA, K8{<(88d8H]`T`?,AK8{< 88=8H1`,,AA8/ z HA(8,#z @,A, K8<88d8H`,T`>A, K8<88=8H`,,AtA8/B:zHA(8,#z@@AX|>@@K888d8H`,T`>A, Kbd, A,p`Ab , @H1`b| @b , @; 8ø80cH PMA(@8~8Hx&x$|"|@* H PA(cH %`Pb0|#@AX|#@@b`8p0bh|$@@$88`8KKH9`K(H-`K|` @K8cc8H9A(,A8|8*cH `K8#K4KH`K@H`K | @K C brc_syn_menuaAb|!}&N?c888c!, |`x$|*A |pA؈ , @ \H`| @ , @ 0;B 8ø80cCH NA(@8z8Hx$|0*x&|"H MA(cCH`Pb0|#@AX|#@@b`8p0bh|$@@ 88`--8-~8-(a@ PBzHA`"0,@ 8/bHA(|vy@<`-p: @8`8G88899 Hn`,/AP,,A\/A(,A`A0,8d@8{8(@x0Ha`,T`>A, @hNAdzzH`z8tH`,@tz8H`zH`z8H`z, @ NBKz8H}`zHm`NBKz8HU`z8H`,@l8zH-`KX|, AXp`A؈ , @8H`| @ , @ ; 8ø80cH K!A(@8~8Hx$|0*x&|" H JA(cH`Pb0|#@AX|#@@b`8p0bh|$@@d88`8 8!|} !AaN KH`KH`K|` @K K8@(8{H`,T`>A`Kp,A Aph8{$8899 9@pxH`,A,A|, Ap`A؈ , @H `| @ , @; 8ø80cH I-A(@8~8Hx$|0*x&|" H HA(cH `Pb0|#@AX|#@@b`8p0bh|$@@ 88`8K KH%`K4H`K|` @KB8 8ø;"p8dc#cH H5A(H@8y8,x$x&|0*|" H GA(c#H`P|8@AX|8@@b`8bh8K88{88H܅`,A,@NB@,K8{88d8HM`T`?,AK8{<88=8H!`,,AA,8/zHA(8,#z@A, @`NA\d@d@H`b8tc0H`,@b8c@Ha`d@8HM`b8lc@H9`bc(, @ NBKb8c@H `d@(H`NBKb8c@H`b8c0H`,@L8bc@H`K4bd, A\p`Ab , @8H m`b| @b , @; 8ø80cH ?A(@8~8Hx&x$|"|@* H ?MA(cHa`Pb0|#@AX|#@@b`8p0bh|$@@T88`88!|!A} aN KH E`KH 9`K|` @K KT8@(88HE`T`>,AXK<,ALAh8$8899 9@px@H`,A ,APbd, A,p`Ab , @H m`b| @b , @; 8ø80cH =A(@8~8Hx&x$|"|@* H =MA(cH a`Pb0|#@AX|#@@b`8p0bh|$@@$88`8KKH u`K(H i`K|` @K8 8ø;p8dccH AK8<88=8 Ha`,,AtA8/b[ { HA(8,#{ @@AX|>@@K888d8H΅`,T`>AK|bd, A,p`Ab , @H`b| @b , @; 8ø80cH 9A(@8~8Hx&x$|"|@* H 8A(cH`Pb0|#@AX|#@@b`8p0bh|$@@$88`8KKH`K(H`K|` @K8c8HzA(,Ah8}8*cH `KP8#KKH`KH`K| @K C brs_dbshut_menuaAb|!}&N?c8\8c!, |`x$|*A pA؈ , @ H`| @ , @ ;B 8ø80cCH 6A(@8z8Hx$|0*x&|"H 6A(cCH`Pb0|#@AX|#@@b`8p0bh|$@@ 88`--8-~8~-8-(a@ Bz`Hu`"0,@ `8/bH{=A(|vy@ @<`-p: @8`8I8889P9 HW}`,/A,,A/A,AA,Ad,8d@8{8x(@0H`,T`>A$, @`NA\zzXHz`zx8tHx`,@z8Hzy`zHzi`z8PHzY`zh, @Dzp, @ NBKz8Hz!`zpHz`NBKz8ŤHy`zhHy`Kz8Hy`zx8Hx`,@88zHy`K$|, AXp`A؈ , @8H}`| @ , @ ; 8ø80cH 3A(@8~8Hx$|0*x&|" H 3mA(cH`Pb0|#@AX|#@@b`8p0bh|$@@d88`8 8!|} !AaN KHU`KHI`K|` @K KX8@(8{HQ`,T`>A`K<,A Aph8{$8899 9@pxH`,A,AT|, Ap`A؈ , @H`| @ , @; 8ø80cH 1A(@8~8Hx$|0*x&|" H 1yA(cH`Pb0|#@AX|#@@b`8p0bh|$@@ 88`8K KH`K4H`K|` @KB8 8ø;"p8dc#cH 0A(H@8y8\x$x&|0*|" H 0}A(c#H`P|8@AX|8@@b`8bh8K88{88H`,A,@TNB@KL8{p88d8H`T`?,AK8{Ŵh8d8Hĝ`,T`>AK8{<`88=8Hq`,,AA8/`z`HtA(8,#z`@A, @XNATdXcdX Hn`b8tc@Hl`,@b8ļcXHn`dXHHnu`b8cXHna`dXPHnM`b84cXHn9`bc0, @Pbc8, @ NBKb8cXHm`dX8Hm`NBKXb8ŤcXHm`dX0Hm`Kb8cXHm`b8c@Hk`,@8bcXHmi`Kbd, ATp`Ab , @0H-`b| @b , @; 8ø80cH 'IA(@8}8Hx&x$|"|@* H ' A(cH!`Pb0|#@AX|#@@ b`p0bh|$@A8`88!|!} AaN H `KH`K|` @K K8A,@(8PH`T`>,AXK,A4Ah8$8899 9@pxXHڵ`,A ,Abd, A p`Ab , @H-`b| @b , @; 8ø80cH %IA(@8}8Hx&x$|"|@* H % A(cH!`Pb0|#@AX|#@@ b`p0bh|$@A8`8KHA`K4H5`K|` @K  8ø8d;bpccfH $UA(@8|8@Hx&x$|"|0* H $A(cH)`P|;@AX|;@@ b`bhK88X8H`,A,@NB@|K8`8H8H1`T`>,AK@888d88HA`,T`>AK8Ŵ8d80H`,T`>AdK8<88=8(H`,,A4A 8/B:(z(Hh=A(8,#z(@AXKbd, A p`Ab , @H}`b| @b , @; 8ø80cH A(@8}8Hx&x$|"|@* H ]A(cHq`Pb0|#@AX|#@@ b`p0bh|$@A8`8KPH`K4H`K|` @K 8cc8HaA(,A8|8*cH `KKTKH)`K\;KH`K | @K, C brs_dbparam_menuaAb|!}&N?c88c!, |`x$|*A |pA؈ , @ \H!`| @ , @ 0;B 8ø80cCH EA(@8z8Hx$|0*x&|"H A(cCH%`Pb0|#@AX|#@@b`8p0bh|$@@ 88`--8-<--|c"(a@ PBzXH]`"0,@ X8/bHbA(|vy@<`-p: @8`8M8889H9 H?`,,AL,/A\,A(Ad,8d@8{8`(@|0H`,T`>A, @pNAlzxzxPHb5`z`8tH`e`,@xzh8H`M`,@,AK8{<X88=8Ha`,,AA,8/XzXH\A(8,#zX@Ad, @DNA@d(d( HV`b8tcHT`,@b8cHT`,@b8c(HVA`d( HV-`b8c(HV`bc , @bc , @bc , @bc, @Pbc, @ NBKDb8c(HU`d(HU`NBKb8c(HUi`d(HUU`Kb8c(HU=`d( HU)`KLb8Ŭc(HU`d( HT`K b8Ťc(HT`d( HT`Kb8Ĵc(HT`d(HT`KPb8c(HT`b8cHR`,@8bc(HT]`Kbd, A\p`Ab , @8H!`b| @b , @; 8ø80cH =A(@8~8Hx&x$|"|@* H A(cH`Pb0|#@AX|#@@b`8p0bh|$@@T88`88!|!A} aN KH`KH`K|` @K K , A8, @( 8H`T`>,ALK, ALAh8$8899 9@px(H`,A,Abd, A,p`Ab , @H`b| @b , @; 8ø80cH 1A(@8~8Hx&x$|"|@* H A(cH `Pb0|#@AX|#@@b`8p0bh|$@@$88`8KKH`K(H`K|` @K8 8ø;p8dccH -A(@8}8Hx&x$|"|0* H A(cH`P|<@AX|<@@b`8bh8K88(8Hu`,A,@NB@xK8X8HA`T`>,AK<8488 8H`,T`>ApK 8888H`,T`>A@K8888 Hq`,T`>AK888 8 HA`,T`>AK|8Ŵ8d8 HQ`,T`>AKL8<88=8 H!`,,AAd8/b[ { HN}A(8,#{ @@AX|>@@K888d8 HE`,T`>AK@bd, A,p`Ab , @Hӽ`b| @b , @; 8ø80cH A(@8~8Hx&x$|"|@* H A(cHֱ`Pb0|#@AX|#@@b`8p0bh|$@@$88`8KKH`K(Hҹ`K|` @K8c8HGA(,A8}8*cH `KK8~KlK8HQ`KHE`KL| @KX CTbrs_moredo_menuaAb|!}&N?c88c!, |`x$|*A XpA؈ , @ 8Ha`| @ , @ ;B 8ø80cCH A(@8z8Hx$|0*x&|"H QA(cCHe`Pb0|#@AX|#@@b`8p0bh|$@@ d88`--8-~8~-8-(a@ $BzpHC`"0,@ p8/bHHA(|vy@ <`-p: @8`8O888 9`9 H%9`,/A,,A0/A,A4A,A,8d@ 8{8(@0H`,T`>A`, @`NA\zzhHH]`z8tHF`,@z8HFu`,@z8HH`zHH `z8ŘHG`zx, @Dz, @ NBKz8ŬHG`zHG`NBKz8ŤHG`zxHG`Kz8ĴHGy`zHGi`K,AXK,A Aph8{$8899 9@pxH}`,A,A|, Ap`A؈ , @H`| @ , @; 8ø80cH %A(@8~8Hx$|0*x&|" H A(cH`Pb0|#@AX|#@@b`8p0bh|$@@ 88`8KKH`K4H`K|` @KB8 8ø;"p8dc#cH -A(H@8y8żx$x&|0*|" H A(c#H `P|8@AX|8@@b`8bh8K08{88H}`,A,@NB@K8{XHM`T`>,AK|8{888H!`T`?,AKT8{Ŵx8d8H`,T`>AK 8{<p88=8H`,,ATAX8/pzpHB%A(8,#zp@%A(`tyb8@HAQA(,#@\b8/HAaA(,`u@tb~88H=A(,AT8u8*bH `@K,A, @,A, @;K8~`888HY`T`>,AtK8~X8d8Hi`T`>,ADKb(@,08~8d8H)`T`>,AKT K 8~T8d8H`T`>,AKc}Kd#d8H3y`b8tcH1`,@4, #@b8ļcH3=`dH3)`b8cH3`dH3`b8cH2`b8cH2`bcH2`, #AbcH, @, #AbcP, @, #AbcX, @p, #Abc`, @$, #Abch, @Ĉ, #Abcp, @d, #Abcx, @, #Abc, @, #Abc, @Db8tcH/`,A cKhb8cH1m`cKLb8cH1Q`dH1=`b8cH1)`Kb8cH1`dH0`b8cH0`K$b8cH0`dxH0`b8cH0`Kb8cH0`dpH0}`b8cH0i`Kdb8cH0Q`dhH0=`b8cH0)`Kb8cH0`d`H/`Kb8ļcH/`dXH/`Klb8cH/`dPH/`K b8cH/`dHH/y`Kb8cH-`,A 8ĴbcH/E`dH/1`Kb8cH/`b8cH-E`,@8bcH.`KaKa8tH- `,A8laH,`,Ap8|aH,`,AX8ĄaH,`,A@8ČaH,`,A(8ĔaH,`,A8#KaA8DaH,i`8~,A8#a8LH,E`8~,A8#a8TH,!`,@ L8~8\aH,`,@8~8ĬaH+`,@8~8daH+`,@`8~8laH+`,@8~8taH+`,@8~8|aH+a`,@48~8`8K8 88 909 H )`,A,A,A|,A,A`,A(,A,A,A,AH, A, A, AA:MK 8ø8d;bpccfH A(@8|8ňHx&x$|"|0* H aA(cHu`P|;@AK8~L888H{`T`>,AK08~D888Hz`T`>,AK8~$888xHz`T`>,AK8~888pHzu`T`>,APK8~<88d8hHzE`T`>,A Kp8~488 8`Hz`T`>,AK@8~(88d8XHy`T`>,AK8~88d8PHy`T`>,AK8~88d8HHy`T`>,A`K8~<88=8@HyU`,A4,A8/@e@H)A(,#@P8bHu`,#A(8ae@H)`bc@H)`b@bbcH#`b8/@bH)1A(,#@8b0AAK:8cH%A(0`v8@ebH(A(,#@Xb8/H(A(,@t`t~b88H%A(,AP8t8*bH `K8H%A(|P0`KH@8ø8bp8bcfx&|:!H A(8bH`P|;@A\KL8~88d88Hwy`T`>,ATKbd, A p`Ab , @H`b| @b , @; 8ø80cH A(@88Hx&x$|"|@* H A(cH`Pb0|#@AX|#@@ b`p0bh|$@A8`8KH`K4H`K|` @K a8ĄH%`,A8ČaH%`,A8#Ka8ĄH$`,A`8ČaH$`,AH8#KDa8|H$`,A8ĄaH$`,A8ČaH$q`,A8#Ka8tH$M`,A8laH$5`,Ax8|aH$`,A`8ĄaH$`,AH8ČaH#`,A08#K,a8dH#`,A8taH#`,A8laH#`,A8|aH#`,A8ĄaH#i`,A8ČaH#Q`,At8#Kpa8ĜH#-`,A08ĤaH#`,A8ČaH"`,A8ĔaH"`,A8#Ka8\H"`,A8daH"`,A8laH"`,At8taH"y`,A\8|aH"a`,AD8ĄaH"I`,A,8ČaH"1`,A8ĔaH"`,A8#KH A(|P0`K,A,A,A,At,A<,A, A, A, A\, A$, A,A,Ad,A,,AAT8~$88899 9@phxH1`,A,A`K|8 8ø;bp8dccfH A(@8|8hHx&x$|"|0* H A(cH`P|;@APX|;@@LK@8~888Hqa`T`>,A,A K\8~`888H`T`>,AK,8~X8d8Hp`T`>,AKb(@,08~8d8Hp`T`>,AlK K 8~T8d8xHpY`T`>,A4K8~L888pHp)`T`>,AKT8~D888hHo`T`>,AK$8~$888`Ho`T`>,AK8~888XHo`T`>,AtK8~<88d8PHoi`T`>,ADK8~488 8HHo9`T`>,AKd8~(88d8@Ho `T`>,AK48~88d88Hn`T`>,AK8~88d80Hn`T`>,AK8~88d8 Hny`T`>,ATKd#d H `b8tcH9`,@4, #@b8ļcH`dH`b8cH`dH`b8cH`b8cHm`bcHY`, #Abc0, @, #Abc8, @, #Abc@, @p, #AbcH, @$, #AbcP, @Ĉ, #AbcX, @d, #Abc`, @, #Abch, @, #Abcp, @Db8tcxHe`,A cKb8cH`cKb8cH`dpH`b8cH`Kb8cH`dhH`b8cH}`K$b8cHe`d`HQ`b8cH=`Kb8cH%`dXH`b8cH`Kdb8cH`dPH`b8cH`Kb8cH`dHH`Kb8ļcHy`d@He`Klb8cHM`d8H9`K b8cH!`d0H `Kb8cH5`,A 8ĴbcH`dH`Kb8cH`b8cH`,@8bcH}`KaKha8tH`,A88laH`,A 8|aHq`,A8ĄaHY`,A8ČaHA`,A8ĔaH)`,A8#K޸a8ĄH`,Ax8ČaH`,A`8#K\a8ĄH`,A8ČaH`,A8#Ka8|H`,A8ĄaHu`,Aݨ8ČaH]`,Aݐ8#K݌a8tH9`,AL8laH!`,A48|aH `,A8ĄaH`,A8ČaH`,A8#Ka8dH`,Aܨ8taH`,Aܐ8laH`,Ax8|aHm`,A`8ĄaHU`,AH8ČaH=`,A08#K,a8ĜH`,A8ĤaH`,A8ČaH`,Aۼ8ĔaH`,Aۤ8#K۠a8\H`,A`8daH`,AH8laH}`,A08taHe`,A8|aHM`,A8ĄaH5`,A8ČaH`,A8ĔaH`,Aڸ8#KڴcC88HA(,A8{8*cH `KٰcC88HA(,AL8{8*cH `K4KH9`K$;KH%`K| @K C (brs_dbshow_menuaA!b?|8}&N,$|xc$8!!|*A ,pA b , @ HI`b| @ b , @ ; 8ø80cH eA(@8~8Hx&x$|"|@*H )A(cH=`Pb0|#@AX|#@@b`8p0;bh|$@@ 88--8-~b8-c,#A 8`##a}H`0|,@ ]8/cCHA(|yy@ \b<`-p;C @8`8Q88899 H `,/At,,A/A,AA,8d@88(@0Hb`,T`>A, @dNA`}ȓC}H1`}8tHa`,@}8ļH `}H`}8H`}H`}8ԤH`}, @ NBK}8ŬH`}H`NBK}8Hy`}8H`,@L8}HQ`K8bd, AXp`Ab , @4H`b| @b , @; 8ø80cH 1A(@8}8Hx&x$|"|@* H A(cH `Pb0|#@AX|#@@ b`p0bh|$@A8`88!|} !AaN H`KH`K|` @K Kd,A8@(8H_`T`?,APKD,A0Ah8$8899 9@pxH`,A,A\bd, A p`Ab , @H`b| @b , @; 8ø80cH -A(@8}8Hx&x$|"|@* H A(cH`Pb0|#@AX|#@@ b`p0bh|$@A8`8KH%`K4H`K|` @K  8ø8d;bpccfH 9A(@8|8ԴHx&x$|"|0* H A(cH `P|;@AX|;@@ b`bhK888H]`,A,@LNB@KD8`888Hp`T`?,AK8(88d8H]%`T`?,AK8<88=8H\`,,AdA8/=}H YA(8,#}@AD, @dNA`ddHU`b8tcH`,@b8ļcH%`dH`b8cH`dH`b88cH`bc, @ NBKb8ŬcH`dH`NBKxb8cHu`b8cH`,@$8bcHE`K |, ALp`AԈ , @,H`| @ , @; 8ø80cH 9A(@8~8Hx$|0*x&|" H A(cH`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8 8!|} !AaN H`KH`K|` @K KD,At8@(8{HS`T`?,AhK(,A Ahh8{$8899 9@pxHs`,A,A<|, Ap`AԈ , @H%`| @ , @; 8ø80cH IA(@8~8Hx$|0*x&|" H A(cH)`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8KHM`K@HA`K|` @K" 8ø8d;pcbYH aA(H@8x8Hx$x&|0*|" H )A(cH=`P|7@AX|7@@ b`CbhCKT8{88HQ`,A4,@TNB@KL8{`888HdA`T`>,AK8{(88d8HQQ`,T`>AK8{<88=8HQ!`,,AA8/vH}A(8,#v@AK||, Ap`AԈ , @H`| @ , @; 8ø80cH A(@8~8Hx$|0*x&|" H A(cH`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8KH`K@H`K|` @K8b8HA(,A8x8*c%H `KaK0KH`KD;@KHy`K| @K C brs_tscreate_menuaA!b?|8}&N,$|xc$8!!|*A ,pA b , @ H`b| @ b , @ ; 8ø80cH A(@8~8Hx&x$|"|@*H iA(cH}`Pb0|#@AX|#@@b`8p0;bh|$@@ 88--8-~b8-c,#A 8`##a} H`0|,@ ] 8/cCH A(|yy@ \b<`-p;C @8`8S88899 HI`,/At,,A/A,AA,8d@880(@0HJ`,T`>A, @dNA`}HC}HHq`}08tH`,@}H8ļHI`}H8H9`}H8H)`}H@H`}H8H `}(, @ NBK}H8ŬH`}H(H`NBK}H8H`}08H`,@L8}HH`K8bd, AXp`Ab , @4HU`b| @b , @; 8ø80cH qA(@8}8Hx&x$|"|@* H 5A(cHI`Pb0|#@AX|#@@ b`p0bh|$@A8`88!|} !AaN H1`KH%`K|` @K Kd,A8@(@8HH%`T`?,APKD,A0AhH8$8899 9@pxHg`,A,A\bd, A p`Ab , @HQ`b| @b , @; 8ø80cH mA(@8}8Hx&x$|"|@* H 1A(cHE`Pb0|#@AX|#@@ b`p0bh|$@A8`8KH~e`K4H~Y`K|` @K  8ø8d;bpccfH yA(@8|8(Hx&x$|"|0* H 9A(cHM`P|;@AX|;@@ b`bhKH888HE`,A,@LNB@KD88`888HXQ`T`?,AK8((88d8HEe`T`?,AK8< 88=8HE9`,,AdA8/= } HA(8,#} @A, @\NAXddH`b8tcH`,@b8ļcHY`dHE`b8cH1`dH`b8cH `bc, @PbcȈ, @ NBKb8ŬcH`dH`NBK\b8ŤcH`dH`Kb8cHi`b8cH`,@8bcH9`K̈|, ALp`AԈ , @,Hu `| @ , @; 8ø80cH -A(@8~8Hx$|0*x&|" H A(cHx `Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8 8!|} !AaN Hs`KHs`K|` @K K8At,@(8{H;`T`>,AhK,A Ahh8{$8899 9@pxH[`,A,A|, Ap`AԈ , @Hs`| @ , @; 8ø80cH =A(@8~8Hx$|0*x&|" H A(cHv`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8KHrA`K@Hr5`K|` @K" 8ø8d;pcbYH UA(H@8x8 x$x&|0*|" H A(cHu1`P|7@AX|7@@ b`CbhCKT8{88H9`,A4,@ NB@K8{`88HL9`T`>,AKx8{(88d8H9I`,T`>AKH8{Ŵ8d8H9`,T`>AK8{<88=8H8`,,AlAH8/vHEA(8,#v@AK|, Ap`AԈ , @Hn`| @ , @; 8ø80cH A(@8~8Hx$|0*x&|" H A(cHq`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8KHm`K@Hm`K|` @K8b8HA(,A$8x8*c%H `K KKHmU`K;@KpHmA`K| @K C brs_tsalter_menuaA!b?|8}&N,$|xc$8$!|*A pA b , @ Hli`b| @ b , @ ; 8ø80cH A(@8~8Hx&x$|"|@*H IA(cHo]`Pb0|#@AX|#@@b`8p0;bh|$@@ 88--8-~b8~~8-c,#A 8`##a} Hޡ`0|,@ ] 8/cCHA(|yy@ (b<`-p;C @8`8U8 88 9 9 H!`,/A,,A/Ah,AAh,A4,A8d8@(8 (@0H2`,T`>Ax, @XNAT} 8C} 8 H=`} 8tHm`,@} 88ļH`} 8 (H`} 88H`} 8 0H`} 88H`} , @x} , @D} , @ NBK} 88H`} 8 H}`NBKt} 88ŬHe`} 8 HU`K} 88ŤHA`} 8 H1`Kl} 88H`} 8HM`,@8} 8H`Kbd, AXp`Ab , @4Hh`b| @b , @; 8ø80cH A(@8}8Hx&x$|"|@* H A(cHk`Pb0|#@AX|#@@ b`p0bh|$@A8`88!|} !AaN Hg`KHg`K|` @K K,A,@( 08H/`T`>,APK, A0Ah 88$8899 9@pxHO=`,A,Abd, A p`Ab , @Hf`b| @b , @; 8ø80cH A(@8}8Hx&x$|"|@* H A(cHi`Pb0|#@AX|#@@ b`p0bh|$@A8`8KHe`K4He`K|` @K  8ø8d;bpccfH A(@8|8Hx&x$|"|0* H A(cHh`P|;@AX|;@@ b`bhK 8888H--`,A,@NB@K (8`88H?`T`>,AKH84 88 8H,`T`?,AK 8( 88d8H,`T`?,AhK8Ŵ 8d8H,q`,T`>A8K8< 88=8H,E`,,A A8/= } HܥA(8,#} @A, @\NAXd0d0H։`b8tcHԵ`,@b8ļc0HY`d0 HE`b8c0H1`d0(H`b8c0H `bc, @Pbc, @ NBKb8c0H`d0Hձ`NBK\b8Ŭc0HՕ`d0HՁ`Kb8c0Hi`b8cHӕ`,@8bc0H9`K̈|, ALp`AԈ , @,H\ `| @ , @; 8ø80cH -A(@8~8Hx$|0*x&|" H A(cH_ `Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8 8!|} !AaN HZ`KHZ`K|` @K K8At,@(8{(H"`T`>,AhK,A Ahh8{$8899 9@px0HB`,A,A|, Ap`AԈ , @HZ`| @ , @; 8ø80cH =A(@8~8Hx$|0*x&|" H A(cH]`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8KHYA`K@HY5`K|` @K" 8ø8d;pcbYH UA(H@8x8x$x&|0*|" H A(cH\1`P|7@AX|7@@ b`CbhCKT8{808H `,A4,@ NB@K8{`8 8H39`T`>,AKx8{488 8H I`,T`>AKH8{(88d8H `,T`>AK8{<88=8H`,,AlAH8/vHEA(8,#v@AK|, Ap`AԈ , @HU`| @ , @; 8ø80cH A(@8~8Hx$|0*x&|" H A(cHX`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8KHT`K@HT`K|` @K8b8HɽA(,A$8x8*c%H `K KKHTU`K;@KpHTA`K| @K C brs_dfmove_menuaAb|!}&N?c8Xa8c, |`!x$|*A pA x , @ tHS]`| @ X , @ @;B 8ø80cCH A(@8z8Hx$|0*x&|"H MA(cCHVa`Pb0|#@AX|#@@b`8p0;@bh|$@@ 88--~8-~8~~<~~,#|d*aA T8##8-bcHť`"0,@$8/bHA(|wy@ <`-p: @8`8[8 88 9p9 H`,/A0,,A X/A ,ALA,A,AAt,A<,8d@T8{8(@40H`,T`>A, @HNADdВdxH%`b8tcHQ`,@$b8cH5`,@b8ļcH`dH`b8cHɱ`dHɝ`b8 cHɉ`bc, @8bc, @bc, @bc, @dbc, @ NBK b8cH `dH`b8cH`NBKb8cH`dHȱ`b8cHȝ`Kdb8ĴcHȅ`dHq`K$b8ļcHY`dHE`Kb8ŤcH-`dH`Kb8ĴcH`dH`Kb8cH`b8cH`,@8bcHǥ`K|, APp`AԈ , @0HNu`| @ , @; 8ø80cH A(@8~8Hx$|0*x&|" H eA(cHQy`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8 8!|a} !AaN HMU`KHMI`K|` @K K, A, Ax8, @(8{HA`T`>,AXK, A Ahh8{$8899 9@pxH4`,A ,A|, Ap`AԈ , @HLu`| @ , @; 8ø80cH A(@8~8Hx$|0*x&|" H eA(cHOy`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8KHK`K@HK`K|` @K" 8ø8d;pcbYH ~A(H@8x8,x$x&|0*|" H ~yA(cHN`P|7@AX|7@@ b`CbhCKD8{88H `,A$,@NB@tK8{`888H%`T`>,AK48{X8H`T`>,AK 8{D888Hy`,T`>AK8{888HI`,T`>A`K8{<88d8H`,T`>A0K|8{(88d8H`,T`>AKL8{Ŵ8d8H`,T`>AK8{<88=8H`,,AA88/uHA(8,#u@AK |, Ap`AԈ , @HGA`| @ , @; 8ø80cH zeA(@8~8Hx$|0*x&|" H z1A(cHJE`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8KHFi`K@HF]`K|` @K8b8HiA(,A 8w8*cH `KKKpHF`K;@K`HE`K| @K C ,brs_tbreorg_menuaA!b?|8}&N,$|xc$8l!!|*A pA b , @ HE `b| @ b , @ ; 8ø80cH x)A(@8~8Hx&x$|"|@*H wA(cHH`Pb0|#@AX|#@@b`8p0;bh|$@@ 88--b8-~8~~9~-8-<~~|:c,#A 8`##a}H5`b0,@ }8/ccHuA(|zy@ <`-p;c @8`8\8 8899 H`,/A ,,A /A P,AxAD,A,A,A,At, A@, 8d@088(@ 0H )`,T`>A, @`K|` @K K, A, A8@(8H`T`>,ALK, A0Ah8$8899 9@pxH&`,A,Abd, A p`Ab , @H>!`b| @b , @; 8ø80cH q=A(@8}8Hx&x$|"|@* H qA(cHA`Pb0|#@AX|#@@ b`p0bh|$@A8`8KH=5`K4H=)`K|` @K  8ø8d;bpccfH pIA(@8|8Hx&x$|"|0* H p A(cH@`P|;@AX|;@@ b`bhK888H`,A,@NB@xK8`888H!`T`>,AK88X8H5`,T`>AK 8L888H `T`>,A`K8$888H`T`>,A4K8888H`T`>,AK8<88d8H`T`>,AK\8(88d8HY`T`>,AK08Ŵ8d8H)`,T`>AK8<88=8H`,,ATA8/]}H]A(8,#}@,AKbd, A p`Ab , @H8`b| @b , @; 8ø80cH kA(@8}8Hx&x$|"|@* H kA(cH;`Pb0|#@AX|#@@ b`p0bh|$@A8`8K|H7`K4H7`K|` @K 8cc8HA(,A8z8*cH `KİKtK H7Q`Kd;KH7=`K(| @K4 C|brs_idrebuild_menuaAb|!}&N?c8a8c, |`!x$|*A XpA < , @ 8H6]`| @  , @ ;B 8ø80cCH iA(@8z8Hx$|0*x&|"H iMA(cCH9a`Pb0|#@AX|#@@b`8p0;@bh|$@@ X8~8--<--8--8~~,#|f*a<`~~|daA 8##8-bcH`"0,@$8/bHA(|wy@ <`-p: @8`8]8 88 99 H`,/A,,A /A ,A A,A,AhA4,A,8d@8{8(@0H`,T`>At, @HNADd8d8H!`b8tcHM`,@b8c H1`,@b8ļc8H`d8(H`b8c8H`d80H`b8Ӡc8H`d8Hq`bc, @bc, @bc, @Pbc, @ NBK b8Ӵc8H`d8H`NBKb8c8H`d8H`b8c8H`Kxb8Ĵc8H`d8H`K8b8ļc8Hi`d8HU`Kb8Ĵc8H=`d8 H)`K@b8c8H`b8cH=`,@8bc8H`K܈|, APp`AԈ , @0H1`| @ , @; 8ø80cH dA(@8~8Hx$|0*x&|" H dA(cH4`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8 8!|a} !AaN H0`KH0`K|` @K K, A, Ax8, @(08{H}`T`>,AXK, A Ahh8{$8899 9@px8H-`,A ,A|, Ap`AԈ , @H/`| @ , @; 8ø80cH bA(@8~8Hx$|0*x&|" H bA(cH2`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8KH.`K@H.`K|` @K" 8ø8d;pcbYH aA(H@8x8x$x&|0*|" H aA(cH1`P|7@AX|7@@ b`CbhCKD8{888HE`,A$,@NB@K8{`8(88H`T`>,AKt8{X8 H`T`>,AKL8{888H`,T`>AK8{888H`,T`>A`K8{<88d8HU`,T`>A0K8{(88d8H%`,T`>AK8{Ӽ8d8H`,T`>AK\8{<88=8H`,,AAx8/uH!A(8,#u@AK`|, Ap`AԈ , @H*}`| @ , @; 8ø80cH ]A(@8~8Hx$|0*x&|" H ]mA(cH-`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8KH)`K@H)`K|` @K8b8HA(,A`8w8*cH `KHKKH)=`K;@KH))`K| @K C brs_tbexport_menuaA!b?|8}&N,$|xc$8!!|*A pA b , @ H(M`b| @ b , @ ; 8ø80cH [iA(@8~8Hx&x$|"|@*H [-A(cH+A`Pb0|#@AX|#@@b`8p0;bh|$@@ 88--8-~b8~~8~-8-c,#A 8`##a}H}`b0,@ }8/ccHA(|zy@ <`-p;c @8`8^8 88 99 H{`,/A`,,A /A P,AxAH,A,AA,8d@88Ȉ(@t0H`,T`>A, @PNAL}c}H`}8tHA`,@l}8H)`,@0}8ļH`}H`}8H`}H`}8tH`}, @}, @x}, @D}, @ NBKl}8H9`}H)`NBKD}8ŬH`}H`K}8ĴH`}H`Kl}8ӄH`}H`K8}8ĴH`}H`K}8H`}8H`,@t8}HY`K`bd, ATp`Ab , @0H$`b| @b , @; 8ø80cH W9A(@8}8Hx&x$|"|@* H VA(cH'`Pb0|#@AX|#@@ b`p0bh|$@A8`88!|!} AaN H"`KH"`K|` @K K,A, A8, @(8H`T`>,AHK`, A0Ah8$8899 9@pxH `,A,Ahbd, A p`Ab , @H"`b| @b , @; 8ø80cH U-A(@8}8Hx&x$|"|@* H TA(cH%`Pb0|#@AX|#@@ b`p0bh|$@A8`8KH!%`K4H!`K|` @K  8ø8d;bpccfH T9A(@8|8ӌHx&x$|"|0* H SA(cH$ `P|;@AX|;@@ b`bhK888H`,A,@XNB@ KP8`888H`T`>,AK8X8H%`,T`>AK8888H`T`?,A\Kx8<88d8H`T`?,A0KL88d8H`,T`>AK8888Hq`T`?,AK8<88=8HE`,,AA8/]}HA(8,#}@A`, @PNALdHdHHm`b8tc(H`,@b8c0H}`,@b8ļcHH!`dH8H `b8cHH`dH@H`b8XcHH`bc, @bc, @bc, @dbc , @ NBK,AXK, A Ahh8{$8899 9@pxHH`,A ,A|, Ap`AԈ , @H`| @ , @; 8ø80cH G5A(@8~8Hx$|0*x&|" H GA(cH`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8KH9`K@H-`K|` @K" 8ø8d;pcbYH FMA(H@8x8dx$x&|0*|" H FA(cH)`P|7@AX|7@@ b`CbhCKD8{8H8Hڥ`,A$,@NB@K 8{`8888H-`T`>,AK8{X80HE`T`>,AK`8{888 H`,T`>AK08{<88d8H`,T`>A`K8{(88d8Hٵ`,T`>A0K8{Ŵ8d8Hم`,T`>AK8{<88=8HU`,,AA8/uHA(8,#u@AK|, Ap`AԈ , @H `| @ , @; 8ø80cH B1A(@8~8Hx$|0*x&|" H AA(cH`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8KH5`K@H)`K|` @K8b8H5A(,A8w8*cH `KaKDKH `KH;@KH `K| @K C brs_tbalter_menuaA!b?|8}&N,$|xc$8!!|*A xpA \b , @ TH `b| @ 4b , @ ; 8ø80cH ?A(@8~8Hx&x$|"|@*H ?A(cH`Pb0|#@AX|#@@b`8p0;bh|$@@ d88--8~~b8-~<~~|*c,#A 8##8-}PH~`b0,@ }P8/ccH=A(|zy@ <`-p;c @8`8`8 88 9@9 H`}`,/A,,A /A ,AA,A,AdA4,A,8d@88(@0H`,T`>A<, @HNAD}c}HH`}8tH`,@}8H`,@}8ļHI`}H9`}8H)`}H`}8,AHK , A0Ah8$8899 9@pxH`,A,A bd, A p`Ab , @H5`b| @b , @; 8ø80cH 9QA(@8}8Hx&x$|"|@* H 9A(cH )`Pb0|#@AX|#@@ b`p0bh|$@A8`8KHI`K4H=`K|` @K  8ø8d;bpccfH 8]A(@8|8HHx&x$|"|0* H 8A(cH1`P|;@AX|;@@ b`bhK888H̭`,A,@NB@K8`888H5`T`>,AKx8X8HI`,T`>AKL8$x888H`T`>,A\K 8p888H`T`?,A0K8<h88d8H`T`?,AK8(`88d8H˙`T`?,AK8ŴX8d8Hi`,T`>AKl8<P88=8H=`,,A|A8/]P}PH{A(8,#}P@,A H,@4 8{Ǩ8d8@H`T`>,A H,@4 8{X8d8HH`T`>,A H,@ P8,A H,@4 8{d8d8H`T`>,A H,@0 8{888H!`T`>,A PHl,@4 8{X8d8H)`T`>,A H4,@4 8{8d8H`T`>,A H, @l 8{888H`,A ,@cK P8bHk`,A8 bHky`,Ap8bHka`,AX8bHkI`,A@8$bHk1`,A(80bHk`,A8#H8,AH,@Ap,A4 P8{8d88H`T`>,AH PA48{8d8PHy`T`>,AhH P8{8d8HHI`T`>,A8HT,@4 X8{|8d8H`T`>,AH,@0 `8{ͼ88d8H`T`>,AH,A,@4 p8{8d8H`T`>,AH, @ Ap,A4 8{88HY`T`>,AHHd A48{88H%`T`>,AH0 8{88H`T`>,A, @;A8K h8{<88=8H`,A,A hz h8/HiA(,#@Db8H`,#A8az hHi!`z hHi` hbbcHcY` h8/bHhA(,#A<:8cHe%A(0`u8@ebHhMA(,#AHdA(|P0`b8/HhEA(,@`t~b88HdA(,A8t8*bH `KAD;KAH 8{88899 9@pxH9`,A,,ADbd, A\p`A b , A(H`HcK8b0KH`b| @H |` @b , A HY`; 8ø80cH !A(@88Hx&x$|"|@* H !YA(cHm`Pb0|#@AX|#@@ b`p0bh|$@A8`8H8 8ø;p8dccH A(@8}8lHx&x$|"|0* H A(cH`P|<@AX|<@@H 8ø8d;pccH )A(@8}8΄Hx&x$|"|0* H A(cH`P|<@A`HPH@8ø8p8bcx&|:!H A(8bH`P|<@AX|<@@ b`bhHx$!8|*A8pA , A He`H]`| @H | @Ĉ , A H1`: 8ø80bH mA(@8v8Hx$|0*x&|"H 9A(bHM`Pb0|#@AX|#@@ b`p0bh|$@@ 8H8`~~8--8--8-~8-(<--a<`--9--|e|"a<`--|@8-H 8#8-bchHZa`b0,@Tb8/hbH_A(|uyA4b88H[A(,A8u8*bH `<`-p<: :`~`ë.-A @8E bCH]`,8#A8-8Ę% b#H]q`,8#A8-8HbH]E`,Ad8bH]-`,AL8bH]`,A48bH\`,A8bH\`,@@b#8H\`,A(8bCH\`,A8-H 8#b8H\`,AX8 bH\q`,A@8b#H\Y`,A(8bCH\A`,A8-H 8#,>@d (d (@H]`b8ьc (H]`d (HH]`, #A,b8 c (H]y`d (PH]e`, #A@bcX, A,b8c (H]1`d (XH]`, #A@bc`, A,b8c (H\`d (`H\`bcp, A,b8c (H\`d (pH\`, #A4b8tcxHZ`,@8ѐbc (H\]`b8tc HZ`,AH8bc (H\-`b8c HZY`,@8bc (H[`b8c HZ)`,A8xbc (H[`b8 cHY`,@ 8|bc (H[`b 8cHY`,@8DŽbc (H[e`b8HcHY`,A8 cHYu`,Al8<PcHYU`,AL8xcHY=`,A48cHY%`,A8cHY `,@<8 cHX`,A8cHX`,@Lb8c (HZy`b, #c (A HZU`H8HZE`, #A8 cHXa`,A8EHbCHXA`,A8 bCHX)`,@c8HX`,@\b8Tc (HY`b8tc HW`,A,8Ȱbc (HY`d ( HYq`, #Axb8c HW`,A\8єbc (HY5`b8c HWa`,A,8Ȱbc (HY`d ( HX`, #Axb8c HW`,A\8јbc (HX`b8c HV`,A,8Ȱbc (HX`d ( HXq`b8c HV`,A,8Ĵbc (HXA`d ( HX-`b8c (HX`d ( HX`c8`88 88 9 9 H4`,A p,A,@408w8d8 H`T`>,A 4H,@488wǨ8d8 H`T`>,A HP,@b8CHbCHUy`,A8 bCHUa`,At8,A Hp,@8EHeHHT`,AL8 bCHT`,A48,A |H,@48wќ8d8 H`T`>,A DH,@48wѤ8d8 H`T`>,A H`,@48wX8d8 H`T`>,A H(,@48w8d8 HI`T`>,A H, @t8w888 (H`,A h,@HcK88%Hb#HR`,A8 b#HR`,A8EPbCHR`,A|8 bCHR`,Ad8bCHRy`,AL8bCHRa`,A48$bCHRI`,A80bCHR1`,@ aH 8#b#8HR `,A8 b#HQ`,At8,AHX,@48x8d8HHy`T`>,AH ,@4@8w8d8PHA`T`>,AH,@48w|8d8XH `T`>,A\H,@48wͼ88d8`H`T`>,A$Hx,A,@48wΨ8a8pHQ`T`>,AH8,@ 8wȈ8d8xHY`T`>,A, @;AHK8w<88=8hH`,Ap,AP8/EhehHPuA(,#@P8bCH9`,#A8aehHPy`bchHPe`bCh|bDHJ`b8/ChbCHOA(,#A4:8cHLuA(0`q8@ebHOA(,#AHLIA(|P0`bC8/HOA(,@P`p~1bC88HKA(,A$8p8*b%H `K A ;`KA@8wΰ88899 9@px (H`,A,Aﴈy, ATp`A  , A(H `HcK|8b0KlH`| @H |` @ , A Hչ`; 8ø80cH A(@8~8Hx$|0*x&|" H A(cH`Pb0|#@AX|#@@ b`p0bh|$@A8`8H8 8ø;bp8dcccH -A(H@8{8Ѭx$x&|0*|" H A(ccH `P|8@AX|8@@H 8ø8d;bpcccH A(@8{8ѼHx$|0*x&| H eA(ccHy`P|8@A`HPH@8ø8p8bcx&|:!H A(8bH)`P|8@AX|8@@ b`bhHy, A8p`A , A HQ`HI`| @H |` @ , A H`; 8ø80cH YA(@8~8Hx$|0*x&|" H %A(cH9`Pb0|#@AX|#@@ b`p0bh|$@A8`8Hy, A8p`A , A H9`H1`| @H |` @ , A H`; 8ø80cH AA(@8~8Hx$|0*x&|" H  A(cH!`Pb0|#@AX|#@@ b`p0bh|$@A8`8@:8!0|x} !Aa!AaN C4 bra_arch_menu;;;aA;@!b?|8}&,$|xc$8!|*ApAb , @H`b| @b , @;b 8ø80ccH -A(@8{8Hx&x$|"|@*H A(ccH`Pb0|#@AX|#@@ b`p0bh|$@@88--8--b<--9--|:<--8-~8~-|2(@8-8-bc,#@hbc,#@@b88"0b888c99 9@xpH`,Ax,7A`,A,w8,#A4`e`!dc|ey@,7A ,8A`! |8@@0w p,#A H .e`,#A܀,Ab88H ``d8aHA `8apH .`,#A,AH.8@t;58w58ȰHD`,@ ȴ|ȼaȾ8a8, |@H }A(A08 b8@8 pb99!9AH AA(bx$.$(*HB A(@8c8cH``zdzH?`,7@XBz hH?`"0,@ h8/bHDA(|vy@X<`-p8@;: | -Ah,A,@ P8bHC)`,@8#b8,A, @;@8`88899 9@H_}`,At,A ,@c8c```!,8c@ Kz p;585H9`8}58H=Q`,@ B蜹8z pD c8H=`,@H蜹Pz pc8H<`,@ b蜹Xz pd c8H<`,@(r蜹hz ptܹv c8H<`,@ 蜹xz p c8H,AK 8|8d8 H`T`>,A\K x8|Ȁ8d8Hy`T`>,A,Kt p8|8d8HI`T`>,AKD h8|<88=8H`,A,A hz h8/H9}A(,#@Db8HA`,#A8az hH9`z hH9u` hbbcH3` h8/bH9 A(,#@8K$:8cH5}A(y`tb8@H8A(,#@Xb8/H8A(,@`u~b88H5A(,A8u8*bH `KH5A(|P`KH@8ø8bp8bcfx&|:!H A(8bH`P|;@A$K `8|ͼ88d8Hm`T`>,A Kh X8||8d8H=`T`>,AK8 P8|8d8XH `T`>,AK H8|88d8H`T`>,AKb8HH5`,A8\bH5`,A8hbH5`,Al8xbH5y`,AT8bH5a`,A<80bH5I`,A$8#K b8 H5%`,A8bH5 `,A8bH4`,A8$bH4`,A80bH4`,A8#K|bd, A p`Ab , @H9`b| @b , @; 8ø80cH UA(@8~8Hx&x$|"|@* H A(cH-`Pb0|#@AX|#@@ b`p0bh|$@A8`8KHM`K4HA`K|` @K 8|X8d8HQ`T`>,AKL 8|888H`T`>,AK 8|d8d8H`T`>,AK P8,A\Kb8HH2`,A8\bH2q`,A8hbH2Y`,A8z H2A`|`4T@bhKlbpK` 8|X8d8HH`T`>,AK 8|Ǩ8d8@H`T`>,AK 8|8d80H`T`>,APK;K4z ؒz HH3-`z 8 H3`z PH3 `, #Az X, @, #Az `, @Tz 8ŬH2`z pH2`, #@z , @z 8tH0`,@,z 8H0`,@tz 8H2Y`z , #AD H2=`z 8H0m`,@z 8H0U`,@, #@hz 8H01`,@,z 8H1`z H1`cKxz 8ĴH1`z H1`Kz 8H1`z H1}`K|z 8H1i`z H1Y`KLz 8TH1E`z 8tH/u`,A 8Ȱz H1`z H1 `K8H0`Kz 8xH0` 8cH/`,A`c8H.`,A0c8H.`,@88DŽz H0`K$z 8LH0y` Kz 8|H0a` Kz 8H0I`z 8H.y`,@8z H0!`Kz 8H0 `z H/`Kdz x8H.)`,A<8z H.`,z @$8H/`z xH/`K8фH/`z xH/`Kz 8H/u`z `H/e`Kz 8H/Q`z XH/A`KPb8H-m`,Ab8xH-U`,A8bH-=`,A8bH-%`,A8-Kb8H-`,A8bH,`,A8bH,`,A8@AX|>@@ b`h8`8H`,AKH`8bKH/ `8bK8#KdKH=`KLH1`K| @K$ C  brb_bdb_menu;;aA;`b|!}&?aA:`8!xp~B"8c~, !|`x$|*A|pAԈ , @\H`| @ , @0: 8ø80bH AA(@8w8Hx$|0*x&|"H A(bH!`Pb0|#@AX|#@@ b`p0bh|$@@88--8`~-8--:~(<--8--a<`--|"|fa@08-8-v,#@v,#@b08v888899 9@x pH `,A,4A,A8,$A8````!`,$@,4A8B:ȴȴ```!:458t58ȰH'U`,@,A\, @P;`@LK8<eH `,@8v`8x8d8Hp`T`>,AKb8\H`,A, @vhKvpK8xʨ88'8H=`T`>,AK08x<88=8HpM`,A`,AT8/eH A(,#@P8bHm`,#A$8aeH `bcH `b}bH`b8/bH -A(,#@8b0@K98cHA(0`o8@eaHA(,#@\b8/HA(,@X`n}b88HA(,A48n8*aH `@ KpHA(|xP0`KH@8ø8p8bbx&|:!H A(8bH`P|7@AK8xͼ88d8Hnu`T`>,AK(h8x8d8HnE`T`>,ATK8xȀ8d8Hn`T`>,A$K8x88d8Hm`T`>,AKb8H`,A8bH`,Atn, ,rAAx,#sAp, AdA,#sA, A , tA@, pA88-K4b8H1`,A8bH`,A܈, @Јn, rA, sAb8cH`,A8#Kb8\H`,A`8xbH`,AH8bH`,A080bHq`,A8#K`KbcK#Kt, AKTикK@y, Ap`AԈ , @H`| @ , @; 8ø80cH ֱA(@8}8Hx$|0*x&|" H }A(cH`Pb0|#@AX|#@@ b`p0bh|$@A8`8KH`K@H`K|` @KAb`, #A`8xt88899 9@pxH`,A,Ay, Ap`AԈ , @H`| @ , @; 8ø80cH 9A(@8}8Hx$|0*x&|" H A(cH`Pb0|#@AX|#@@ b`p0bh|$@A8`8KH=`K@H1`K|` @K8xt88899 9@pxH5`,AHK8 8ø;bp8dccbH A(H@8{8x$x&|0*|" H A(ccH`P|7@AX|7@@K8x8d8Hhu`T`>,AK(8xX8d8xHhE`T`>,ATK8x888pHz`T`>,A$KH8xX8d8hHg`T`>,AK88xǨ8d8`Hg`T`>,AKh08x8d8XHg`T`>,AK8;MAKdCdH `b8cH`dH`b8 cH`dH`, #Abc, @xb8cH`dHq`b8TcH]`, #@bc, @b8tcXHi`,@Db8tc`HM`,Ab8cH`b, #cAhH`, #@b8cxH`,@48bcH`dH}`cK|b8ĴcHa`dxHM`b8cH9`Kb8cH!`dpH `KL8H`K0b8xcH`Kb8cH`b8cXH`,@8bcH`K|b8cH`dHq`K4b8tcH`,A8ȰbcH=`dH)`Kb8cH`dH`Kdb8H)`,A8bH`,A8-Kb8\H`,A08xbH`,A8bH`,A8bH`,A8-K8bc8HmA(,Al8r8*b%H `KT8cb$8He`s`sK8ab$HI`KH8 H 9A(K8ab$H%`K8`8H1`,A,AK H@8ø8p8bcx&|:4 H A(8bH`P|<@AX|<@@ b`h8`8H`,AtK`Hm`8KH`8K8#KԈKxH`KH`K| @\K C4 brr_dbv_menu;;;;aA!; ;::aA!xpb?g|8}&,$|xc$8 !|*A;pAb , @;H`b| @b , @;X;B 8ø80cCH A(@8z8Hx&x$|"|@*H ˉA(cCH`Pb0|#@AX|#@@ b`p0bh|$@@:88-~b8--8--8-=--|B<--c|(@:T8-8-bc,#@: bc,#@9Bb8808cHɁ`,AD,:A98,A9z,#A8`eD``!dcE|eyD@,:A B"ȴ00```!a, @8dj, @8,s, @7|, @7, @7, @7L, @7, @6܈, @6, @6l, @64, @5, @5Ĉ, @5, @5T, @5, @4, @4, @4t , @4<, @4, @3̈', @30, @3\9, @3$B, @2K, @2T, @2|], @2Df, @2 o, @1؈x, @1: :`, @(P, A, @(0|d:|j8 b|8 p8cE9H 5A(,A<,@0bH A(8a8b|`H A(,A<,@0bH A( 8j8b|`H ǵA(,A<,@0bH A(8s8b|`H uA(,A<,@0bH MA(8|8b|`H 5A(,A<,@0bH A(88b|`H A(,A<,@0bHA(88b|`H ƵA(,A<,@0bHA(88b|`H uA(,A<,@0bHMA("88b|`H 5A(,A<,@0bH A(&88b|`H A(, A<,@0bHA(*88b|`H ŵA(, A<,@0bHA(.88b|`H uA(, A<,@0bHMA(288b|`H 5A(, A<,@0bH A(688b|`H A(, A<,@0bHA(:88b|`H ĵA(,A<,@0bHA(>88b|`H uA(,A<,@0bHMA(B88b|`H 5A(,A<,@0bH A(F88b|`H A(,A<,@0bHA(J88b|`H õA(,A<,@0bHA(N88b|`H uA(,A<,@0bHMA(R8 8b|`H 5A(,A<,@0bH A(V88b|`H A(,A<,@0bHA(Z88b|`H µA(,A<,@0bHA(^8'8b|`H uA(,A<,@0bHMA(b808b|`H 5A(,A<,@0bH A(f898b|`H A(,A<,@0bHA(j8B8b|`H A(,A<,@0bHA(n8K8b|`H uA(,A<,@0bHMA(r8T8b|`H 5A(,A<,@0bH A(v8]8b|`H A(,A<,@0bHA(z8f8b|`H A(,A<,@0bHA(~8o8b|`H uA(,A<,@0bHMA(8x8b|`H 5A(b. x$~ *HA(@88cb8H``ydyH`;Z@y@"y `H`0,@ `8/bHA(|vy@|H<-p8@bP,At, @c~h AK,@@8{888HC`,A0,@c~h AKAb, #`At8{tpx8899 9@Hc}`,A,Apbd, Ap`Ab , @Hz`b| @b , @8b8ø80H A(8H8b8cx&| x$|@*H A(8bH}`0bP| @Ab0X|#@@ b`0bp| @Ac8K,Hz`K,AK8{X8d8HHA `T`>,AXK8{Ǩ8d88H@`T`>,A(K8{8d80H@`T`>,AKb0, A$````!`, @y 0Hy`y x8tHI`,y @A@8ƬH MA(y H"8ƬH 9A(:L~`&~h AK &8ƬH A(y H*8ƬH A(Kyy 8H}`y x8tH`,yA8ŤHU`bn, Ab0,=AMbB``!8ty xHY`,A, A`@yH`8yH`bH)A(|t8ƬH A( }|@ Ma,=@xy8 H`y PH}`, #Ay X, @y8HQ`y hHA`y8TH1`, #@$y8tHU`,@y8tH=`,Ay8H`y, #AtH`y8H`,@,y8H`yH`cK(y8ĴHy`yHi`K8HY`Ky8xHE`KPy8H1`y8Ha`,@8yH `Ky p8tH5`,A8ȰyH`y pH`Ky8H`y XH`KH8XyH`bHA(|t"8ƬH A(K8yH]`K\$, A@yH9`8yH)`bHqA(|t&8ƬH eA((}$|AL8XyH`bH-A(|t*8ƬH !A(K8yH`Kdy @H`y H @H`,A8XyHq`y HHa`K8lHQ`KbC8xH}`,A8bCHe`,A8bCHM`,A8-KHA(}$y HHA(}(K88ø8b8dpH A(8<H8b8cx&| x$|@*H A(8bHu`pbP| @A,Xbp|#@@$K x8{8d8 H:a`T`>,AK8y P8,AdKbK h8{ʨ88'8HL`T`>,A,K `8{<88=8H9`,A,AY `y `8/HA(,#@@bC8HJ`|ryAy `8H!`y `bDH`Y `bbDcHY`Y `8/bCHA(,#A:#8cH%A(0`p8@ob#HMA(,#@`bC8/H]A(`q,@~bC88HA(,A8q8*bH `~h AKHA(|P`K~h b0ATKl8ø8H8bpx&|!H UA(8bHsi`pbP| @AK X8{ͼ88d8H7`T`>,ADK P8{8d8hH7`T`>,AKy @, @@bn|4T~ H|e8{L8HJ=`T`>,AKTHA(Ky Hn,$|4T~@4{X @|f8{`~E8HI`T`>,AlKHA(K 88{88d8H6`T`>,A4KbC8H`,8-ALKLbC8H`,A 8bCH`,A_, r,sL3A, A, @Ȉ, @8-KbC8H1`,Ax8bCH`,A`8Ԉ_, r,sL3AHy pH`8#,A0K0bC8xH`,A8bCH`,A80bCH`,8#AἘKb88HaA(,A8v8*cH `K88cb8HmQ`y`yKlccK8zE:E8ȰH`,@ {ȼȾa, @|d:|j8 b|8 p8cE9H A(,A<,@0bHA(8a8b|`H A(,A<,@0bH]A( 8j8b|`H EA(,A<,@0bHA(8s8b|`H A(,A<,@0bHA(8|8b|`H A(,A<,@0bHA(88b|`H A(,A<,@0bH]A(88b|`H EA(,A<,@0bHA(88b|`H A(,A<,@0bHA("88b|`H A(,A<,@0bHߝA(&88b|`H A(, A<,@0bH]A(*88b|`H EA(, A<,@0bHA(.88b|`H A(, A<,@0bHA(288b|`H A(, A<,@0bHޝA(688b|`H A(, A<,@0bH]A(:88b|`H EA(,A<,@0bHA(>88b|`H A(,A<,@0bHA(B88b|`H A(,A<,@0bHݝA(F88b|`H A(,A<,@0bH]A(J88b|`H EA(,A<,@0bHA(N88b|`H A(,A<,@0bHA(R8 8b|`H A(,A<,@0bHܝA(V88b|`H A(,A<,@0bH]A(Z88b|`H EA(,A<,@0bHA(^8'8b|`H A(,A<,@0bHA(b808b|`H A(,A<,@0bH۝A(f898b|`H A(,A<,@0bH]A(j8B8b|`H EA(,A<,@0bHA(n8K8b|`H A(,A<,@0bHA(r8T8b|`H A(,A<,@0bHڝA(v8]8b|`H A(,A<,@0bH]A(z8f8b|`H EA(,A<,@0bHA(~8o8b|`H A(,A<,@0bHA(8x8b|`H A(b. x$~ *HٕA(@Hc8cb8Hdy``ydyH]`;K88cb8Hd5`y`yyH`KccK8abH`K8zx::`|Hڽ`,AHK<8zo::`xHڕ`,A K08zf::`tHi`,AK08z]::`pH=`,AK͘08zT::`lH`,A͜K`08zK::`hH`,ApK(08zB::`dHٹ`,ADK08z9::``Hٍ`,AK̸08z0::`\Ha`,AK̀08z'::`XH5`,AKH08z::`TH `,A̔K08z::`PH`,AhK08z ::`LHر`,A@AX|>@@ b`h8`8H~`,A KlHt`bKHu`bK8#KŰKXH]-`KĤH]!`Kp| @,A, @LNAHd d xH`b8ϸc H`b8Ŭc H`d H`bc , @Pb8tc H`,@b8tc H`,Ab8c H}`d Hi`b8c HЕ`,@48bc H9`d H%`NBK0b8Ĵc H `d H`b8c H`Kb8xc H`K8b8c Hѱ`b8c H`,@8bc Hс`Kb8c Hi`d HU`K|, ATp`A؈ , @4HX%`| @ , @; 8ø80cH IA(@8~8Hx$|0*x&|" H A(cH[)`Pb0|#@AX|#@@b`8p0bh|$@@`88`8 8!|} !AaN KHW`KHV`K|` @K, A$Ata8{H8899 9@ pxH>`,AP,A|, Ap`A؈ , @HVi`| @ , @; 8ø80cH A(@8~8Hx$|0*x&|" H YA(cHYm`Pb0|#@AX|#@@b`8p0bh|$@@ 88`8KDKHU`K4HUy`K|` @KB8 8ø;"p8dc#cH A(H@8y8x$x&|0*|" H ]A(c#HXq`P|8@AX|8@@b`8bh8Kp8{8 8H`,AP,@NB@\K8{X8 H`T`>,AK 8{888 H/A`,T`>AK8{Ǩ8d 8 HQ`,T`>AK8{08d8 H!`,T`>AK8{88 H`,T`>AXK`8{8d 8 H`,T`>A(K08{<88=8 H`,,AAP8/ w HA(8,#w @A K(|, Ap`A؈ , @HQ=`| @ , @; 8ø80cH aA(@8~8Hx$|0*x&|" H -A(cHTA`Pb0|#@AX|#@@b`8p0bh|$@@ 88`8KKHPY`K4HPM`K|` @K8cC8HYA(,A 8y8*cH `K8`#aKKpHO`KHO`K| @TK C brb_compr_menuaA!b?|8}&N,$|xc$8@!!|*A ppAb , @ LHO `b| @b , @ ; 8ø80cH )A(@8~8Hx&x$|"|@*H A(cHR`Pb0|#@AX|#@@b`8p0bh|$@@ h88--8~-b8--8-<--|2c(@ ~ HE`0,@ ~ 8/ccHƅA(|zy@ <`-p;c @8`88 88 9 9 H`,/A ,,A /A,AA,A,A`A,,A,8dA, 8@4 8HM`T`>,A, @PNAL~ c~  H`~ 8ϘH`~ 8ŬHŹ`~  Hũ`~ , @~ 8tH`,@~ 8tHñ`,A~ 8HY`~  HI`~ 8Hy`,@,~ 8H!`~  H`NBKd~ 8ĴH`~  H`K~ 8xH`Kl~ 8H`~ 8H`,@,8~ Hę`K~ 8Hą`~  Hu`Kbd, A`p`Ab , @,AKL8 888H"-`T`>,AK 8Ǩ 8d8 H=`,T`>AK8 8d80H `,T`>ATK8 88H`,T`>A$K8 8d8(H`,T`>AK`8< 88=8H`,,AA8/^ ~ HA(8,#~ @@AX|>@@K8 88d8H `T`?,AKtbd, A,p`Ab , @HD5`b| @b , @; 8ø80cH wQA(@8~8Hx&x$|"|@* H wA(cHG)`Pb0|#@AX|#@@b`8p0bh|$@@$88`8KKHC=`K(HC1`K|` @K8cc8H=A(,AP8z8*cH `K88`#aKKHB`KHB`K| @K C brb_prep_menu;;aA;`b|!}&;>aA:@8P!~B"8c~, !|`x$|*A8pAԈ , @HA`| @ , @: 8ø80bH tA(@8v8Hx$|0*x&|"H tA(bHD`Pb0|#@AX|#@@ b`p0bh|$@@H88--8`~-8--8-<--(|2a@v,#@v ,#@b08v888899 9@x pHu`,AD,4A,A8,$A,`!`,$@,4Ab0c ,3AX```!b0 |3@@0t p,#A H Q`,#A,Ab88H e``d8aH`8apH `,#AT,A s.3@p:t58t58ȰH`,@ ȴwȼaȾ8a8, |@ ``rv rH`,4@Tbc H`b0#,@$b8/c bcHA(|ry@ <`-p8@:c -| ,````!A p@,8A8`88 88 9 9 H`,A,@c}K,A,A0,A,A,A,AP,A ,@8w8d8 H`T`>,A, @(;K y, A\p`AԈ , @`Pb0|#@AX|#@@ b`p0bh|$@A8`8KH:%`K@H:`K|` @K8 8ø;bp8dcccH m5A(H@8{8ψx$x&|0*|" H lA(ccH=`P|8@AX|8@@ b`bhK@8wX8d8 H`T`>,A, @(;K  8wǨ8d8 HI`T`>,AK08w8d8 H`T`>,AK8w88 H`T`>,AxKd8wȀ8d8 H`T`>,AHK48w<88=8 H`,A,A0b8/C bCHA(,#@L8bCH`|ryAb8c H`bbDc H`bC }bDH!`b8/C bCHmA(,#A:#8cHA(0`p8@eb#HA(,#@XbC8/H!A(,@L`qbC~88HiA(,A(8q8*bEH `KHiA(|P0`K8b0KH@8ø8p8bcx&|:!H jA(8bH:-`P|<@A,X|<@@(K8w88d8 H`T`>,A@K,d Ȓcd HE`b8hc H1`d H`b, c At8pH`bc , @(b8tc H`,@b8tc H`,Ab8c H`,@48bc H`d Hm`cKb8Ĵc HQ`d H=`b8c H)`Kb8xc H`K`b8c H`b8c H%`,@8bc H`Kb8c H`d H`K8|H`K 8`88899 9@Ha`,A4,A,@c8c`!,8c@ K8 b8f H Ri``dccHY`b8Ec HE`, @\, @Pb, c A$;;`MK`;;`MKbc Ky, Ap`AԈ , @H39`| @ , @; 8ø80cH f]A(@8}8Hx$|0*x&|" H f)A(cH6=`Pb0|#@AX|#@@ b`p0bh|$@A8`8K,A, @,NK$bd, A`p`Ab , @,A, @NK8Ǩ X8d8 He`,T`>AK8 P8d80H5`,T`>AtK8Ψ H8cf8H`T`?,AH@dNK\8 @8d8 H`,T`>AK08 88d8XH`,T`>AK8< 088=8Hu`,,AA^ 0~ 08/HA(,#@@8cCH`|zyA~ 08H`~ 0cDH`^ 0bcDcH`^ 08/cCHiA(,#A;#8cHA(}`xc#8@HA(,#@XcC8/H!A(,@`ycC88HiA(,A8y8*cEH `KHiA(|P`K8KH@8ø8p8bcx&|:!H Z!A(8bH*5`P|>@AX|>@@K8 (88d8H`T`?,AKbd, A,p`Ab , @H&5`b| @b , @; 8ø80cH YQA(@8~8Hx&x$|"|@* H YA(cH))`Pb0|#@AX|#@@b`8p0bh|$@@$88`8KKH%=`K(H%1`K|` @K~ p~ p (H `8 ~ pH` 8~ pH`8t, #A@~ @H `8,~ p@$H`~ H, @~ P8tH`,@8t~ XH`,Ah8~ `H`,@,8~ pHM` h~ pH=`NBK8Ĵ~ pH%` `~ pH`K8x~ pH`K8~ pH`8~ PH`,@L8~ pH`K88~ pH` H~ pH`K8~ pH`K8cc8HA(,A8z8*cH `KKKHH#=`KH#1`K\| @,Kh C H bra_deld_menuaA|!}&Nb8c>!18p, |`x$|*ApA؈ , @H"M`| @ , @;B 8ø80cCH UqA(@8z8Hx$|0*x&|"H U=A(cCH%Q`Pb0|#@AX|#@@b`8p0bh|$@@ 88`--8-<--|c"(a@B"<`-p; @8`88889p9 Hvi`,/A,,AdA,,A,8dA8@P8wH`T`?,A@xNAtddxH`b8cH`dH}`b8cH`,A48bcHM`dH9`NBKb8cH`b8cH `K|, ALp`A؈ , @,H`| @ , @; 8ø80cH RA(@8~8Hx$|0*x&|" H RA(cH"`Pb0|#@AX|#@@b`8p0bh|$@@X88`88!|} !AaN KH`KH`K|` @K,A$Ata8wΰ@8899 9@pxH`,AX,A|, Ap`A؈ , @H%`| @ , @; 8ø80cH QIA(@8~8Hx$|0*x&|" H QA(cH!)`Pb0|#@AX|#@@b`8p0bh|$@@ 88`8KLKHA`K4H5`K|` @Kb8 8ø;B"p8dcCc&H PQA(H@8z8x$x&|0*|" H PA(cCH -`P|9@AX|9@@b`8bh8Kx8w88H`,,AT@NB@K8w 8Hm`T`>,A , KP8{8d8H9`,T`>A, K8w88d8xH`,T`>A, K|, Ap`A؈ , @H`| @ , @; 8ø80cH NA(@8~8Hx$|0*x&|" H NuA(cH`Pb0|#@AX|#@@b`8p0bh|$@@ 88`8KKH`K4H`K|` @K8`#aKKHi`K4H]`K| @K C  bra_rctl_menuaAb?G|}&N8|,$xc$8!A|*A pAb , @ H`b| @b , @ ; 8ø80cH LA(@88Hx&x$|"|@*H LuA(cH`Pb0|#@AX|#@@b`8p0bh|$@@88--8-~b8-8#(@<`-p<; `ë````!8H`8#,A8~@8`8 88899 Hm]`,/At,,ATA$,A,AA|,8A4,8@8z|H`T`>,A, @DNK,A, @NK8z8d80Hە`,T`>AK8zΨ8c8H)`T`?,A@NK8zΜ8d8H1`,T`>AHK`8z88d8H`T`?,AKbd, A,p`Ab , @H}`b| @b , @; 8ø80cH EA(@88Hx&x$|"|@* H E]A(cHq`Pb0|#@AX|#@@b`8p0bh|$@@$88`8KKH`K(Hy`K|` @KȓHQ`8̜HA`8ccHm`,cc@8H`, @8tH1`,@p8H`H`, #A, @ NBKh8H`H`NBK@8Hm`8H`,@p8HE`K\8H1`H!`K 8HQ`,@8ΔH`KK\K H`KhH`K4| @K@ C hbrb_itape_menuaAb|!}&N>88c!1, |`x$|*A pA؈ , @ H`| @ , @ ;b 8ø80ccH BA(@8{8Hx$|0*x&|"H AA(ccH`Pb0|#@AX|#@@b`8p0bh|$@@88--8`-~8-8#(a@b<`-p<;C `ë````!8bcH`8#,A8~@8`8!88899 Hb`,/At,,A(A,A,AAP,8A,8@8w|He`T`>,A, @A(@8~8Hx$|0*x&|" H =A(cH `Pb0|#@AX|#@@b`8p0bh|$@@ 88`8KKH `K4H `K|` @Kb8 8ø;B"p8dcCc&H =A(H@8z8μx$x&|0*|" H ,A, @AK8wΨ8c&8H`,T`>AK8wΜ8d8H`,T`>AxKd8w88d8HЙ`,T`>AHK4|, Ap`A؈ , @H`| @ , @; 8ø80cH ;AA(@8~8Hx$|0*x&|" H ; A(cH !`Pb0|#@AX|#@@b`8p0bh|$@@ 88`8K@KH9`K4H-`K|` @KdCdH`8̜bcH`8bcH~`,c@88eH`bc, @8tbcH}`,@8bcHq`bcH]`b, #Ac, @ NBK8bcH!`bcH `NBK\8bcH~`8bcH}`,@T8bcH~`K<8bcH~`bcH~`K8H|`,@8ΔbcH~i`KK`K(HM`KxHA`KL| @ KT C Xbra_itape_menu|}&aAN!!?8ab,$8|xc$|*A PpA 4b , @ ,Hi`b| @ b , @ ; 8ø80cH 7A(@8~Hx&x$|"|@*H 7IA(cH]`Pb0|#@AX|#@@b`8p0;bh|$@@ <88-*8-~b8--8-, A 8##} Hv`} Hv`b0,@ } 8/ccH{A(|zy@ h8aHz5`,A 8ͬaHz`,A <`-p;c @8`8"8 88 9 9 HW`,/A,,A|AL,/A,AA<, @PNAL} c}  Hz`} , @} 8ŬHz`} Hz`} 8Hz`}  Hz`} 8tHx`,@L} 8ļHz}`}  Hzm`} 8Hz]`}  HzM`NBK} 8Hz5`} 8Hxe`,@8} Hz `K} 8Hy`}  Hy`Kbd, ATp`Ab , @0H`b| @b , @; 8ø80cH 3A(@8}8Hx&x$|"|@* H 3A(cH`Pb0|#@AX|#@@ b`p0bh|$@A8`88!|!} AaN H`KH`K|` @K0K4a8Hv`,A8ͬaHv`c,@K8d8A,@(8 HE`T`>,AK, A0AX 88899 9@pxH`,A,Abd, A p`Ab , @Hq`b| @b , @; 8ø80cH 1A(@8}8Hx&x$|"|@* H 1QA(cHe`Pb0|#@AX|#@@ b`p0bh|$@A8`8KH`K4Hy`K|` @K  8ø8d;bpccfH 0A(@8|8Hx&x$|"|0* H 0YA(cHm`P|;@AX|;@@ b`bhK 888H`,A,@NB@K8` 88Hu`T`?,AKP8ʨ 88'8HI`T`?,A\K$8< 88=8H]`,,A0AH8/] } HtA(8,#} @A, @`NKXbd, AHp`Ab , @$Hu`b| @b , @; 8ø80cH 'A(@8~8Hx&x$|"|@* H 'UA(cHi`Pb0|#@AX|#@@ b`cp0bh|$@Acc8`ʀ} 88!|aN Ha`K HU`K|` @K,8@4 888Ha`,,Al@NBKA 888899 9@pxXH `,A,Ahbd, A@p`Ab , @H`b| @b , @; 8ø80cH %A(@8~8Hx&x$|"|@* H %eA(cHy`Pb0|#@AX|#@@ b`cp0bh|$@Acc8`a} 88!|N Hy`KHm`K|` @K 8ø8d;pcc~H $A(@8}8Hx&x$|"|0* H $MA(cHa`P|<@AX|<@@ b`cbhcK 8`888H˙`T`>,A, @0NK(88d8 H`,T`>AK8ʨ88'8H1`T`>,A|K8ͼ88d8HE`T`>,APKl88d8H`,T`>A K<888d8H`T`>,AKbd, A@p`Ab , @Ha`b| @b , @; 8ø80cH "}A(@8~8Hx&x$|"|@* H "AA(cHU`Pb0|#@AX|#@@ b`cp0bh|$@Acc8`a} 88!|N HU`KHI`K|` @K8~ Hg)`8~HeY`,@|8~ Hg`Kh8~ Hf`~ Hf`K 8~ Hf`~ Hf`KK<KH`KD;`KH`K| @K C brv_disas_menuaAb|!}&N?c8a8c, |`!x$|*A ppA T , @ PH`| @ 4 , @ ;B 8ø80cCH A(@8z8Hx$|0*x&|"H A(cCH`Pb0|#@AX|#@@b`8p0;@bh|$@@ p88--8`-~8~-,$aA <8##8-bc H^`"0,@$8/ bHd-A(|wy@ <`-p: @8`8?888 9 9 H@e`,/A,,A@/A,A4A,A,A8d8AX,@ 8{ HH`T`>,A, @\NAXd Pd P Hc`b8tc 8Ha`,@b8ļc PHcU`d P @HcA`b8c PHc-`d P HHc`b8c PHc`bc (, @Pbc 0, @ NBKb8c PHb`d P 0Hb`NBK\b8Ťc PHb`d P (Hb}`Kb8c PHbe`b8c 8H``,@8bc PHb5`K̈|, APp`AԈ , @0H`| @ , @; 8ø80cH )A(@8~8Hx$|0*x&|" H A(cH `Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8 8!|a} !AaN H`KH`K|` @K,A Aha8{$h8899 9@ PpxH`,AT,A,|, Ap`AԈ , @HM`| @ , @; 8ø80cH qA(@8~8Hx$|0*x&|" H =A(cHQ`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8KHHu`K@Hi`K|` @K" 8ø8d;pcbYH A(H@8x8x$x&|0*|" H QA(cHe`P|7@AX|7@@ b`CbhCK8{8 P8H`,Al,@DNB@K<8{`8 @8Hm`T`>,A4K8{08d8 8H}`,T`>AK8{88d8 0HM`,T`>AKP8{Ŵ8d8 (H`,T`>AK 8{<88=8 H`,,AtAP8/ u H]IA(8,#u @AK$|, Ap`AԈ , @H`| @ , @; 8ø80cH A(@8~8Hx$|0*x&|" H A(cH`Pb0|#@AX|#@@ b`Cp0bh|$@ACC8`8KH`K@H`K|` @K8b8HVA(,A88w8*cH `K K̈KHe`K;@KHQ`K| @K C brs_fback_menu;;;aA!b?|8}&,$|xc$8!|*A@pA b , A HY`HQ`b| @H | @b , A H`;b 8ø80ccH YA(@8{8Hx&x$|"|@*H A(ccH1`Pb0|#@AX|#@@ b`p0bh|$@@ 8H8~b8--8~~8-=--|Bc(@ H 8`#ab{ HRa`B0:,@P 8/cHWA(|wyA4c88HSA(,A8w8*c%H `"<`-p; .-A@,>@{ȓ{HWi`{8HU`,@8{HWA`{8tHUq`,@8x{HW`{8HUI`,A$8Ĵ{HV`{HV`{8HV`{HV`{8̌HV`{(8tHT`,@8̘{HV`{0, A${8ĴHVi`{0HVY`{88tHT`,@8̜{HV1`{@8tHTa`,@8ʘ{HV `{H, A4{8ǠHU`{HHU`{8HU`c8`8%88899 H1`,A|,A,@48|8d8 H`T`>,A@Hh,@48|Ǩ8d8 Hq`T`>,AH0,@48|X8d8H9`T`>,AH,@48|8d8H`T`>,AH,@(8|888H`,Ah,@cK8`8$88899 H0`,A,,A,@08|88d8H]`T`>,AH,A(,@4(8|8d8 H`T`>,AH,@008|<88d8H`T`>,AH,@488|8d8 H`T`>,AHHp,@4@8|̰8d8 Hy`T`>,AH8,@H8|88HA`T`>,A, @`;AtKX 8|<88=8H`,A,A( { 8/HReA(,#@Db8H)`,#A8a{ HRm`{ HR]` bbcHL` 8/bHQA(,#A4:8cHNqA(z`ub8@HQA(,#AHNIA(|P`b8/HQA(,@@`v~b88HMA(,A8v8*bH `KA@;KAP8|888899 9@pxH`,A(,Abd, AXp`Ab , A$H`HcKd8KXH`b| @H |` @b , A Hױ`; 8ø80cH A(@8~8Hx&x$|"|@* H A(cH`Pb0|#@AX|#@@ b`p0bh|$@A8`8H8 8ø;bp8dccfH A(@8}8̠Hx&x$|"|0* H A(cH`P|;@AX|;@@H 8ø8d;bpccfH A(@8}8̸Hx&x$|"|0* H AA(cHU`P|;@A`HPH@8ø8bp8bcfx&|:!H A(8bH`P|;@AX|;@@ b`bhH@ { { HH`{ `8HG `,@8{ HH`{ h8tHF`,@8x{ HH`{ 8HF`,A$8Ĵ{ HHa`{ HHQ`{ 8HHA`{ HH1`{ 8ʌHH!`{ 8HH`{ HH`{, A${ 8ĴHG`{ HG`{, A4{ 8ǠHG`{ HG`{ 8HG`{ , A4{ 8HGq`{  HGa`{ 8HGQ`{ 8HGA`{ pHG1`{ x, AL{ 8HG`{ xHG`{ 8tHE1`,@8{ HF`c8`8'888 9 X9 H"`,A,A,@4 `8|8d8 H`T`>,AH,@4 h8|Ǩ8d8 H`T`>,AtH,@4 p8|L88H `T`>,A,AH0,@4 8|8d8 H`T`>,AH,@4 8|X8d8H`T`>,AH,@4 8|8d8Hm`T`>,A`H,@ 8|88 8H9`,A0,@cK8`8&88899 H `,A,A,@08|88d8H`T`>,AH,A,@48|88d8H`T`>,A|H,@08|<88d8HU`T`>,AHHp,@48|88H`T`>,AH8,@ 8|88H`T`>,A, @;AK8|<88=8H`,A,A\{8/HC A(,#@Db8H`,#A8a{HC`{HC`bbcH=I`8/bHBA(,#A4:8cH?A(z`tb8@HBAA(,#AH>A(|P`b8/HB=A(,@t`u~b88H>A(,AH8u8*bH `K0A@;K$AP 8|888899 9@pxH1`,A(,Abd, AXp`Ab , A$Hȩ`HcK8KHȉ`b| @H |` @b , A HU`; 8ø80cH A(@8~8Hx&x$|"|@* H UA(cHi`Pb0|#@AX|#@@ b`p0bh|$@A8`8H8 8ø;bp8dccfH A(@8}8(Hx&x$|"|0* H }A(cHʑ`P|;@AX|;@@H 8ø8d;bpccfH %A(@8}8DHx&x$|"|0* H A(cH`P|;@A`HPH@8ø8bp8bcfx&|:!H A(8bHɩ`P|;@AX|;@@ b`bhH@dXdXH9`b8ŬcXH9`dXH9m`b8cXH9Y`dXH9E`bc, A,b8cXH9`dXH9 `b8tc0H75`,AH8bcXH8`b8c0H7`,@8bcXH8`b8tc8H6`,@8xbcXH8y`b8cXH8e`dX@H8Q`b8cHH6}`,A,8ĴbcXH8!`dXHH8 `b8cXH7`dXPH7`c8`8)8889(9 H`,A(,A,@408x8d80H`T`>,AH@,@4 8xǨ8d88H`T`>,AH,@48x888@H`T`>,A|H,@48xX8d8HH`T`>,ADH,@48x8d8PH`T`>,A H`,@8x888XH`,A,@cK8`8(88899 Hi`,A,Ax,@48x88d8H1`T`>,A\H,A,@408x8d8H`T`>,AHp,@48x88H`T`>,AH8,@8x88H`T`>,A, @p;AKh8x<88=8HA`,Ap,A48/eH4A(,#@P8bHa`,#A8aeH4`bcH4`b|bH.`b8/bH4!A(,#A4:C8cH0A(0`s8@ebCH3A(,#AH0qA(|P0`b8/H3A(,@4`r~sb88H0A(,A8r8*beH `KA ;`KAH8x88899 9@pxXH`,A,Ay, ATp`A  , A(H1`HcK`8b0KPH `| @H |` @ , A H`; 8ø80cH A(@8~8Hx$|0*x&|" H A(cH`Pb0|#@AX|#@@ b`p0bh|$@A8`8H8 8ø;bp8dccbH UA(H@8{8x$x&|0*|" H A(ccH1`P|7@AX|7@@H 8ø8d;bpccbH A(@8{8 Hx$|0*x&| H A(ccH`P|7@A`HPH@8ø8p8bbx&|:!H =A(8bHQ`P|7@AX|7@@ b`bhHy, A8p`A , A Hy`Hq`| @H |` @ , A HE`; 8ø80cH A(@8~8Hx$|0*x&|" H MA(cHa`Pb0|#@AX|#@@ b`p0bh|$@A8`8Hy, A8p`A , A Ha`HY`| @H |` @ , A H-`; 8ø80cH iA(@8~8Hx$|0*x&|" H 5A(cHI`Pb0|#@AX|#@@ b`p0bh|$@A8`8 8!|Aa} !AaN C brb_dbv_menu;;aA;`b|!}&?aA8P!xp}B"8c}, !|`x$|*A8pA , A HA`H9`| @H | @Ĉ , A H `: 8ø80bH IA(@8w8Hx$|0*x&|"H A(bH)`Pb0|#@AX|#@@ b`p0bh|$@@ 8Hbc`H&`0,@T8/`bH+A(|uyA4b88H(9A(,A8u8*bH `<`-p<:--: :`##:@~~`ë.-A T@8-80bH)`,A48 bH)`,A8~8`-~aHz` 8#x|b80H)y`,8~A8#8-|(@ H 8#8-,>@ddXH*`b8cH)`,@8bcH*`b8cH(`,A8xbcH*u`b8cH(`,@ 8|bcH*A`b8cH(i`,@8DŽbcH* `b8cH(9`,A,8ĴbcH)`dH)`b8cH)`dH)`b8ʌcH)`b80cH'`,A8 cH'`,Abc, A,b8ĴcH)-`dH)`b8tcH'E`,@8ʘbcH(`bc, ALb8ǠcH(`dH(`b8cH(`bH b, AHb8cH(e`dH(Q`b8cH(=`bc80H&e`-A8 cH&M`,Abch, A,b8cH'`dhH'`bcp, A,b8ļcH'`dpH'`bcx, A,b8cH'e`dxH'Q`bc, A,b8cH')`dH'`bc, A,b8cH&`dH&`b8cH&`dH&`b8tcH$`,@8ʜbcH&`b8cH$`,A\8bcH&Q`b8tcH$y`,bc@8HH&`HcH& `bc, A,b8cH%`dH%`bc, ALb8cH%`dH%`b80cH#`,@`H b80cH#`-@@bc, A,b8cH%1`dH%`c8`8+8 88 99 H1`,A ,Ap,@4 8x8d8Hs`T`>,A H4,@488xǨ8d8Hs`T`>,A H,@48xL88HI`T`>,A hH,@4 8x8d8HsQ`T`>,A 0H,@4P8xʠ8d8Hs`T`>,A HT,@48x8b&8H`T`>,A H,@488x8d8Hr`T`>,A H,@48xʨ8b&8H1`T`>,A PH, @48xX8d8Hr9`T`>,A Ht, @48x8d8Hr`T`>,AH<, @8x88 8Hq`,A,@cK8-80bH `,A@8 bH u`,A(z@ x`|x|H z` `x|"|"8~8`8*8 88 9P9 H`,A,A,@48x88d8XHp`T`>,AH,A ,@48x 8d8hHp`T`>,AdH,@48x`8d8pHpM`T`>,A,H,@48x8d8xHp`T`>,AHP,@48x8d8Ho`T`>,AH,@48x8b&8He`T`>,AH,@48x<88d8Hom`T`>,ALH, @4 8x8d8Ho5`T`>,AHp, @48x88Hn`T`>,AH8, @ 8x88Hn`T`>,A, @;AK8x<88=8`Hn`,Ah,At8/`e`HA(,#@P8bH`,#A8`pe`H`bbc`H`b`|bH`b8/`bHeA(,#A098cHA(w`na8@H A(,#AHA(|pP`b8/H A(,@|`o}b88HQA(,AP8o8*aH `K8A ;`K,A8x888899 9@pPxH`,A,A܈y, APp`A , A$Hy`HcK8KHY`| @H |` @ , A H-`; 8ø80cH iA(@8~8Hx$|0*x&|" H 5A(cHI`Pb0|#@AX|#@@ b`p0bh|$@A8`8H8 8ø;bp8dccbH ֡A(H@8{8ʴx$x&|0*|" H iA(ccH}`P|7@AX|7@@H 8ø8d;bpccbH A(@8{8Hx$|0*x&| H A(ccH`P|7@A`HPH@8ø8p8bbx&|:!H ՉA(8bH`P|7@AX|7@@ b`bhHy, A8p`A , A H`H`| @H |` @ , A H`; 8ø80cH A(@8~8Hx$|0*x&|" H ԙA(cH`Pb0|#@AX|#@@ b`p0bh|$@A8`8Hy, A8p`A , A H`H`| @H |` @ , A Hy`; 8ø80cH ӵA(@8~8Hx$|0*x&|" H ӁA(cH`Pb0|#@AX|#@@ b`p0bh|$@A8`8@:8!0|px} !Aa!AaN C brc_usta_menu;;;aA!b?|8}&,$|xc$8`!|*A@pA b , A Hy`Hq`b| @H | @b , A H=`;b 8ø80ccH yA(@8{8Hx&x$|"|@*H =A(ccHQ`Pb0|#@AX|#@@ b`p0bh|$@@ 8H8--8~~b9-~8~~8--=@~~= --8-|Rc|J(@ H 8`#ab{ He`b0C,@P; 8/c#HA(|xyA4c#88HA(,A8x8*cEH `B<`-p<;# `ë.-At@,>@{ ȓ#{ He`{ 8H`,@8{ H=`{ 8Hm`,Al8x{ H` 8cHA`,@8|{ H` 8cH`,@8DŽ{ H`{ 8H`,A$8Ĵ{ H`{ H`{ 8Hu`{ He`{ 8ʌHU`{P, A${ 8ĴH5`{ PH%`{X8tHU`,@8ʘ{ H`{`, A4{ 8ǠH`{ `H`{ 8H`{h, A4{ 8H`{ hH`{ 8H}`{(, A${ 8H]`{ (HM`{0, A${ 8ļH-`{ 0H`{8, A${ 8H`{ 8H`{@, A${ 8H`{ @H`{H, A${ 8H`{ HH`{ 8H}`{ Hm`{ 8tH`,@8ʜ{ HE`{ 8Hu`,AP8{ H` 8tcHI`,{ @8HH`HcH`{ , A${ 8H`{ H`{ , A${ 8H`{ H`c8`8-8 88 9 x9 H`,A x,A,@4 8|8d8 H`a`T`>,A ,A H ,@4 8|L88Hr`T`>,A H,@4 8|8d8 H_`T`>,A H,@4 8|ʠ8d8PH_`T`>,A \Hx,@0 8|8c8Hr `T`>,A (HD,@4 8|8d88H_`T`>,AH ,@4 8|X8d8H^`T`>,AH, @4 8|8d8H^`T`>,AH, @ 8|88 8H^q`,AP,@cK8`8,8 88 99 H5`,A,A,@08|88d8H^`T`>,AH,A,@4(8| 8d8H]`T`>,AH,@408|`8d8H]`T`>,AdH,@488|8d8H]Q`T`>,A,HH,@4@8|8d8H]`T`>,AH,@0H8|8c8Ho`T`>,AH,@0P8|<88d8H\`T`>,AH, @4X8|8d8 H\y`T`>,ATHp, @4`8|88H\A`T`>,AH8, @h8|88(H\ `T`>,A, @,;AK$ 8|<88=8H[`,A,A { 8/H -A(,#@Db8Hl`,#A8a{ H 5`{ H %` bbcHm` 8/bH A(,#A<:8cH9A(0`v8@ebH aA(,#AH A(|P0`b8/H YA(,@`u~b88HA(,A8u8*bH `KAD;KAP 8|888899 9@pxHzM`,A,,Albd, A\p`A b , A(H`HcK(8b0KH`b| @H |` @b , A Hm`; 8ø80cH ĩA(@8~8Hx&x$|"|@* H mA(cH`Pb0|#@AX|#@@ b`p0bh|$@A8`8H8 8ø;bp8dccfH A(@8}8ˤHx&x$|"|0* H ÕA(cH`P|;@AX|;@@H 8ø8d;bpccfH =A(@8}8˴Hx&x$|"|0* H A(cH`P|;@A`HPH@8ø8bp8bcfx&|:!H ­A(8bH`P|;@AX|;@@ b`bhH@dȒdhH`b8cH`,@8bcHU`b8cH`,A8xbcH%`b8cHM`,@ 8|bcH`b8cH`,@8DŽbcH`b8cH`,A,8ĴbcH`dHy`b8cHe`dHQ`b8tcH=`bcx, A,b8ĴcH`dxH`b8tcH-`,@8ʘbcH`bc, A@b8ǠcH`dH`b8cH`bc, A@b8cHY`dHE`b8cH1`bc, A,b8cH `dH`c8`8/88899 H `,AT,A,@4 8x8d8HN`T`>,AHx,@488xǨ8d8HN`T`>,AH@,@4@8x8d8HNa`T`>,AH,@48xX8d8HN)`T`>,ApH,@48x8d8HM`T`>,A8H,@8x88 8HM`,A,@cK8`8.8889`9 Hy`,A,A,@48x88d8hHMA`T`>,AH,A,@48x<88d8xHM`T`>,AHH,@4 8x8d8HL`T`>,AHp,@48x88HL`T`>,AH8,@08x88HLY`T`>,A, @X;AKP8x<88=8pHL`,Ad,A8/epepHuA(,#@P8bcH]9`,#A8aepHy`bcpHe`bcp|bdH`b8/cpbcHA(,#A,:C8cHuA(w`qbC8@HA(,#AHMA(|P`bc8/HA(,@$`r~1bc88HA(,A8r8*b%H `KA;`KA|P8x888899 9@pxHj`,A,Ay, APp`A , A$H`HcKP8KDH`| @H |` @ , A H`; 8ø80cH A(@8~8Hx$|0*x&|" H A(cH`Pb0|#@AX|#@@ b`p0bh|$@A8`8H8 8ø;bp8dccbH 9A(H@8{8˄x$x&|0*|" H A(ccH`P|7@AX|7@@H 8ø8d;bpccbH A(@8{8˔Hx$|0*x&| H qA(ccH`P|7@A`HPH@8ø8p8bbx&|:!H !A(8bH5`P|7@AX|7@@ b`bhHy, A8p`A , A H]`HU`| @H |` @ , A H)`; 8ø80cH eA(@8~8Hx$|0*x&|" H 1A(cHE`Pb0|#@AX|#@@ b`p0bh|$@A8`8Hy, A8p`A , A H~E`H~=`| @H |` @ , A H~`; 8ø80cH MA(@8~8Hx$|0*x&|" H A(cH-`Pb0|#@AX|#@@ b`p0bh|$@A8`80*8! |!A} a!AaN C brc_dsta_menu;;;aA!b?|8}&,$|xc$8!|*A@pA b , A H|=`H|5`b| @H | @b , A H|`;b 8ø80ccH =A(@8{8Hx&x$|"|@*H A(ccH`Pb0|#@AX|#@@ b`p0bh|$@@ 8H8--b8-~8~~8-<~~|2c,#A8`##aHb{`HE`b0C,@P;`8/c#HA(|xyA4c#88HA(,A8x8*cEH `B<`-p;# .-A|@,>@{(#{(XHM`{8tH}`,A<8{(H%`{8HU`,@8{(H`{8H-`,A$8Ĵ{(H`{(H`{(8ļH`{(H`{(8H`{( H`{(8@Hu`{h, A${(8ŤHU`{(hHE`{p, A4{(8H%`{(pH`{(8H`{x, A${(8ļH`{(xH`{, A${(8ĴH`{(H`{, A4{(8H`{(Hu`{(8He`c8`8>88899 H}`,A,A,@Pb(@b0H b 8|8d8H@)`T`>,A,AH ,@08|`888HR}`T`>,AH,@4 8|8d8H?`T`>,AH,@$(8|888H?Q`,Ah,@cK8`8=8889P9 H`,A,,A,@0X8|88d8H>`T`>,AH,A,@4h8|Ŵ8d8XH>`T`>,AH,@0p8|\88d8H>m`T`>,AH,@0x8|(88d8H>9`T`>,ALHh,@08|<88d8H>`T`>,AH4,@8|888H=`T`>,A, @ ;AK`8|<88=8H=`,A,A`{`8/HA(,#@Dc8HN`,#A8a{`H`{`H``bccH5``8/cHA(,#A<:8cHA(0`w8@ebH)A(,#AHA(|P0`c8/H!A(,@`v~c88HiA(,A8v8*bH `KAD;KAh(8|$88899 9@pxH\`,A,,ALbd, A\p`A b , A(Hs`HcK8b0KHsi`b| @H |` @b , A Hs5`; 8ø80cH qA(@8~8Hx&x$|"|@* H 5A(cHvI`Pb0|#@AX|#@@ b`p0bh|$@A8`8H8 8ø;bp8dccfH A(@8}8LHx&x$|"|0* H ]A(cHuq`P|;@AX|;@@H 8ø8d;bpccfH A(@8}8dHx&x$|"|0* H A(cHt`P|;@A`HPH@8ø8bp8bcfx&|:!H uA(8bHt`P|;@AX|;@@ b`bhH,A, @TNAPd hd h (HA`b8c XHm`,ALb8c hH`d h `H`b8c hH`bc 8, @bc @, @bc H, @Pbc P, @ NBKb8c hH}`d h PHi`NBKTb8c hHM`d h HH9`Kb8ļc hH!`d h @H `KLb8c hH`d h 8H`K b8c hH`K|, AXp`A؈ , @8Hi`| @ , @ ; 8ø80cH A(@8~8Hx$|0*x&|" H A(cHl`Pb0|#@AX|#@@b`8p0bh|$@@d88`8 8!|} !AaN KHhq`KHhe`K|` @K, A$Ata8{8P8899 9@ hpxHPU`,AL,A|, Ap`A؈ , @Hg`| @ , @; 8ø80cH A(@8~8Hx$|0*x&|" H A(cHj`Pb0|#@AX|#@@b`8p0bh|$@@ 88`8K@KHf`K4Hf`K|` @KB8 8ø;"p8dc#cH A(H@8y80x$x&|0*|" H A(c#Hi`P|8@AX|8@@b`8bh8Kl8{8 h8H.U`,AL,@NB@K8{ 8 XH.!`T`>,AKh8{8dH8 PH-`,T`>AK88{8d8 HH-`,T`>AK8{`8d8 @H-`,T`>AK8{ 8d8 8H-a`,T`>ATK8{<88=8 0H-1`,,A$A8/ 0v 0HݍA(8,#v 0@Q`,#aA8v 0Hݕ`v 0H݅` 0~bH`8/b 0bHA(,#@8@K4:8cHىA(`tzb8@HܵA(,#@\b8/HA(,`u@b~88H A(,A8u8*bH `@dKH A(|P`KH@8ø8Bp8bcFx&|:!H A(8bHf`P|:@AX|:@@K8{88d8 (H+e`,T`>AXK|, Ap`A؈ , @Hb`| @ , @; 8ø80cH A(@8~8Hx$|0*x&|" H A(cHe`Pb0|#@AX|#@@b`8p0bh|$@@ 88`8KPKHb`K4Ha`K|` @K8b8HA(,A8x8*c%H `K8`#aK@KHa`KPHa`K$| @K, C brc_cdst_menuaA!b?|8}&N,$|xc$8!!|*A $pA b , @ H``b| @ b , @ ; 8ø80cH A(@8~8Hx&x$|"|@*H A(cHc`Pb0|#@AX|#@@b`8p0;bh|$@@ 8}H`b0,@ }8/ccH]A(|zy@ <`-p<;c `ë@}8--<--8t|*H֙`8-,8-8#@8#8`9@-8A889(89 @ A8-H5`,/A8,,A/A`,AAP,A,8dA8@p8H&`T`?,A@ NA}ȓc}He`}8HՕ`,A}8H=`}H-`}8H`}8H `}8tH=`,}@8H`NBKhH`NBKT}8Hֹ`Klbd, AXp`Ab , @4H]}`b| @b , @; 8ø80cH A(@8}8Hx&x$|"|@* H ]A(cH`q`Pb0|#@AX|#@@ b`p0bh|$@A8`88!|} !AaN H\Y`KH\M`K|` @K,A0AP888899 9@pxHDA`,AH,Axbd, A p`Ab , @H[`b| @b , @; 8ø80cH A(@8}8Hx&x$|"|@* H A(cH^`Pb0|#@AX|#@@ b`p0bh|$@A8`8K,A, K$8ʨ8cF8H4`T`?,AK88d8 H!`,T`>A, K8<88=8H!m`,,ApA8/=}HA(8,#}@aA8!x}"8c}, |`!рx$|*A @pAԈ , @ HI`| @ , @: 8ø80bH }A(@8u8Hx$|0*x&|"H |A(bHL`Pb0|#@AX|#@@ b`cp0bh|$@@P8bc8,#@ bc@,#@b8808c8H{`,AT8,4A4,At8,#A<`e8```!d8c|ey8@,4bA: ȴȴ````!:T58t58ȰHu`,@`vȼȾa:TE8tE8ȰHE`,@vȼȾpaxz8 Tbb8 8899!pH {!A(bx$@. ~Y *HA(@czs8cbD8HG``d@H`;,4@ b8pH zA(8bؐHA(8c8x$| *HGm`cHY`;ch8`81889 9@@H`,A@,A,@b8d8``!,8@ cK8,#8 @8aH`8a8HJU`~,,AAT|8;`A88`H{`,A:,A~|@cWKx, A`p`AԈ , @@HE`| @ , @; 8ø80cH xA(@88Hx$|0*x&|" H xA(cHH`Pb0|#@AX|#@@ b`cp0bh|$@Acc8`8@:8!0|x} !Aa!AaN HD`KHD`K|` @xKĈx, Ap`AԈ , @HDU`| @ , @; 8ø80cH wyA(@88Hx$|0*x&|" H wEA(cHGY`Pb0|#@AX|#@@ b`cp0bh|$@Acc8`8KHC}`K@HCq`K|` @KH a`88H i``d8aH vA(K`wKx, Ap`AԈ , @HB`| @ , @; 8ø80cH v!A(@88Hx$|0*x&|" H uA(cHF`Pb0|#@AX|#@@ b`cp0bh|$@Acc8`8K0HB%`K@HB`K|` @K8c3bD8HBQ``Kx8apbDH5`K8abDH!`K8`8Hc-`,A(,Axb8KH@8ø8p8bcx&|:W@H tA(8bHD`P|?@AX|?@@ b`ch8`8eHb`,AKHXe`b8@KH `b88KЈKH@`KH@`K| @K C bra_logs_menu;;;;aA;`!b?G|8}&,$|xc$8!|*A pAb , @ H?`b| @b , @ ;" 8ø80c#H rA(@8y8Hx&x$|"|@*H rA(c#HB`Pb0|#@AX|#@@ b`p0bh|$@@8"yH,#@yP,#@"08yH8889)H`,AH,8A,A8,$A4H```!`H,$H@,8A````!: p8x 8Ha`8,8x @pxH9`,8@zpaxzbH `,8 @pzatbH`,84@(pz0axbH`,98Rb@ǪpǬt8Xv88cb9pH pA(Pb. x$~ *HqA(@c8cb8H=U``yPH=`;,8@b8TH pA(8bؐHA(8c8x$| *H<`cH`;c8`P82889 9@H9``d,AL,AyH,@cd8``!,8@ cK,#8 @D8aH5`8a8H?`h,,AAX|8;A88`HqQ`,A;{,Ah|@cK bd, Adp`Ab , @@H;1`b| @b , @ ; 8ø80cH nMA(@88Hx&x$|"|@* H nA(cH>%`Pb0|#@AX|#@@ b`p0bh|$@A8`8PJ8!@|} !AaN H:`KH9`K|` @Kbd, A p`Ab , @H9`b| @b , @; 8ø80cH lA(@88Hx&x$|"|@* H lA(cH<`Pb0|#@AX|#@@ b`p0bh|$@A8`8K|H8`K4H8`K|` @K 8H V`88H ^``d8aH kA(K`KTbd, A p`Ab , @H8-`b| @b , @; 8ø80cH kIA(@88Hx&x$|"|@* H k A(cH;!`Pb0|#@AX|#@@ b`p0bh|$@A8`8KH7A`K4H75`K|` @K 88cb8H7e``K8`8HXi`,A,AxHK8H@8ø8p8bcx&|:W@H iA(8bH:`P|?@AX|?@@ b`h8`8HW`,ApKHM`8PKXHQ`8HK8KH6`KhH6 `K4| @K@ C brr_logs_menu;;aA;`;@b|!}&:aA!>#}8"8c}, |`!x$|*ApAԈ , @H5`| @ , @l: 8ø80bH h)A(@8v8Hx$|0*x&|"H gA(bH8 `Pb0|#@AX|#@@ b`cp0bh|$@@8bcX,#@bc`,#@pb808cXH%`,AX,5A,A|uH8,#A8`eHX``!dXcHH|eyX@,5A:`b8ɰ955B8 8 b```!H fA(bx$`. ~Y *HA(@czt8cbD8H3}``d`Ha`;H8ɰb~y95A8 8 b5BKlb8H fA(8bؐHA(8c8x$| *H2`cH`;ch8`83889 9@`HI`,A8,A,@xb8dX``!,8@ cHK8,#8 @8apHE`8ap8H5`~,,AAT|8;`A88`Hga`,A:,A~|@cWKx, AXp`AԈ , @8H1M`| @ , @ ; 8ø80cH dqA(@88Hx$|0*x&|" H d=A(cH4Q`Pb0|#@AX|#@@ b`cp0bh|$@Acc8`88!|!A} a!AaN H0%`KH0`K|` @K̈x, Ap`AԈ , @H/`| @ , @; 8ø80cH cA(@88Hx$|0*x&|" H bA(cH2`Pb0|#@AX|#@@ b`cp0bh|$@Acc8`8KH/`K@H.`K|` @KH MA`88H U ``d8apH bA(K`wKx, Ap`AԈ , @H.`| @ , @; 8ø80cH aA(@88Hx$|0*x&|" H auA(cH1`Pb0|#@AX|#@@ b`cp0bh|$@Acc8`8K8H-`K@H-`K|` @K8ctbD8H-``K`8`8HN`,AP,AbXK`H@8ø8p8bcx&|:W@H `mA(8bH0`P|?@AX|?@@ b`ch8`8eHNI`,AKHD`b8`KH]`b8XKXK|8}&,$|xc$8!1|*A pAb , @H+u`b| @b , @;B 8ø80cCH ^A(@8z8Hx&x$|"|@*H ^UA(cCH.i`Pb0|#@AX|#@@ b`p0bh|$@@8Bzh,#@zp,#@08zh8H(M`,A :h,9A,A`8,$A8`:h````!`h`,$#`:h@,9A8xb9Y=9^958 8 c%``!H ]1A(pb. x$ *HA(@c8cc8H)``zpH`;9`8xb y9Y=A958 8 9^c%Khb8ɔH \A(8bؐHeA(8c8x$| *H)I`cH5`;c8`p84889 9@H``d,AD,Azh,@cd8``!,8@ c`K,#8 @<8apH`8ap8H,5`h,,AAX|8;A88`H]`,A;{,Ah|@cK bd, A\p`Ab , @8H'`b| @b , @; 8ø80cH ZA(@88Hx&x$|"|@* H ZA(cH*`Pb0|#@AX|#@@ b`p0bh|$@A8`88!|} !AaN H&y`KH&m`K|` @Kbd, A p`Ab , @H&%`b| @b , @; 8ø80cH YAA(@88Hx&x$|"|@* H YA(cH)`Pb0|#@AX|#@@ b`p0bh|$@A8`8KH%9`K4H%-`K|` @K 8H Cq`88H K9``d8apH XIA(K`K\bd, A p`Ab , @H$`b| @b , @; 8ø80cH WA(@88Hx&x$|"|@* H WA(cH'`Pb0|#@AX|#@@ b`p0bh|$@A8`8KH#`K4H#`K|` @K 88cc8H#``K8`8HD`,A,Ax:hKH@8ø8p8bcx&|:W@H VuA(8bH&`P|?@AX|?@@ b`h8`8HDQ`,ApKH:`8pK(H `8hKKH"`K8H"`K| @K C brc_logs_menu;;aA;`;@b|!}&:>aA8!}"8c}, |`!x$|*A pAԈ , @ H!`| @ , @ h: 8ø80bH TA(@8u8Hx$|0*x&|"H TuA(bH$`Pb0|#@AX|#@@ b`cp0bh|$@@8bcx,#@bc,#@lb8808cxPH7!`,Ax,4A,Atth8,#A4`ehx`!dxchh|eyx@,4"A:`b8954BTF8 8 b``!H SAA(bx$. ~Y *HA(@czq8cbD8H``dH`;h8b~y95A8 8 b4BTFKhb8H RA(8bؐH}A(8c8x$| *Hi``tcHQ`b8@AX|>@@ b`K88bP8xx&|H ?QA(8bHePb`| @@cK,8`H uU`B`bhz, @<,'A 8<```cDHaA(,#ATbHB= PI=#SA4|( P@ ||p<|8dB@T>;aA!Tx>`vb|}&aA!NBxp8(!8|xc$,&|*ADpA, , @(Kݽ| @ , @ 8;b08xccH A(@~8{Hbx&x$|"|@*H A(ccKPb0|#@AX|#@@ b`bhp0|$@@8,A ,@,b, @b@,@8, A4,>@d, A bHB@8bx&| *HO``y8bKKi,,8pPh~8@A\,A @z.x&8b}b8xc|8*H uA(8bK߉AX|8@@ b`|, AXp`Ä , @A t88b08xH A(b9S``88qx8x&| *H A(8bK|3@LNBA@c8apHX9A(,#@8apHX%A(,#A h8apHO)`,@ KK48ap8qHO`,A8ap8]HN`,A8ap8HN`,A8ap8HN`,A,>A<8ap8HN`,A8ap8HNq`,AdK!88bP8xH eA(b8 @8px&| *H EA(8bKY} @,K$K88b08xH A(b8px&| *H A(8bK|3@LNBA@c8ap8HM`,@```!8b808xH yA(b8Tx&| *H YA(8bKm8ap|3@LNBA@cHUA(,#8ap@HUA(,#A8apHL`8,8ap@ KyKDHL`,8apA8HL`,8ap8AHLy`,8ap8DAHL]`,AK 8ap8HL=`,A8ap8HL!`,A88bP8xH A(b8 @8px&| *H A(8bK } @PKHKu88b08xH A(b8px&| *H A(8bKױ|3@LNBA@c8ap8HKA`,Al8ap8HK%`,AP89 `8b08xx&|8*H A(8bK%|3@LNBAAK8c8b8xH A(b8 x&| *H A(8bKaT>|h | LB0BA[, A 8`@8Ka`K$88`@KE`KKbx4p @H8c8b8xx&|H A(8bKP|8@AK8"9Bbc89 x $|H*KKp8ap8HIa`,A8ap8qHIE`,A8ap8]HI)`,A8ap8HI `,Ap8ap8HH`,AT8`H d}`,A @(|, A p`A܈ , @Ke| @ , @ 8;08xcH A(@88Hx&x$|"|@* H MA(cKaPb0|#@AX|#@@ b`bhp0|$@A`8`8KKЁK4KyK|` @K|, Ap`A , @KA| @ , @88b08xH mA(b8x&| x$|@*H 9A(8bKMA0| @@A`8`8KKύKdKυK@|` @KDb@,@c@K88b08xx&| `H A(8bKҡA0| @@@cKX88b08xx&|T H 1A(8bKEA0| @@@cNK8KΉbx4p A"8B9bc89 x $|H*KKh8b808xH qA(b8S`8qx8x&| *H EA(8bKY|3@LNBAKz.b8b08xx&}|8*H A(8bKAXb0|#@@ b`@8Ktc#x&| *H@``y8bKнb0P} @@x8bz.x&0b}8x|8*H aA(8bKuAXb0|#@@ b`hp0} @@8K|x&8b||20x.8x|:HA(8bKAXb0|#@@Kb@,@8K.,8AHb@8bx&|H?y``z8bKωKbP0}$@@x&8b0z.}b8x|8*H)A(8bK=AXb0|#@@ b`"hpb0~#@@8 8~8b08xHA(8z8x&|HA(8bKαAXb0|#@@ b`@8Kx|x&8b||20x.8x|:H1A(8bKEAXb0|#@@KKʩK~KKʙK| @K CBrContBackEnter ;|aA}&!aALB`r!Tq>T>xpBbb88~&8c~,$!|cxc$|*ApAl , @lKu| @P , @|h | LB0BAb[, A8`8K`K$88`K`K 8bK9bx4p @88bf8b8xx&|HaA(8bKuP|3@A |3@@z, Ap`A , @K| @ , @88b08xHA(b8x&x$||0* HA(8bKA |9@@A`8`8KK KtKKP|` @KT89`"Bbc89x$i|8*K1K8ap8H2`,A8ap8H2`,A8ap8H2`,A8ap8H2`,@@8ap8H2i`,A8ap8DH2M`,A8ap8H21`,~`&~h @aAU+>;`|!}&`aA:`!xp9!8, |8Xx$aHbAPaX`ah| |)*A(pAB , @BKb| @Bb , @Bp8, ;AA8`H <}`,AA|,AAh'!H-?x.bHB0-p}*Ax@*yD.p:RbbX~#":S`}2~2@::T"9S: @P!9S 8S@h8T x$:cV:Ra8ka:h, @bЈ, AbH,, LB3BAЀe|@88`||, *A , #@8|s,H*A(K`r8`H ;`,Abd, |` A,p`Ab , @HKb| @b , @ b8x08HA(@8vbGHx&x$|"|@* HA(bK0bP| @A | @@8b`0bp| @@8bC88!|px} !Aa!AaN KKKKb@,@8Khb, @bbP0| @A`````!bc@8x08x&|8*HفA(bcK8`|2@8a@@8H& A(,#8a@H%A(,#Ad8 8aH`,@ KK\AbCHA(,A,,2:@ADa:!```!HA(,, Ax:R@pq:1,#@, @8aH!A(a`,@H|,LFBA|K bc8xP8HEA(@8v8Ax&| *H!A(bcK58Ppb`|$(@@8KA,@|, *@tKq bc8xP8H׵A(@8v8Ax&| *HבA(bcK8Ppb`|$(@AtKT, #@tK bc8xP8H=A(@8v8Ax&| *HA(bcK-8Ppb`|$(@AKK bc8x08HA(@H:V8v8x&|"RH֡A(bcK"0P|1@A |1@@8b`@88a8H5`,@P"p0``!bc 8x08HA(bC@x&| *HA(bcK 0P|@8`8a|&8@LB0BA@8H"mA(,#8a@H"YA(,#A8 8aHU`,8a@ KK,8H5`,8a8AH`8,8aAH`8D,8aAH`,AK8a8H`,A8a8H`,A bc8xP8HԱA(@bC8x&| *HԍA(bcK8b`|/@@<K4K bc8x08HEA(@HbC8x&|" HA(bcK1"0P|1@A |1@@8b`@88a8H`,A|88aH`,Ad@Hbc8x80x&}: `HӁA(bcK|1@A0| @@8b`A\K< bc8xp8H1A(@HbCx&|" H A(bcKpbP| @A | @@8b`8x[,#A :@@8`OK`K:@@8`OK`K8K!bx4p @@Hbc8x8px&|:HEA(bcKYpbP| @A | @@8b`88bЈc,#| A,pAb , @Keb| @b , @ b8x08HщA(@8v8Hx&x$|"|@* HMA(bKa0bP| @A | @@8b`0bp| @@88`8KKK@K}K8"9Bb89bp x $|H*KK8a8H]`,A,8r8aHE`,A8s 8aH-`,A8q8aH`,A@8]8aH`,A(8a8H`,@H,LJBA,@8"Ppc9P````!o9,#?A|.@9AP, 8a8~ &Ha`,V >| ALA8a8sH=`,A88aH%`,@h8`AT,@Lc8`~B@,````!8, =A8cC , =A`aH, ,|LFB,LFAX@bc8xAP8x&|8*HΕA(bcK8Ppb`|$(@AxKX@Hbc8x80x&|: `H=A(bcKQ0P|?@A |?@@8b`@88bАK`x` `K:@Kp8a8H`,A`b|8KX, @8`8ahKl8`H ,`,A,8bЈc,#| A,pAb , @Kb| @b , @ bc8x08HA(@bC8Hx&x$|"|@* H̩A(bcK0P|?@A |?@@8b`@88`8KKKLKK b@,@8K8a8H`,A8s8aH`,@bPKM:`8BahKbc P8x8H˹A(bC@}x&| *H˙A(bcK8b`|1@8@8K8a8H9`,~ &~( AK8a8H`,A488aH`,~ &~( A8a8sH`,@K@bc8x08x&|8*HA(bcK|1@A0| @@8b`@888`a`Kh@Hbx&| *H Y``obcKi bc8x08H-A(@bCpx&| *H A(bcK|1@A0| @@8b`@8@Hax&| *H ``vbcKb@A0bAx&| *H ``vbcKK KXx&bA| *H U``vbcKeKK,K bc8xP8HA(@H8v8x&|"SHA(bcK 8Ppb`|$(@@8K8a8H `,A88aH y`,A8q8aH a`,A8]8aH I`,At88aH 1`,A\88aH `,AD88aH `,A,8s8aH `,A8r8aH `,A8s 8aH `,AKh8K]bx4p @\@Hbc8x8px&|:HǁA(bcKpbP| @AHp| @@HK88"9Bb89bp x $|H*K)K\bc`@8x````!8x&|8*HA(bcK8`8a@8HaA(,#8a@HMA(,#A8 8aH I`,@dK8x@bc0Kd.?,@A,@8bpP}# @A |#@@l;bHcp;6;V}@```!;z, ;Z,?@p@ b 8xp8HŭA(c#@x&| *HōA(bK8LJpBb`8A8`w|>@Ax, AH8A,@8`|B@(```!;,$=A\8cC 숟,$=AH|, @H,A ,@@ˆ|ĐaKi b8x08HĭA(@H8v8x&|"HąA(bK0bP| @A | @@8b`0bp| @@88bАK8a8WbEHA(KDK@Hb8x8px&|:S`HA(bKpbP| @AK\x` K:@KKIKbHc;V; ;V```!~;, ,?@\@hb 8xp8HQA(cC@%x&| *H1A(bKE8`8w|9@;9@KKK@Hbbx&| *H``rbKKmHb,LBSBA&`, @&T 08xbcxH‘A(@8r!px&| *HmA(bcK0P8|0x@|@LB0BA b`0bp| @@8@HbCx&|"PH`abcKA|,@tb@c6A%\c#x&| *H``yb:c8r8c`!HIA(,#:8rA:R8c|6@AP(A$a| *| N A ,@0b@Aax&| *H-`abcK=A<,@4@H8(bcx&|" HA(bcK@Hax&| *H``vbcK@Hbx&|"Q@H``vbcK@Hbx&|"PHe``vbcKu:`ahKTx&a|H5`abcKEADK8y(c$H`A,KA ,@hb@A0bcx&| *HA(bcKA,@Kx&bc|HA(bcKAK8y(c$HA(AKA ,@lb@A0bcx&| *HIA(bcK]A\,@TK x&bc|HA(bcK-A,K8y(c$HA(A KA ,@pb@A0bcx&| *HA(bcKA,@Kx&bc|HA(bcKAK8y(c$HUA(ApKA ,@tb@A0bcx&| *HA(bcK%A$,@Kx&bc|HA(bcKAK8y(c$HA(AKA ,@xb@> A0bcx&| *HiA(bcK}A|,@tK@x&bc|H9A(bcKMALK8y(c$> HA(A KA ,@|b@> ^(A0bcx&| *HA(bcKA,@Kx&bc|HA(bcKAK8y(c$> ^(HQA(AlKA ,@b@> ^(0A4bcpx&| *HA(bcKA,@Kx&bcp}dHA(bcKAK8y(c$> ^(0pHA(AKA ,@b@> ^(0~8A8bcpaxx&| *H-A(bcKAA@,@8Kx&bcpax}dHA(bcK AK8y(c$> ^(0~8paxHA(AKA ,@b@> ^(0~8@A ^(~8pax@HA(AK|A ,@b@> ^(0~8@HA@bcpaxx&| *HQA(bcKeAd,@\K(x&bcpax}dHA(bcK%A$K8y(c$> ^(0~8@HpaxHA(AKpA ,@b@> ^(0~8@H^PADbcpaxx&A| *HEA(bcKYAX,@PKx&bcpax}dAHA(bcKAK8y(c$0> ^(~8@HpaxPHA(AKdA ,@b@> ^(0~8@H^P>XAHbcpaxx&A!| *H%A(bcK9A8,@0Kx&bcpax}dA!HA(bcKAK8y(c$> ^(0~8@H^P>XpaxA!HuA(AKXA ,@b@> ^(0c~8@H^P>X`ALpaxxd&bcA!| *HA(bcKA,@Kxd&bcpax}dA!HA(bcKAK8y(c$0> ^(~8@H^P>XpaxA!`H5A(APKLA ,@b@> ^(0c~8@H^P>X`hAPxd&pbcaxA!| *HA(bcKA,@Kxd&bcpax}dA!HYA(bcKmAlK8y(c$> ^(0~8@H^P>X`hpaxA!HA(AK@A ,@b@> ^(~0c8@^H>PX`hpATxd&apxbcA!| *HMA(bcKaA`,@XK$xd&bcapx}dA!HA(bcK A K8y(c$0> ^(~8@H^P>X`hpaxA!pHyA(AK4A ,@b@> ^(0c8~@HP^X>`hpxA`xc&pxaabcA!|*HA(bcKA,@Kxc&pxaAabc!|HuA(bcKAK8y(c$> ^(8~@HP^X>`hpxx0paA!HA(AKA ,@$b@> ^(0c8~@HP^X>`hpxAhxc&Apxaabc!A|*H)A(bcK=A<,@4Kxc&pxaAa bc! |HA(bcKAK8y(c$8> ^(~@HP^X>`hpxx0paA!H-A(ADKA ,@4b@~@H> ^(c08a(0~PX`^h>pxApxc&xpaa8bcA!(08|*HeA(bcK~yAx,@pK ^(H~PX`^h>px0p8x@aA!HYA(ApKA ,@Tb@~@H> ^(c08aH~P`^h>pxPXXAxxc&Apxaa`bc!HPXA`|*HyA(bcK|A,@KPxc&pxaAahbc!Xh|HPHA(bcK|AK8y(c$H> ^(~PX`^h>px0p8x@aA!H]A(AtKA ,@db@~@HP^Xc> ^(08apxA~`hp^x>Axc&xpaabcA!px|*HuA(bcKzA,@KLxc&pxaAabc!|pxHA(bcKz AK8y(c$> ^(X~`hp^x>0p8x@HPaA!HIA(A`KA ,@b@~@HP^Xc> ^(08a~`hp>A^xAxc&Apxabca!A|*HIA(bcKx]A\,@TK xc&pxaAabc!|HA(bcKwAKx8y(c$X> ^(~`hp^x>0p8x@HPaA!H A(A$KA ,@b@~@HP^X>`hc> ^(08aA!~px^>Axc&xpaabcA!|*HA(bcKvA,@Kxc&pxaAabc!|HuA(bcKuAKp8y(c$> ^(h~px^>0p8x@HPX`aA!HA(AKA ,@b@~@HP^X>`hc> ^(08a (A0!8~px^>@HAxc&xpA aPbca(08@!HAP|*HA(bcKsA,@Kpxc&pxaAaXbc!HX| (08@HA(bcKsAKh8y(c$h> ^(~px^>0p8x@HPX`aA!H=A(ATKA ,@b@~@HP^X>`hpcx> ^(08a`hpAx!~^>Axc&pxaabc`hpxA!|*HA(bcKq)A(,@ Kxc&pxaAabc!|`hpxHuA(bcKpA߈K`8y(c$> ^(x~^>0p8x@HPX`haA!pHA(AKA ,@b@@HP^X>`hpcx> ^(0~8A!^>Axc&paxabcAaaaaaaaa!|*HqA(bcKnA݄,@|KHxc&paxA!abca|aaaaaaaaaaaaaaaaaaHA(bcKmA,@Kܜ8y(c$0~8@H^P>X`hp> a A(!08@H^(x~^>apx (08A@!HHA(A۸,Aۀ@HaK۬x&c#|Hi``yKڤ c#8x0xHAA(@8y!pz&| *HA(c#8rHݵA(,#A0H,A, A@8#b@z&Hbcc%| HA(bcKkKٌ@c%bcHz&K:`;Kb@,@8Kp;B 8x80cCH=A(@8zcgHx&x$|"|@*HA(cCKkPb0|#@AX|#@@b`8bhp0|$@@8KKgEK8, KKg1KX CC BrMenuProcessb`;;aA;`;@!; ;`:|}&aA!T>8xpU>UR>899@9!a|,%x$89:a: !baA8chA|l!*A-pA-Ԉ , @-Keـ| @- , @-8, @~(A,8`H `,A,,A,a(xs.b~Ě8rx&~*bHiA(,#A,: 8@:0"P-/| HA|@Lb|&x|0|(H@x.9ET A`8}8H8raP:LAX9eS`ahp9%S9S!8R8da8T9 @-8T9ETA9eRa8R}&B ,1x~ &,0!:% ~&,.}&, |`&aHaT>| ,TF>|! Lӂ|&T 6T>| L#|&T 6| @\p| @'48,8Aa|h @`!,,LF ADb0,@4|y||P,@ 4T~|`9A~,#Abp;9%|pAb, 8r@8rHA(abx&| *HiA(aKf},8@@Hapx&| *H9`apaKfI,.A@,|`&, aH|&| @8, @X| ADpA(0X aA!ahxb`"p`!a808xx&|8*HqA(aKe 8ap|@LB0BA|:@@cHA(,#8ap@HA(,#A88apH`,@ KaKX!Aa Ap9pbHA(,AP,0A8:p, Ax9a,#A0;q8`````!,/,,-L3AaHaA(,9AH, 8A8p}},/@:p, @bH֕A(,ab@p8-|A`H9A(`nb8,H%A(`p,.}&} A8n,0|@L BAH)A(P,|P|28|p@4|LD A(| 8x`!8C ,0|dP8|Ap:, A8ap8]TH`,@,@< 8d| 8x```!8cC |,@h8:K_=p9A 0a88xHuA(a8pHx&|RHQA(aKbex| Ab0X|#@@ b`0bph|$@~&~ @c8ap8H`,@X``!a808xHA(ax&| *HA(aKa8apx0hX| |8@LB0BA `~ @cH A(,#8ap@HA(,#AT88apH`,8ap@ K]K$8H`,8apA8HԱ`,8apA8Hԕ`,8ap8DAHy`,AK])8ap8HY`,A8ap8H=`,Aa8P8xH5A(a8px&| *HA(aK`)Ppb`| @@ hKK\a808xHA(a8pHx&| HA(aK_x| Ab0X|#@@ b`~ bh@c8ap8H)`,A8ap8H `,Aa8H08xx&| `HA(aK_ x} Ab0X|#@@ b`L|&~ H@Lbh|&HKa8p8xH}A(aHx&| HYA(aK^mbpP|#@AX|#@@ b`hb蛄[, A b@88`KJ`K8b@8`KJ`K8bKZi4p @a8Hp8xx&|HA(aK]pbP| @AbX| @@ b`h, dAdp`A؈ , @HKY| @ , @ a808xHA(8Hbp8~x&| x$|0*HA(aK\0bP| @AbX| @@ b`0hbp| @A`8`88!|px} !Aa!AaN KXKKXK|` @xK9@8"89bpGyg$|8*KvK8ap8HY`,A8ap8H=`,@|, @(8`;L;`ca|&HK8`H `,A, dAp`Ä , @KW| @ , @a808xHA(a8Hx&| x$|0*HqA(aKZaxh A0bX| @@ b`~ bhA`8`8KKVKHKVK |` @K(b@,@cK8ap8sHͩ`,Ap8ap8rH͍`,A8ap8s Hq`,A8ap8qHU`,A8ap8]H9`,A8ap8H`,@A,, A,A,Aa,#A``e8d8x|c|a8H08xx&| `HA(aKXx A0bX| @@ b`~ bh@c8`H `,AH, dA(p`A , @ KT| @؈ , @a808xHA(BHapx&"|8{cx$ |0*HA(aKWx A0bX| @@ b`~ bhA`c8K KSK<|c8KKSK|` @Kb@,@cK8Ka8hP8xx&|8*HA(aKVbPpL}&`|#@H@K8ap8Hm`,@ A|KPa8`08xx&|8*HQA(aKVex| Ab0X|#@@ b`~ bh@c8b8ؘKaHx&| *H`aaKUa808xHA(a(x&| *HA(aKUx| Ab0X|#@@ b`~ bh@cHax&| *H-``paKU=A,,,/@K,0A8|8ap| , @,/AK8p8dpa8xHA(8obHBx&8r|x$ |0*HMA(aKQapbP| @ApbX| @@Ka,#AT9p,,`!,/-aLFAHA(, ,A:A9,,,/@K9p,,`!,/-aLFAHŵA(, ,A:A9,,,/@K`p, @|KP8ap8H1`,A8ap8H`,A8ap8qH`,Ah8ap8]H`,AL8ap8H`,A08ap8Hå`,A8ap8HÉ`,A8ap8sHm`,A8ap8rHQ`,A8ap8s H5`,AKKp:AlPa88xHA(b8px&| *H~A(aKOPbp`| @@8bhK,a8P8xH~A(b8px&| *H~A(aKNPbp`| @@bhK 8bKJ4p @Pa8Hp8xx&|H~A(aKN-pbP| @AK88"9bp_yG$|8*KhKl0X aA!ahxb`"p````!a808xx&|8*H}AA(aKMU 8ap|@LB0BA|:@@cHA(,#8ap@HɱA(,#A88apH`,@ KI]KX!Aa A@KA8KA, AA,A|a,#A`8|8x|8ap8WH|9A(KHp80a8xH|A(8o8pHx&|H{A(aKL0Pbp| @&| @x~& A$bX| @@ K8bˆcĐpatKXKH%8Hppa8xx&|S`H{UA(aKKipbP| @AKapx&|Q@H``naKK-ax&|PH`apaKKKapx&|PH`apaKJa808xx&|T HzA(aKJ0bP| @& xAbX| @@ b`b0ph|# @~&~ @c8b8ؘKHzA(8,;@|abx&䘇|0*HyA(aKIb蛃Kpb8rHyA(K4rH!A(A x&|p*HA(8tXHA(8apH5A(8apHqA(,@8ap8H!`,@x;8ap8qH`,8apAD8]H`,8apA(8H`,@;`;@8ap8rH`,@bp,?@hbcAHx&| *H``sb8rH%A((#8c@bHA(Kx&| *HQ``sKx&Abc| *Hx-A(Kbc| *cHxA(K8ap8rH`,@4K88ap8H`,@K8Kt8ap8H`,@xKp8KHx&|p*HA(8tXHA(8apH-A(8bK | @x`!,,LF ADb0,@4|y||P,@ 4T~|`9A~,#Abp;9%|pAb, 8r@H8rHvA(abx&| *HvA(aKF,8A4Kc#Hx&| *H`apaK>; Klx&c#| *H``yaK>c#Hx&| *Hi`KADx&ac| *HnIA(aK>]c#Hx&| *H%`Khx&ac| *Hn A(aK>c#Hx&| *H`K(a008xHmA(8xX(x&| *HmA(aK=xb0X| | @LB0BA4K(bc008xHm]A(78s,A(8{$&| *Hm1A(bc8rHA(,#A$||#xxT8 +7{ &a"Hbe| HlA(aK|}&aA!`aA!xp!a8xb8,$|xc$|*ApAb , @K6b| @b , @x; 8x80cHjA(@8|Hx&x$|"|@*HiA(cK9Pb0|#@AX|#@@b`8bhp;0|$@@8bЈ, A,?bH0PX9U  9#U(!(9CUA09cVa89U@~ @Bh} (@`&bЈ, @L 8aX8xh @88b0HhA(@! 8b8cx&| *HhA(8bK8LRPBA b`8aX0p|$(@@cH9A(,#A 8!X8aX-A$HEA(`x|@K48 8x8bPHhA(@8X!08b8cx&| *HgA(8bK8bp`P|@, @K,9 A b, @ Dh Ahc\a_HaPbeX`YhhpZ![x!A]a^Aa`acdfagAi!jk8raH`,@\9XXADa`!HA(,A,9,.a@(8@~y@K3I 8b8x8PHfA(@8X!@8b8cx&| *HfaA(8bK6uPpb`| @AK ,7AK2͈X, A , Aa8qH`,Aa8r0H`,Ata8rHA(,#, LFBA,Ka8qH1`,@8/8aXHA(,#@K) 8b8x8PH] A(@8X!88b8cx&| *H\A(8bK,Ppb`| @AK, @h cAlK8aX8LHq`,AXK8aXH9A(,#@8K(bx4p @@H8x88bpx&|:H\!A(8bK,5pbP| @AbX| @@ b`bd, Ap`Ab , @K(Yb| @b , @ 8b8x80H[}A(@8H8b8cy&x$}B|0* H[=A(8bK+QA0bX| @@ b`b0p|# @A`8`8KK'}KDK'uK|` @K 8"8Bb9bp) y)$|H*KEK0Hq`8aX?8q,9A4`!H`8aXH`8q98aX,9@8x 88b0HZ A(@8X!(8b8cx&| *HYA(8bK)LRPBA0K$h A8rH`,@t8aX8rlHYA(h AH8aX````!H `8aX8q,?AH`8aXK8aXHA(KL8aX8rxHY%A(h AK8aX8rxHYA(8aXHqA(K8`H i`,@pb@,@cKTK%]K;K4K%MKT| @K\ C BrStrValEnterT>ۡہ`b|}&aA!``axAp!h`XP8~!!"B8c~|cxc$,$|*A a\!N1BU >;@T>; T>;aA:!`xp!qbabad8|x$, 8|!*A p`Ab , @Kb| @b , @8a8Db&HIA(0 8x88bbHIA(@H88bx$8cx&|0*|"HIA(8bKbPa|7@~@&~H AAX|7@@ b`#bhp|# @|&| @8@H8bx&| *H``p8bK% 8b8x8#HHA(@Hb&8b8cx&|"$hHHA(8bKa~h AXa|#@@ b`#a|h @88`8K6,A,A,4A8[teH`,A8qb8HA(,AT,:@TxcCHA(,AtbBr|A\8aHA(,#@ 8"cFay $9$|P* K28`8K5,A,:@bd, A\p`Ab , @A(@8H8b8cx$|0*x&|" H>A(8bK~ AXa|#@@ b`#a|h A`78`8KK KPK K$|` @K,aKeK8K,8b8x8 H=A(@H8b8cx&|"! H=A(8bK |>@AX|>@@ b`#7KcCHA(;@Kx&Hb|QH}U``v8bK eK8a8VXH`,@b#H~ y@p,1@|8ap%HH~A(8c8 x$| *H `p8peHcH|`0s8K8pq````!H 1`,8pAl1~ yAhqK8a8\HA`,@b#@~ y@,1@8ap8 %@H~A(8c8 x$| *H `p8pe@cH{`0,<A|8,4A,8a8\H`,@t8K8pq`!H 1`,8pA@1~ yAA|8a8Y8H`,@b#8~ y@t,1@L8ap8%8H|A(8c8x$| *H`p8pe8cHz`0~8K8pq```!H !`,8pAl1~ yAhqK8a8\dH~1`,A08\p8aH~`,A8\8aH~`,A8\|8aH}`,A8VX8aH}`,A8\8aH}`,@K8apHA(bpADb , @bH{A(`q8||, @}8`||, @}Á8||x, @}y@8bx&| *H9A(8bK 18b|| , ^@~!|, ^@~C|x, ^@p~CyKhKmK0cH}A(,Ab؈cH}A(,Ab؈cH}A(,Ab؈cH}A(,Ab؈,WA , E@|c,# @pM3MAMBNCN @;b`#, EMMAMBN(CN,@07K(x&Hb|QHw``v8bKK8ab$Hw`8q8aH}Y`x|:@A||:@Ap8L8aH}1`8acDH}!`KLb#8HyA(|uyA,88ab$HwM`8q8aH|`x|:@A|:@@ 8-8abH|`K8acDH|`8L8aH|`8-8abH|q`Kbc8^H A(-@9`8cFa"dy $9x|P*K!8`8K$,AK9`8cFa"dy $9x|P*K!18`8K$%,A(KcC8H `,@K8cCH `,AK89`"cF9aBx$e|8*K 8`8K#,AK8aH~-A(,#@`89`"cFaB9x$e|8*K %8`8K#,AK8a8V|H|QA(`s;AK8_9`"89ayJ$g |P*K8`8K",AK8UaHxQ`,A\8TaHx9`,AD,5@b$8aHt9`8q8aHy`8aHy`Kb#8HuA(|uyA88ab$Hs`8q8aHyq`8aHy]`8L8aHyM`8-8abHy5`KD8ab$Hs`KLKKd0bPahp| @|&| @|&K KK|` @K C BrToolCall|`8`aA`!QxH%A(|zybAp A8b  , @H8x;0cH2}A(8}@Hx80cIcx&}@"<脛H2AA(cKU0bP| @AXb0|#@Ap`dbh|$@@8(?@LcxH88!zcC}AaN 88cC8!}KĘK8p0`bh|&(@@KXK8 ;8x0cH1-A(8}@Hx80cIcx&}@"<脛H0A(cK0bP| @A`K(?A88cC8!}K8 ;bp8xccfH0}A(8|@H880xx&} "H0IA(cK]89`"P8`9`BXh@|;H@|P@@P[, A$gK`bp A K(88`K`K9 `9@A[, $AK`DK AxBrNameAllocate|}&aAT>;!;;;`;@aA!xp!"a`h8b,&8|xc$|*A 4pA  , @ K1"| @ ܈ , @  8"08b8xc&H.QA(@H8b8q8cx&x$||0*H. A(8bK!Pp~9@AX|9@@ b`bhpx}9 @@88bx&| *Hm``u8bK 8c&8b8xH-yA(8b`8cx&|VH-UA(8bKiAX|9@@ b`bh@8`e8`8K-,A,@l, dALp`A , @0Kq| @ , @ 8c&8b8xH,A(88b8cx&| x$|@*H,]A(8bKqAX|9@@ b`bhA`8`80*8! |px} !Aa!AaN KMKKEK|` @xKa`8HrA(,#@l8"B9bax` y$|H*KQ8`8KE,@$, dAp`A , @K| @ , @ 8c&8b8xH*A(88b8cx&| x$|@*H*}A(8bKAX|9@@ b`bhA`8`8K KKTKK,|` @K4abx&| *Hi``v8bK bx&|PHi``v8bKbx&| *Hi``v8bKb<`b8c HqA(,#AAdX|9@AX<`::wT:W :#B@: ````!,b0@@,@4|~||P,@ 4T~|`9A,#A,:;@b8o HpiA(,#@,:Atbx&| *Hh``~8bKcx&|PHh``~8bKaHp)A(,@,;A(h, A, dAp`A , @K| @ , @ 8c&8b8xH'A(88b8cx&| x$|@*H'A(8bKAX|9@@ b`bhA`8`8KLKKTKK,|` @K4apKKcx&| *Hg`8bK18c&8b8xx&|T H&A(8bKAX|9@@ b`bh@8K89"Bbax`x $|H*K8`8Ky,A8KTb8qH&9A(8 b<8B@ x&|w| @$8b8H%A(8bK K08bH%A(8bKKb8qH%A(|8bx& | *@8H%A(8bKKH%}A(8bKKbx&| *HeY``v8bKic&88b8xx&|8*H%%A(8bK98aph`@cHqA(8ap88Hh`,@c}8ap8qHh`,8apAp8]Hh}`,8apAT8Hha`,@;@;:K8ap8Hh5`,@`;@;:K\;`Kp8ap8Hh`,@PKH:X<`b`B:7T: 9B@9 }@`!,@Db0,@4|~||P,@ 4T~|`9A,#A,:;@(bb8c HkA(,#AKb8qH#YA(|x8bx& | *@8H#-A(8bKAKH#A(8bK-K|bx&| *Hb``v8bKc&88b8xx&|8*H"A(8bK8aphLRpBA@cHoMA(8ap88HfQ`,@c}8ap8qHf1`,8apA8]Hf`,8apA8He`,@;@;:Kp8ap8He`,@H;@;:KD8ap8He`,@XKPKMK8"0PpHpx~9@@}9 @KKK| @K C BrFileDisplay|`a!QaxHsmA(|{ybAp AH8 ;p8xccH A(8}@Hx8(x&} "H A(cK89`"P8`9`BXh@|@8ExcKu88889b9 H(8b88899 8VcVTUe?89 88`PY ](a0<8|8@?x9 HP@XD8 `hpx (08@Hpx (0HPX`hhpc`ı?bp8!}!Aa (08@HPXxN A BrDbfAllocate,#M H8N @ BrDbfFree|`8`aA`!QxHhA(|zybAp A`8b  , @8x;0cH=A(8}@Hx8qhcIcx&}@"<脛HA(cK0bP| @A,Xb0|#@Ap`dbh|$@@8(?@cxK]88 zcCL (08<DPX`hpx8!}AaN 888 cCL (08<DPX`hpxKK 8p0`bh|&(@@KK18 ;8x0cHqA(8}@Hx8qhcIcx&}@"<脛H5A(cKI0bP| @A`K4(?Ad888 cCK8 ;bp8xccfHA(8|@H88qhxx&} "HA(cK89`"P8`9`BXh@|;H@|P@@P[, A$gK=`bp AK88`K`K9 `9@A[, $AK`DK ABrAsmfAllocate,#M HXN @ BrAsmfFree|`~8`aA`!!AxHdA(|y@ ;8bp8xccfHA(8|@HH88Pxx&} "HA(cK89"XBPh9`9`@8`|;H@|P@[LFBA,$AK]`H8`gKI`bp AĈd ,#AK8 ;08xcHA(8}@FHx8Pccx&}@"<脛HA(cK8P0Xbh`|&(@pA |&8@@|&(@@8(>8@8xcEK89 888b8H$8b9 8888?` 8!!A} (c08@|HPX`hpxa (08@HPX`hpxN "Al BrTspAllocate,#M HN @ BrTspFree|`8`aA`!QxH`A(|zybAȀp A8b ; , @8x0cH A(8}@Hx8QcIcx&}@"<脛H A(cK0bP| @AlXb0|#@A\p`dbh|$@@88bh(?@cxK88 8 zcC{ }$,4<DLX`hlpxy8!}AaN 888 8 cC {}$,4<DLX`hlpxyKdbhK8p0b`h|&(@@KKر8 08xcH A(8}@Hx8QcIcx&}@"<脛H A(cK0bP| @AdK(?A,888 8 cCK8 ;bp8xccfH QA(8|@H88Qxx&} "H A(cK189`"P8`9`BXh@|;H@|P@@P[, A$gK`bp AK|88`KǙ`K9 `9@A[, $AK`DK A$BrDiskAllocate,#M HN @ BrDiskFree|`8`aA`!QxH\A(|zy@ ;8bp8xccfH yA(8|@H88xx&} "H EA(cKY89"XBPh9`9`@8`|;H@|P@[LFBA,$AK`H8`gK`bp AĈ} ,#AKE8 ;b08xccHA(8{@Hx8cIcx&}@"<脛HEA(ccKY8P0Xbh`|&(@pA |&8@@|&(@@8(?8@4xcK8888zbH 88b88= X: \8c (08zcC@HPX`hpxȐ  (08@HPT\dlpxȘ (08@HPX`hpx8!}AaN ABrInstAllocate,#M HN @ BrInstFree|`8`HaA`!QxHWA(|zybAXp A 8b  , @8x;0cHA(8}@Hx8q`cIcx&}@"<脛HA(cKԵ0bP| @AXb0|#@Ap`dbh|$@@8(?@pcxK8zcC (08<@8!}AaN 88cC (08<@KKL8p0`bh|&(@@KK8 ;8x0cHQA(8}@Hx8q`cIcx&}@"<脛HA(cK)0bP| @A`Kt(?A88cCK 8 ;bp8xccfHA(8|@H8H8q`xx&} "HmA(cKҁ89`"P8`9`BXh@|;H@|P@@P[, A$gK`bp A K88`K`K9 `9@A[, $AK`DK ABrServAllocate,#M HxN @ BrServFree|`8`(aA`!QxHSeA(|zybA8p A8b ; , @d8x0cHA(8}@Hx8q\cIcx&}@"<脛HA(cKЕ0bP| @AXb0|#@Ap`dbh|$@@8bh(?@XcxK88!zcC} AaN 88cC 8!}KbhKl8p0b`h|&(@@K8K 8 08xcHQA(8}@Hx8q\cIcx&}@"<脛HA(cK)0bP| @AdK(?A88cC K8 ;bp8xccfHA(8|@H8(8q\xx&} "HmA(cK΁89`"P8`9`BXh@|;H@|P@@P[, A$gK`bp A K 88`K`K9 `9@A[, $AK`DK A BrArtAllocate,#M HxN @ BrArtFree|`8`0aA`!QxHOeA(|zybA@p A8b ; , @x8x0cHA(8}@Hx8qXcIcx&}@"<脛HA(cK̕0bP| @AXb0|#@Ap`dbh|$@@8bh(?@hcxK88 xz8 cC (8!}AaN 88` 8xd8 cC (KbhKX8p0b`h|&(@@K$K8 08xcH=A(8}@Hx8qXcIcx&}@"<脛HA(cK0bP| @AdK(?A88` 8xd8 K8 ;bp8xccfHA(8|@H808qXxx&} "HeA(cKy89`"P8`9`BXh@|;H@|P@@P[, A$gK `bp AK88`K`K9 `9@A[, $AK`DK A BrColAllocate,#M HxN @ BrColFree|``aA!Qa8` xHKUA(|zy@ ;bp88xccfHA(H@8|8 8qTxx&} "HA(cKȩP|;@AX|;@@b`8bh8@[, A8`8K5`H88`K`bp Ab , AKĕ 8;08xcHA(H@8|x8qTccIx&}@"<脛HA(cKǩPb0|#@AX|#@@b`8bhp0|$@@8(?@<xcK8z&GfH,88&GfcC̰԰ְذڰܰް   (08@HPT\dlptx|ĐȐ̐АԐؐܐ TX$8!Đ\a},̐`4Ԑd<ܐhDlLpTt\xd|l t|$,4<DAN AL BrOwnAllocate,#M HN @ BrOwnFree|``aA!Qa8`HxHEA(|zy@ ;bp88xccfH A(H@8|8H8qHxx&} "HA(cKP|;@AX|;@@b`8bh8@[, A8`8Ku`H88`K]`bp Ab , AK 8;08xcHA(H@8|x8qHccIx&}@"<脛HA(cKPb0|#@AX|#@@b`8bhp;0|$@@8H;(?@8xcK88 8 8 zx8 H(88 8 x8 8 8}8z z(zcC08@HPX `,{ưb-d4fgiklmpxy{Ԑ  (08@HPX`hpx $68@8!:I<XLqNqPTDH`bdafhijklmnopqrstuvwxyz{|}~˜ØĘŘƘǘȘɘʘ˘̘͘Θ (08@A}N A BrTabAllocate,#M HN @ BrTabFree|`}8`aA`!a!xH?A(|y@ ;b8Bp8xcccFHA(8{@H88q<xx&} "HA(ccK89"XBPh9`9`@8`|:H@|P@[LFBA,$AKe`H8`gKQ`;bp AȈd ,#AK8b ;08xcHA(8~@Hx8q@ExcKvH 8(<@ExcKvH 8(=@ExcKv H 8 (;@DExccK]88v(b80@H488b(808@8!}!AaN A \ BrParAllocate,#M HxXN @ BrParFree|`a!Qax8`HA(|{ybAp AdH8 ;p8xccH-A(8}@H88qxx&} "HA(cK 89`"P8`9`BXh@|g]haN bp AK0`D[, AgKM`K A8BrEcolAllocate,#M HN @ BrEcolFree|}&!qaxbЀ ; .A ,A8`,A,AA|, AT`d, A 8, A4, @, 8^8A, AK8!|} N bx8cHϩ`, AKtbx8c Hυ`AKLbx8c$Hi`,AAK(bx8c!`axAp!h`b|XPc8,#8|!ѐxc$|*A pA b , @ KZb| @ db , @ L;b 8x80ccHA(@"8{Hx$x&|"|0*HA(ccK]Pb0|#@AX|#@@b`8bhp;`0|$@@8,:BA (`zp,?A\c``!X, @Y, A,8, A T|@j|@`cx|`y@"H@8bx&| *H̝`ap8bK\@8b8nLx&| HmA(8bK\@8b8nx&| HAA(8bK\U0h: <~` :@ m üm$: *:,?A,cX, @Y, A8, AT|@zh|Al, @`, @Tg, @H, A$A8,, @,b, @b, A , @t`A(, A\,AW, AD),@4+, A, @-, @, A, A ȲAAu9,#A, @o@c,#A ,@A |, AB, @, @u,#@Јu,#@Ĉu,#@ug,#@bc, A, A,A؈oT,#|d|d|f.p|f*xe&|Pxd|*A!,$A/`A|@$rr@舕+,$A,$@Ј-,$@Ĉ,$@/`|h|!؁p8ol@ 89Axb|H9A(zz|@8bx&| *HA(8bKY:`o`A*p/*,Z`ؚp@؀,@̈, @a,.A````!| x@An|@|8mXb, @Y, A\, AB, @,%@H1A(@8bx&| *HA(8bKX%x}sy@hT|@zh|Ax,/@, @T, @H, @<g, @0b, A , Az8|@x@apx&| *H]``8bKWm, A؈m, A; 8*z<˚``Te,#| |"|.p*{&|Pxd"A`|`Hm \m$!H <$2), @4+, A, @-, @, Apü A8ہۡ8 ap9!8x@b8p4`HA(, @, @, @g, @b, A, A@8bx&| HA(8bKUbd, Alp`Ab , @LKRb| @b , @  8b8x80H)A(@88(x$x&| *|@HA(8bKUPb0|#@AX|#@@ b`cbhp0|$@A`c@( ˡˁ8!0}dPX`8!hApax!AaؐN KPKKPK|` @tKہ8 b8p8HA(K,$8a8H`KhہX8p9!b 88pl@XAHA(K K; 8*KL), @4+, A, @-, @, ALzp\ ˚`@\$ہ8pbAa( (HA(K˚` b8pہHA(K/`O|c8o0o|88!A9!a؁apx|bAHaA(K( !@KAKd@du+,#Au,#@Lu-,#@@u,#@4/`8o!b8`|HA(K/`O8o8o9!!Aa(pb|A(HA(Kt/`8n`!8b8HqA(@8bx&| *HQA(8bKQe/`x`@*z}{y8czZ`@,KL!K!K<,A0`:pzh:xz Khc~:xz`:pz KKMAK;`K`KM1K| @K"Ad BrDistPrint|}&H)``;aA;@!; ;xph``aXAP!H@80bb!8 8,'|xc$|*A pA܈ , @ KL| @ , @  8:08xbH)A(@8wHx&x$|"|@*H~A(bKOPb0|#@AX|#@@ b`#bhp0|$@@8,?A @,cA T|@j|@```!cx|`yAT|@K@H8bx&| *H-``v8bKN=H8bx&|8l H}A(8bKN H8bx&|8l H}A(8bKMbH<,?~`:c .-:AÄm $m$A\cA~ 8, @=, A(T|@h|@`ALx}{y@|@,?;AKHbx&|(*H``8bKM,:@Ahb8 m Cm$!h >$2bc),#@4bc+,#Abc,#@bc,#@xWF <`@9!`eb8n(|(|*|.p|2x&|(Pxd|2xH|A(H8bx&| H{A(8bKL {, A`p`A؈ , @DKHe| @ , @  88b08xH{A(8Hx&|8(x$@|@*H{QA(8bKKePb0|#@AX|#@@ b`#bhp0|$@A`#zd} 88!p|08@!HAPaX`hpx!AaHKG-KKG%K|` @|K<`WE$`f9!bۡ 8m@`|0|2|.pA؁p|*x&|(Pxd|2Hz A(K8`*aKDo( HyA(@9 9 *9Abb%, ,9/ /LZB`V>A@,$A@O, АVA@$2r@rAB,$@,(@`),$@0)+,)A,$@舄,$A9 AA9*o`А}Pl, A|bAȏ @oA,$Ao!|.p`ؐ|:؁xap!x&8m(}g0Pyld|bHxEA(*8bx&| *Hx%A(8bKH9|*b0T>,@,@bh, @b,0A``!| x@Ap|@Xb, @Y, Ad, AB, @,%@8mHwUA(8bx&| *Hw9A(8bKGMx~y@`T|@܀h|AKz $KPlKxKtVb%bA9ApA8m` А}|B|.p|:x&}0Py d|J!HvA(KX!AdKHO`K~8, @=, Ah|@`@ @o0HA( T>bc9,#A, @o@c,#A ,@$o~ ,1A8` a$2r@rbc,#A bcB,#@,'@bc),#@4bc+,#Abc,#@bc,#Ao,Aȏ @OAbc,#AO8` aV&bb ؐaH9AAXA8m(`АAp؁x||:|.p|2x&|0Pxd|:H!XHtA(*8bx&| *HtA(8bKD|*b0T>,@܀,@b, @bh#b ,1A`!| x@Aq|@Xb, @Y, Ad, AB, @,%@8mHsA(8bx&| *HsA(8bKC1x~ y@`h|AHx}{y@K8[ $KT@ؐPlKD@ؐ8`*aPlK4V&bba(9ApA88m` ؐ||:|.p(|2!8x&|0Pxd|:HrA(KD@8`*aKo`Ko(HIA( T>Kjx,|@`````!A,jcx,|@K@H8bx&| *H=``v8bKBMH8bx&|8l Hr A(8bKBH8bx&|8l HqA(8bKAbH~<`.:c -:AÄm $m$KpK>9KLK>1K(| @K,"C BrDurPrint`aA!:aA!xpb|c}&8,#|xc$8!Q|*A pAb , @ K=%b| @b , @ h; 8x80cHpEA(@8|Hbx$|0*x&|"Hp A(cK@!Pb0|#@AX|#@@b`8bhp0|$@@8,?AHc``!, @$d@, @|@`x|#y@;;bH,B0~P::h:x |&;@ccx&| *H``p8bK?)." qcgA ,A P,@8b8x08HnA(@b8kx&|AHnA(8bK>|:@AX|:@@ b`bp|:@@b@bx&| *HU``{8bK>e@8b8lx&| Hn%A(8bK>9@ccx&| *H``{8bK>~ @x@L:@8,?:RAXc~E,$@(@,$@|A``!cx|dyA,$@K|2@A(<A4bd, ALp`Ab , @,K9b| @b , @ 8b8x80HlA(@b8(x$| *x&|@HlA(8bK<|:@AX|:@@ b`bp|:@A`~88!} |px!Aa!AaN K8KK8K|` @K#cA$8l@#b!paApHkA(@8bx&| *HkA(8bK;K$,@\:@:,?:R8AT~Ec, @$q@, @ |A<`!1x~ yA, @K8|A|2@@K1qA$8l@1b!aAHjA(@8bx&| *HjA(8bK:1x~ yAh |A1x~ yAP |@8lhbHjqA(8b@x&| *HjQA(8bK:eKbK:@,.--~ &,~&9,?:R8Ax~Ec``!, @Xo@, @H~( @$|pA@(|pA@,|pA$@0|pA4x}{y@~ @8|AA|2@@KP/oA$8l@/b!aAHi1A(@8bx&| *HiA(8bK9%x}{yAh0|pAx}{yAP0|p@8lhbHhA(8b@x&| *HhA(8bK8Ka~ @K/oA$8l@/b!aAHhQA(@8bx&| *Hh1A(8bK8Ex}{yA,|pAx}{yAp,|p@8lhbHgA(8b@x&| *HgA(8bK7K/oA$8l@/b!aAppHgA(@8bx&| *HgaA(8bK7ux}{yA(|pAx}{yA(|p@8lhbHgA(8b@x&| *HfA(8bK7 K/oA$8l@/b!aAHfA(@8bx&| *HfA(8bK6x}{yA$|pAx}{yAЀ$|p@8lhbHfEA(8b@x&| *Hf%A(8bK69Kb8WbEHfA(8b8x80cgHeA(@bx&|AHeA(8bK5|:@bX|@LB0BA$K8b8x08HeA(@b8kx&|AHeiA(8bK5}|:@AK8b08x8He=A(@b8kx&|AHeA(8bK5-|:@A|KlK1KK1Kl| @4Kt"C ` BrSetPrint``|aA!aA!xpb!"8؀,&8|xc$|*A pA  , @ K0| @ tb , @ \ 8;08xccHcA(b@8}Hx&x$|"|0*HcA(cK3P|<@AX|<@@b`8bhp|<@@8c8SHyA(@Hc8v8xx&|HEA(c8hH1A(,?A bc@ihixipi`ZcZZ[ ȡ#[Ci!ءciiAaCZ#ZAZZ!ZZici (a0CiA8`!, @}@, @aȘ}@,@}@,@}@,@ }@, @ 8, @ , @ 8a萁 "4, @a 4,@4,@  !!"4,@  ! !"4,@4,@ (0 !8!"4,@V, @8a(=!88Sd8H`A(9@*c@}\98=`e, .=,!(/ !H/)@X9d( *+@ A,AH,@8,@9@ -a.8iA/!01234A5]AAp!xaA!=ZAHA!aHA(xy@4@c8SHA(B@Hc8w8xx&|H]A(c8jHIA(cb@#ihixjjHPc?jcZJX```!8a(,8Sd@tX 4, @ a4, @P4,@H4,@=!XXH^9A(8c\=`/ , 9DJ=J!ha(A, , @9D)A*@ A, AH, @8!+-8j,./0a1A2!345]AapxA!aA!AZAhHA(xy@p@c8SH]A(@Hc8x8xx&|H)A(c8k HA(``!,Axy@4p A"8B9b9p cxx $|H*KGa}, AhbpA܈ , @DK(pA , @ 8;8xcH[A(@8~8Hx&|x$ |0*H[A(cK+P|<@AX|<@@b`8bh|<@@88`88!}px!Aa!AaN K'qKK'iK|` @KcHA(,@8e, Ap`A , @K'| @b , @ 8;8xcHZ1A(@88Hx&|x$ |0*HYA(cK* P|=@AX|=@@b`8bhp|=@@88`8KdK&)K4K&!K|` @K8"9Bb9p cx $|H*KDA, @b| @K8a(?!x8SdxHXA(c\?`/ (, 8)!*!A+A, , @8a,-@ A, AH, @8Z.8ka0/A1!234apxaA!Ȋ5_AHQA(KT@ 8K\8KT@ 9DK9DK@ 9dK@ 9dK@ 9dK9dK8VHH9`K8a8VHH!`K8a8iH `K8a8iH`Kc8SHA(Hc8wx&|8xHYA(c8jHEA(c8SH1A(Hc8xx&|8xHA(c8k HA(KK#1K0KLK#Kl| @Kt"AX BrDbfPrint|``aA!aA!xpb!8f,%8cf|cxc$|*A `pbA , @ @K")b| @b , @ 8x;8 0cHUIA(8|@bHBx$x&|"|0*HU A(cK%!8P0Xbh`|&(@pA |&8@@|&(@@8,?bHAb ;C>````!?(9@;=b8x80HTmA(@8|cc&x&| *HTIA(c8_|HA( c8_"?_&*?.pax!2H5A(8|`yA x@|`yA `6Jc8`?P_ZHA(?`_hc8`Tpȟxȿ^?_!Aa؁ ء0px!Aa! A0HuA(?_c8a$ȟȿ!@APa`؁pءpx@P`p!AH A(?_c8aȟ JNFR?>_B!Aa ؁0px 0HA(T(@ 8U(@ 8V(@ 8W(@ 9X(@ x9=Y(@ `9]Z(@ H8[(@ 09}\(@ 9](@ ;=^(@;_(@:`(@:a(@:b(@:c(@p:}d(@X:]e(@@:=f(@(:g(@9h(@9c8b@pax!aA!pHA((%@8(&@8('@8((@9?()@9=c8chHA((%@8(&@8('@8((@9?()@9=_(*@9]( @8c8cpaxHA((%@8(&@8 ? _( ?@826c8d0apx!(HA(8(@89(@8:(@8<(@9=(@9=>(@9]?(@8@(@t9}A(@\9B(@D;=C(@,;D(@:E(@:]F(@:JNc8dRpax!AaHiA(VX(&@8`('@8j?p()@9=_x~(@D9(@,9}c8epxaHA((@8(@8?_c8fPȟȿ?_ɟ!@APa`؁pءpx!Aaفɿ١@P!`ApHEA((@@8c8gh?_ pH A(c8g8 ?(_0pHA(@(@8A(@8H('@8P((@9?Xc8h4`_\apaxxHiA(4p @xy@lcH=A(,@bd, T`zAdb, A , @DKQb| @b , @8x;8 0cHKqA(8(8@Hx$x&|"|0*@HK5A(cKI8P0Xbhp|% @`A |%0@@|%@@@8@8!0}pxd!Aa8!AaN KKKK|` @K89`9"bP_iyJ$|P*K55K,89`9"bbP\xiyJ$|P*K4,?AK8KP8K88K8K$8K 9}K9K:K :]K:K;K;=K9K9}K8Kx9]K`9=KH9K08K8K8K9K 9K:K:=K:]K:}K:K|:Kd:KL:K4;K;=K9K9}K8K9]K9=K9Kt8K\8KD8K,8K8KKKKK| @K"A BrDbfDumpT>aA`{b|!8$!A8|,&xc$x|*ApA| , @xK| @` , @L 8;08xcHG=A(@8}Hxx&x$|"|@*HGA(cKPb0|#@AX|#@@b`8bhp0| @@8axcH `,#A8`z , @ ,<@;,9Alz`!|A, A `K8cH)A(8c8x$| *K7`{y`yccH`  $$,,~, A4p`A܈ , @K9| @ , @ 8;08xcHE]A(@8c'Hx&x$|"|@*HHE!A(cK5Pb0|#@AX|#@@b`8bh0| @@8c#8!}!AЀa8N K-K K%K|` @KcHeA(`{cH `,@YyH9A(|Ax8|||H9A(,A\ccCH `KH8cHA(8c8x$| *K5M`y{ccH`  $$,,Kc88,8H6M``|K~, A0p`A , @Kـ| @Ĉ , @ 8;08xcHBA(@8H8x&x$|"|@*@HBA(cKPb0|#@AX|#@@b`8bh0| @@88`8!}a8N KKKK|` @KKKpK`KK| @K"A BrDiskInsert|ۡہ}&;aA!:axAp!h`XP!QaЀf84Y8cf|c,$xc$|*AdpA؈ , @HK | @ , @$ 8;b8x0ccH@A(@8{BH"x$x&|"|0*H@qA(ccKPb0|#@AX|#@@ b`bhp0|$@@8b,$A0;b;`;@B, AԈC, @bHˣz, @|bHAl 8R:"p8xbc&H?A(Hb@;w8wx&|J@H?mA(bKBPh}@AX|9@@ b`b8Wc&8xH?A(ccHx&|*H>A(bK AX|9@@ b`}, A`p`AȈ , @DK I| @ , @ b808xH>uA(cc8x&| x$|0*H>AA(bKU0P| @Ab0X|#@@ b`b0|#@A`8`8|ˡ8!} PX`!hApax!AaN K KK K|` @lKb @b, @, @܈9, @@$pv2ApHb@8U8b"p`w8xc&x&|*HV@h|`A$H{A(|`||xA`|P|``oHA(,#@dac%H Ñ`,A,<||A,@b @8 `d8d:c&8xbH8qA(b@;w8wBHx$x&| *| H8-A(bKABPh}@AK|,;A: bPb@p;w}@A| h, @dKmb8c&8xH7A(cccHx&|"H7A(bKA4KK Kb8c&8xH7MA(ccBHx&|"H7%A(bK9AX|9@@ b`hb؛KK :P b@h;w}@K:P b@h;w}@Kx;wpAX , @Db8Hc&8xx&|#`H6eA(bKyAKKKb8c&8xH6-A(ccHx&|"H6A(bKAX|9@@ b`bKKD|``oHwA(8^|e}zbax&,& , /( | *@@@H5iA(bK}8 n8 ,^,%^@,&^@8 @KKK8, KKpAKbK pAKb8c&8xH4A(bx&| *H4A(bK;`;@K b|cHyA(,AaHy)A(A| @V@T|`A HuA(|`|x|A|P|``qHzA(,#AlKh|``qHu1A(|db%b~$x&, , /' | *@@@H2A(bKq,^,#^@ 8 ,$^@Q@QKK9K9,.KK%pAKbKpAKb8c&8xH2AA(ax&| *H2A(bK1;`;@LNPBA4b`K(b|cHvA(,Ab#HvA(A| @(KKQKKIKKAK| @xK"C`4 BrRawOffsGet;;aA;`;@!``t`b|aA}&!xp8D8!|,&xc$|*ApA , @K5| @p , @\ 8;"08xc#H0YA(@8yH8^x&x$|"|@*H0A(c#K-Pb0|#@AX|#@@ b`bh"p0| @@8b`PcH}A(,ADb|A,8"Bbc#c9) y)$|H*KqbP@h}9@aH}aA(8c&H8b8xx&|<`H/A(8bKAX|9@@ b`}, A\p`AЈ , @@KU| @ , @ 88b08xH.}A(88bx&8c|x$ |@*H.EA(8bKY0P| @Ab0X|#@@ b`b0|#@A`8`8`Z8!P|px} !Aa!AaN K!KKK|` @xKc8V|HtA(,#@d8"B9bc#c9 x $|H*K!bP@h}9@K`wc8c%H `,@bP@h}9@K|bbb8_THzA(,A bHtMA(,A`8"Bbc#c9 x $|H*KYbP@h}9@K8apb8_\0H, A(8`8p"8c899)c*H `,#AapAԈ , @ ,8 8:0b8xH+A(@8vH8^x&x$|"|(*H+=A(bKQPb0|#@AX|#@@ b`bh0| @@88>bb`HreA(,#AP}9@AbX|9@A8@H:h@:@^| 9:":e@b`````!@,;@|| @X , @8@( , @8, O@TA$|`zHl A(|`||A@|P|`z`pHqyA(,#@tac%0H `,A,<||A ,AT,;A4bPb @p}9@Ah , @K 8c&8b8xH)MA(c8bH8cx&0|"H)A(8bK1AX|9@@ b`KKK8c&8b8xH(A(8bBH8cx&0|"H(A(8bKAX|9@@ b`hb؛KKb P@h}9@KaHvqA(,Ab|@$}, Ap`A؈ , @K| @ , @ 8;08xcH'A(@88Hx&x$|"|@* H'A(cKPb0|#@AX|#@@ b`bh0| @A`8`8K@KK8KK|` @K89"B9bbP x$|8*KKpAd , @P8c&H8b8xx&|#`H&yA(8bKAlX|9@@hK\KK 8c&8b8xH&1A(8bH8cx&0|"H&A(8bKAX|9@@ b`bKK0|`z`pHgA(b|d8b~x&,' , | *@P, @P@PH%mA(8bK8 8` ,$^@,%^@p,&^8 @ KKK8, KKpAKbKpAK8 c&8b8xH$A(8nx&0| *H$A(8bK;`;@K0b0HfA(`|b(HfA((#(A:A:V?~.<AԀ| @K8@XH:b:@ : ^| h@9&"!:f@}(@b`o@,;@x| @T , @4@$ , @8, N@XA$|`rHeA(|`||A|P|`r`oHjA(,#A|@dKp|`r`oHe-A(a|d8b}zx&,& , | *@/, @/@/H"A(8bKo, ^@ 8 ,#^@O,$^@OKK9K8, KK%pAKbKpAK8 c&8b8xH"=A(8b8cx&0| *H"A(8bK);`;@LJpBA(b`Ka0HcA(`|(aHcqA((#(A:A:V?~.<AȀ| @KK)K8"9Bbc#c9 xx $|H*K YbP@h}9@KKK"pKPKKx| @K| CdBrWallPassChange;;;aA;`!`T>`uaA!xpb|c}&8,#|xc$8X!|*A pAb , @Kb| @b , @;B 8x80cCHA(@"8z8^Hx$x&|"|0*HuA(cCKPb0|#@AX|#@@ b`bhBp0| @@8b`#P!c#Hm9A(,AXb|A@8"BcCc&9 x$|8*K bP"h}:@aHlA(@H8x88bcFx&|:<HeA(8bKyAX|:@@ b`bd, Alp`Ab , @LKb| @b , @  8b8x80HA(@8H8b8cx$x&|"|0* HA(8bK0P| @Ab0X|#@@ b`b0|#@A`8`8`Z8!P|px} !Aa!AaN KiKKaK|` @xKc#8V|HdA(,#@`8"9`BcCc&9ix$|8*KmbP"h}:@K`xc#8cEH uI`,@P"h}:@Kpc8^bHjMA(,A |cHcA(,A\8"cCc&9^yG$|8*KbP"h}:@Kb88)880HI``f8ap8_c%HQA(,7A 8_48apH``8`8p8899<cJH `,#AapAb , @ P"8 8x:80bHA(@8v8^Hx$x&|"|(*HqA(bKPb0|#@AX|#@@ b`bh0| @@88<`b`HaA(,#AP}:@AX|:@A8@H"h<: :e":E@| : ``````!@,=@b| @d , @@@0b , @8, n@XA$|`rH[-A(|`||AD|P|`r`oH`A(,#@h0acEH `,A,>|~A ,AL,=A0bP }: @pAb"h , @|K-8b8x8cFHuA(@Hc08b8cx&|""HEA(8bKYAX|:@@ b`K|KK8b8x8cFHA(@H08b8cx&|""HA(8bKAX|:@@ b`"hb؛KK P"h}:@KaHeA(,Ab|@4bd, Ap`Ab , @Kb| @b , @; 8x80cHA(@8~8Hx$x&|"|0* HA(cKPb0|#@AX|#@@ b`bh0| @A`8`8KKKAĀ| @K8@HX<| b: "h9":f@}(@:@ : ^``o@,=@b| @` , @<@,b , @8, n@XA$|`rHTA(|`||A|P|`r`oHZA(,#Ah@hKd|`r`oHT=A(a@|`8b}z, , @/,' x&@/@/| *HA(8bKo, ^@ 8 ,#^@O,$^@ OKKEK8, KK1bpAKbKbpAK8x8b8cFHIA(@8b08cx&| *H!A(8bK5;;`b`LJpBAK a0HRA(`~(aHR}A((#(bA:A:V?~.>A| @KK1K8_H8apHV!`KH9`8BcC9"dxx$c&|8*KMbP"h}:@KKܹKHBpKKܩK| @K C BrWallEnable;;aA;`!`ub|aA}&!xp`98h!8|xc$,&|*ApA , @Kۙ| @h , @T 8"08b!8xc&HA(B@H8b8^8cx&x$}|0*HuA(8bKމP|9@~&~ AX|9@@ b`c#"hp|#@|&| @8H8bx&| *HM``t8bKKځ 88b8xH A(8bbx&8c|< H A(8bKݭ~ AXa|#@@ b`a|h @8bx&| *HM=`8bKQb`cPaH[IA(,A8b|A 8"Bbc9) y)$|H*K}@aHZA(8cH8b8xx&|<`H yA(8bK܍AX|8@@ b`}, AXp`Ä , @bb`HPA(,#A}@AbX|8@A8`@H:: 9|` :":@->:`^b````!@,<@Pq| @( , @@ , @@8A$|`HIA(|`||A$|P|``pHO!A(,#@|ac0H )`,A,/|{A ,A@,<A,a}@pA , @Kӽ 8c8b8xHA(cf8bH8cx&0|"HA(8bKAX|8@@ b`KK=K| 8c8b8xHyA(8bH8cx&0|"HMA(8bKaAX|8@@ b`bK=K}@KaHT-A(,Ab|@}, Ap`AЈ , @KY| @ , @ 88b8xHA(8H8bx&8c|x$ |@*HEA(8bKY AXa|#@@ b`a|h A`8`8KKсK@KyK|` @K 89"B9abȐ x$|8*KKpAd , @P8cH8b8xx&|#`H=A(8bKQAX|8@@|KpKйK 8c8b8xHA(8bH8cx&0|"HA(8bKAX|8@@ b`bKӹK0|``pHE}A(b|d8b~x&,' , | *@p, @p@pH1A(8bKE8 8` ,$^@,%^@p,&^8 @(K Kρ@LKKupAKbK݀pAK8 c8b8xHA(8nx&0| *HmA(8bKҁ;;`K\b0HCA(`ob(HCA((#(A:A:V?~./Ab8^HCA(,#A| @KbKpAK8`@X:|` H:|8 @8"9@->:@ : ^b`~`&@,<@lv| @D , @$@ , @@XA$|`HCA(|`||A|P|``nHHA(,#Al@dKx|``nHBA(a|d8b}rx&,& , | *@., @.@.HuA(8bKЉn, ^@ 8 ,#^@N,$^@ NKK@PKKpAKbK)pAK8 c8b8xHA(8b8cx&0| *HA(8bKś;;`~h LNBA0b`K$a0HAA(`o(aHA A((#(A:A:V?~./Aa8^H@A(,#A| @KaK!pAKKˍK8"9Bbc9Ȑ xx $|H*K}@KK-K0bPapB@| @"h|&| @|&KHKKP| @KT C BrWallDisplay|ۡہ}&`;aAT>;!;;`T>U>U4>axApUS>:@!h`: :XP!!b"a8@AHPbX8,%`ah|8cxAp!xx$ P|y!*A>xpA>` , @>\K}| @>Db , @>,8, B "@HA=dhbpa,@=088a0 $"|0P08@88l8HA(a Xa|`y@;bThTzTp 8bx&| *H;`a8bK,0@:88bb8xHA(8b@x&8c|8QWhHmA(8bKˁP|6@AX|6@@ b`|6 @|&| @8a@8HB}A(,#@T9`"8B9a@d x$|8*K~=@8y8b8xHA(8b@8cx&| HmA(8bKʁAXa|#@@ b`e, App`A؈ , @TKƱ| @b , @(88b08xHA(88b8cx&| x$|0*HA(8bKɱ0P| @Ab0X|#@@ b`b0|# @A`8`8|ˡ8!} PX`!hApax!AaN KiKKaK|` @lK8<a`s`A`bDbeH@A(,#A b^@ȡ^H#^J^LC^T!cRRAa^Xc^`ab8, AH, #A@H6A((#A3\8bp9aax9:ada889a a9 :a a8 9a\a908:aa888]9l9!@9A89aa9:aTaHFEA(`s,A1p8aH5A((#@1\, b@1PaHEEA(,A18~!8@88DH܍A(!88a"#$&')*, -!/"0#2$3%&H A(>>, a@a蓞~E, f@ a~EI, i@$a8~EI, p@8~E8, f@8~5H, n@$PaX85~9`;, t@a8@~UY~pt, p@,ahp8~UY~pt, d@(a~UY~pt, s@,a8~UY~pt, f@48~U88]px, v@48~U8]px, r@08~U8]px,@8a8]pH`,@ 8~U8]8a8]`HQ`,@(8~U (80]_8a8]dH`,@ 8~U8]8a8]hH`,@ 8~U8]8a8]tH`,@a8@8~UY8a8]lHm`,@ 8~U8],@,@,AT, @A , &@,A餈, AT,@A@鈈T, &@|:~88~8UaH`8A82,1AX-=A:^MbBbdb#`!H`,Abd1,1b#@@cLMa@8`.~, A,1@88bP8xHEA(8bbe>xc8cx&|@HA(8bK)@K8q bDH`,@@8~8 H`8~8!H`KD:^bdb#```!H`,Abd1,1b#AK8q bDHQ`,AKbC8U88H-``o, A0, A$, APH=`,#A, @bC 8H ``eb(8c'8DHA(8x8bP8xHյA(8ba?xx&8c|8'臯HՅA(8bK@c,=@Dcxp, A;``8`~K8a8;`KaxxK:`BarHA(8c"8x$| *K~ aH`, @,K8~8TH`b8THAA(,#AX: :9H```!:18p:88[88H&A(,, /.`d@/ @a/&@ OA|L#B~.AHA(,aAH A(,8aAHA((#8aApHeA(o8aHUA(o9y$|*8|2, A, @, A 88eHm`K8{;`"8bP8xqH=A(@8bx&~8cx$||8*`HA(8bK @c8bx&| HҽA(8bK;`,AKt,@d8aT8H`,AKP8aH A(~8adHA(~8a8HA(~8a HA(~8a HA(>8a HA(~H, A, @, A 8H8a HA(>"8~H`Kp8~i88H!Q`8o, kA , b@, b@|, h@, @, @, A, rA, sA , t@ԛ, AĈ, s@K, h@K8a\HA(88\|| , +@8\8|8|8a\8UH`,@蓞E8a\8UHi`,@$aؐE~IK8a\8UH-`,@$8~E8M8a\8UH`,@ 8~E88a\8UH`,@aE~I8a\8UH`,@8~E8a\8VHY`,@a8E~I8a\8VH%`,@ 8~E88a\8V8H`,@ (8,a ~EI80KA8a08RH`,@8~5H8a08RHu`,@(8~5phx8=?8a08RH5`,@ 8~5=8a08RH`,@,8~58=?8a08RH`,@$8~58=8a08RH}`,@ 8~58=8a08RHE`,@$PaX85~9`;8a08H `,@$8~58=8a08SH`,@$8~58 =8a08SH`,@$8~58 =8a08HU`,@08~58 =?8a08H `,@08~5 8 =?8a08S H`,@$8~50(8 =8a08S0H`,@08~58@H88=?8a08S@HA`,@08~5PX`88=?,Al8a8H`,@ 8a@U~Yp~t8a8QH`,@(8~UPH8]px8a8QHy`,@(8~UX`8]px8a8QH9`,@$hap8U~Yp~t8a8QH `,@(8~Ux8 ]px8a8QH `,@(8~U8 ]px8a8QH }`,@ aU~Yp~t8a8QH E`,@08~Uph8 ]pt8a8RH `,@08~Ux8 ]pt8a8RH `,@$a8U~Yp~t8a8RH y`,@88~U9 ]_pt8a8R$H )`,@88~U9]_pt8a8R4H `,@(8~U8]px8a8R@H `,@88~U9]_px8a8RTH I`,@(8~U8]px8a8R`H `,@88~U9]_px8a8RpH `,@08~U8]px8a8R|H q`,@08~U8]px8a8RH )`,@8~U88]_pxzKD8a\8V@H `,A܈, @,AK8~E8VHH U`K8a\8VH }`,A\8a\8V H a`,A@8a\8V(H E`,@@AX|>@@8bx&| HA(8bKK8b8b8xHA(8b@8cx&|W`HA(8bKP|6@A$X|6@@ Kb8Sd/!  H5A(8a 8Sl6Vv v V apxa AHA(K89B"a@x$|8*KbP~=@KbThTzTpK<88b08xH-A(8b@8cx&|x$|0*HA(8bK 0bP| @Ab0X|#@@ b`hbpa0| @@8KK5K,<KK%K| @K"C? BrbRunGet|}&H );a^9`;aA;`;@!; ;xp::h`::aXAP:`:@!H@: :809989!;a AX9@(a 8` 08 @H  !P! Гa  Pa A X!  `  h (pa 0A 8x! @ H P XA `a h888bb8;@;  x 8    pA ! A 8,'! 8|x$|*A0bpA , @8, AbpAԈ , @̓8, Aa 88Hi`aa , @a 8HA(a,#@b8B bpx $ |H*x $|H*K 8y;p8xcHA(H@8} x&| HA(cKBPp| @AbpX|#@@b`8"h8{,#A0bpA , @4c, AtbpAT , @@8,?Ax8`88!|08} @!HAPaX`hpx!AaH88b08xH}A(8}8x&| x$|@*HIA(8bK]0| @Ab0X|#@@b`80bp| @@8KHHH|HhH\HHKyK8;8KKaKKYKt8`8a4Kl:e08ea 8a:  b HqA(8ab08?HYA(8ab08HAA(8ab08H)A(8ab089HA(8ab08HA(8ab08XHA(8ab08bHA(8ab08HA(8ab08HA(8ab08tHA(8ab08uHiA(8ab08HQA(8ab084H9A(8a b085H!A(8a(b086H A(8a0b08=HA(8a8bP8\HA(8a@b08HA(8aHb08\HA(8aPb08THA(8aXb08HyA(8a`b08HaA(< ` b`H A(,#A| b 5H:89 84 x9cDAXa : 08 KHxH A(,A b8?8K , @4 , A , A 8;p8xcHA(H@8~8 x&|"8`HeA(cKypbP| @AbpX|#@@b`8bh8K$ 8;p8xcHA(H@8~8 x&|"8`HA(cKpbP| @A|Xbp|#@@xKh p, A,<@ , A  8;08xcHYA(H@8~ x&|"9H1A(cKE0bP| @Ab0X|#@@b`8pb0|#@@bh8cb , @ 8,<@d, @Ј, @4, A, A, A, Ab@, @ 8, A0bpAD , @0 Tc~|9A 8  T> K|Kbc\|K|8aH ܁A(!`9K8a \H eA(@9`$K9=8aH mA(8c8=x$| *KvaH8ypaPH =`@, APK8aH ٭A(y8a8-H eA(,#@8a8/H MA(,#@<,@8aH ۅA( `K98cH 1A(ya8-H A(,#A8cH A(y K8cH A(yK`, A(K8cH A(yK8a \8-H ۅA(,#A\8cH إA(yKH9!88aH ڵA(@!@*8a`H iA(y,A 8a8/H A(,#AKd8a8-H A(,#A8cH A(yK8a8.H ڥA(,#A@8cH A(yK,8a8/H yA(|oy@,/A؁h,/A8aH A(,#Ax|yA 8ha }{yA,<@>bc8P8xHr%A(:V8v 9x&8Y\|8HqA(cKB8bPp|# @@=c8hP8xHqA(bCx&8Y\|8Hq}A(cKA8c8 8aH EA(8c8 x$| *KO8}H `8x8a8H ` |`44|xTA , @: , @: , @:8a8UH `,@9 8a8VH i`,@98  8a8$H 5`,@ , A , @8Ԉ, A%, @8!, @6 , @ , A , A), A6 b808xHoA(bC x&|6HoA(bK?0bP| @AbX| @@ 80bp| @@bh8 , A , A), A5b8108xHoA(bC x&|F HnA(bK? 0bP| @AbX| @@ 80bp| @@bh88a HH }`.@4 H8&, @0, @088`a 8a80H )`,@8a8QH `-8a8RH `@/. 0, A0 , @), A , A 8?8a8RH `,}&} @/4 8@/ (8a8R@H a`,}&} @.88a8RTH 5`-@.x @, A@-B, @-\, At8cH `,|&|  A8a8H `,|&|  A,T8a8QH `,A,88a8QH }`,A,8a8QH a`,A,8a8QH E`,A+8a8QH )`,A+A*8a8QH `,|&| LBBA c8QH `,@*\} A*T8a8RH `,}&} A 8a8R$H `,@ c8RH y`,@)8a8R4H ]`,A)} A*@ c8R4H 5`,@)8a8R`H `-@| LFBNBBA(|c8RH `,U>| LFBA 8a8R$H `,@(8c8R4H `,U>| LFBLNLJBA(c8RTH m`,MBQA'8a8RpH M`,A'8a8R|H 1`,A'8a8RH `,A'| | AHAd8a8R`H `,@ c8RTH `,@,c8R4H `,U>| LFBAb8P8xHhA(bC9 x&8Wl|8HhmA(bK88bPp|# @@&8a 0H `,@8a 0~>8a H `.@81 >8a H q`,@8a ~>8a 8H I`,@L8a 8~28a H !`.@h89 8a @H `,@ a @~8;18a8PH `,@8>8a8PH `|`4T~2,@, AЈ9, AĈ, @bAT, A8,<@, Ac8P8xHbAA(:V8v`88\ x&|HbA(cK2%8bPp|# @@8bhc8a8 H `,A l8a8 pH `,@, @8a8 H ]`,@, @8a8 H 5`,@, @ , AL8a8 H `,@, @ , A8a8 H `,@, @8a8 H `,@, @B, @ 8a8H q`,@, @P8a8HH I`.@, @A,8a8\4H `,@P , @؈, A8b, A(b8&H 9A(,#@p;8aH A(8c8x$| *K>}88oH `nH 9`,A֬, @,<@\bc8P8xH_YA(:V8v x&8YD|8H_%A(cK/98bPp|# @@xc8hP8xH^A(bCx&8YD|8H^A(cK.8ccKc8P8xH^qA(bC8YDx&|8H^IA(cK.]8ccKbbx&| *H ``vcK.Kb8ƒp8xH]A(8v 8YDx&|8H]A(bK-pbP| @ATK88c8SH A(,@x8a8H Y`Kd8aH AA((#A 88}H -`K8a8P$H `,@ HK8a8P4H `,@ HK~8H `,Ap,<@`bc8P8xH\A(:V8v 9x&8H|8H\aA(cK,u8bPp|# @@c8hP8xH\A(bCx&8H|8H[A(cK,8c8a8HH `.AKhc8P8xH[A(bC8Hx&|8H[qA(cK+8Kbbx&| *H A``vcK+QK~8H `,A,<@Lbc8P8xHZA(:V8v 9x&8|8HZA(cK*8bPp|# @@pc8hP8xHZqA(bCx&8|8HZIA(cK*]8cKc8P8xHZ A(bC8x&|8HYA(cK)8cKPbbx&| *H ``vcK)K8a H m`,@$a ~0, A8K 8a8PH `,@K8a @H `,@L89A8a8PH }`,Ah8a8PH a`,@TKH8a8PH A`,A8a8PH %`,A8a8PH `,Ah9Kd2K8a H `,@81@PK@1Kl, @~8H `,A,<@Lbc8P8xHMA(:V8v 9x&8 |8HM]A(cKq8bPp|# @@pc8hP8xHMA(bC8x&8 |8HLA(cK8cKc8P8xHLA(bC88 x&|8HLA(cK8cKXbbx&| *H Q``vcKaKb8P8xHL!A(8a H `|`4T@b8bC`8 98x&| HKA(bK8bPp|# @@ bh48c65K@b8Kb88xHKeA(bC  (8 x&| HK5A(bKI8@Ktb8Kc88xHJA((@Hb8bC8[x&|HJA(cK8@`KPb8Kbx&| *H ``vcK,KPp~&@Axc88xHJAA((@Hb8bC8[x&|HJ A(cK8@Kb8Kc88xHIA((@Hb8bC8[x&|HIA(cK8@4K$b8K8a 8H A`,@K$88aH 9A(8c8x$| *K'~08H `Ka 8~08*Kpb8p8xHHA(8v8|x&|HHA(bKpbP| @AXK@K8a 8H U`,@A@\K~08H 1`,A,<@tbc8P8xHHA(:V8v0 9x&8[|8HGA(cK8bPp|# @@c8hP8xHGA(bC8x&8`|8HGyA(cK8c. A`, @`~08H `,AKDc8P8xHG A(bC88`x&|8HFA(cK8Kpbbx&| *H ``vcKKl8a H u`,@Ȉ, @, @b088xx&| HFIA(bK]0bP| @AbX| @@ 80bp| @@bh88a H `,@L 0*)8a8QH `|`4 T~88T> Kޤa 8~08*Kb8p8xx&| HE]A(bKqpbP| @AbX| @@ 88bh8rp8xHEA(8vx&|@HDA(bKpbP| @AK8a 8H `,@K$;@8aH A(8c8@x$| *K#5~8H i`K488aH IA(8c8x$| *K"~p8H !`K8a8H `,Aܜ8a8 H `,A܀8a8 (H `,@pK`; 8aH A(8c8 x$| *K~ c8H }`K8a8PH E`,@K8a8RpH %`,A<8a8R|H `,A 8a8RH `,@\b8l08xHBA(bC?88x&|脭HBA(bK0bP| @AbX| @@ 80bp| @@bh8K8a8RH 5`,Aڐ8a8RH `,At8a8R$H `,@`KTb8P8xHAA(bC080x&|8HAA(bK8Kc H `,Atb8ƒp8xHAyA(8v9 8Wlx&|8HAIA(bK]pbP| @AK|c8QH `,A8c8QH `,Ac8QH `,Ac8QH `,Ac8QH `,@`Kc8R4H i`,AKc8H I`,A$c8QH -`,Ac8QH `,Ac8QH `,Ac8QH `,AӴc8QH `,AӘK88a8QH `,LRA8a8RH }`,@ 8{),#CA\@KT8a8R$H E`,@8K8a8QH %`,LRB@b8Yp8xH?A(8v x&| H>A(bK pbP| @AK(8a8R`H `,@|Kp8a8R`H `,@8K,8a8R$H e`,@K8a8RH E`,Aи8a8R$H )`,@ФKИ8a8QH `.8a8RH `A8a8RH `.@(K8a8RH `,@!8% , @ , @ , A |||`8,A,<@bc8P8xH=YA(:V8v x&|6H=5A(cK I8bPp|# @@Xc81hP8xH||`|||4T@  ؐT>a ,@D |4T~|`9@bؠ舡c|x|"x|#x|c*x|yAbؠc|x|"x|#x|c*x|yA  , @h8v(@l,e,vAH/t@$8w@8t T>a `o|8a 0H"9A(8 x ,AȀؠa|:x|x|x|x|y@,tA8 x Kpx8bؐH cA(8c)8x$| *K 9 }c}cH g`}8YcH f`}, 9 @@\n, APb8 H f]A(,#Ab8 H fAA(,#A;b0}{y@4(:@aKA8 xKo`cz`!H d`,cAZA@yA zK(:@aKbKh,v@8bؠc|x|"x|#x|c*x|yA$AKnĀbؠ܈ހc|x|"x|#x|c*x|y@,888` x А aKnhbؠ䈡c|x|"x|#x|c*x|y@,888` x А aKn bؠc|x|"x|#x|c*x|yAKmԓ888` x А aKm;bؓH `A(8c)8x$| *K 9 ococH dE`o8YcH d-`o, 9 @@n, @,8t8` x8t  a Klb8 H ciA(,#Ab8 H cMA(,#A;b0}{y@D(:@aK|8t8`A8t x a Kl\cz````!H aq`,cAZA@yA zK(:@aKbKLa@8v@K@K,wA0,xA ,@ cc K}K8x8`x9x8xa А K , Aa ,#@ 8a x a АKkXb8Òp8xHA(8v8 x&|8`HeA(bKypbP| @@KlKlb8Ēp8xH!A(8v8 x&|8HA(bKpbP| @@KkKl,bؠc|x|"x|#x|c*x|yAbؠc|x|"x|#x|c*x|yApbؠ c|x|"x|#x|c*x|yAȀbؠc|x|"x|#x|c*x|yA X8|4Tc~|9@ؠa! x! X|Bx|x|x|"x|c#y@` da|yyA4x, A(``!`|yAx, @8 x `Ki `8`|4T~| 9@hؠ,(.! `ad|`x|*x|x|2x|y@b,<@a8P8xHA(:V8v x&|9`HA(aK8bPp|# @@ bhc pbؠc|x|"x|#x|c*x|yA;!ab8X8c,#|xc$|*A $pAb , @ Kb| @b , @ ;b 8x80ccH 5A(@8{Hx$|0*x&|"H A(ccKPb0|#@AX|#@@b`8bhp0|$@@8b88a "|(P8H ]A(,#A |8ap8TP8l8H AA( $p8"8a||"|P8H ]5A(,#A 8a8TP8l8H A(a8H S)A(,#@b|@\bd, A8p`Ab , @Kb| @b , @; 8x80cH !A(@8|8Hx$|0*x&|" H A(cKPb0|#@AX|#@@b`8bhp0|$@@88`8!}!8AaN KKKK|` @K9`8"B9pdxg$c |8*K;bBP" H@h~<@8b8x8ycH A(8{x&| H A(8bKٽAX|<@@b`8:bd, A0p`Ab , @Kb| @b , @8b8x80H A(8{8x&x$||0* HA(8bK0| @Ab0X|#@@ b`b0|#@A`8` 88!} |!AaN KKKK|` @K8<`{``c$ceH OA(,#A,````!;ZbH IA(,8(A@8, #, A8Y b8@A889H YA(,8alA8D88HqA(,<8al@48H K9`88C8,a@tH``|8al8pH K`8V|,cA,H N}A(|xybcAH XA(,Ac$bceH NqA(,#@4p Al9@8 "p9cGyg$`|8*K;bBP" H@h~<@K|ccH NA(,@,8AcH MA(,Al9` 8cp"xj$9 cd|P*K;bBP" H@h~<@KaH SA(,Al9@ 8"9 pcGyg$ |8*K;bBP" H@h~<@KhcH V)A(,A8 _9`cp"9 yJ$c(|P*eK;bBP" H@h~<@K9@8"9pcGyg$|8*K;bBP" H@h~<@K89` _c9p"cyJ$eh|P*K5;bBP" H@h~<@K89`_c9p"cyJ$e|P*K;bBP" H@h~<@KcbH UaA(,@89` _c9p"cyJ$eh|P*KM;bBP" H@h~<@K0;b" 8x8zpcccHA(H@E8{8x&|@HA(ccKBP~<@AX|<@@b`8h8ccؘx&| HaA(ccKuKt9`8B9p"xg$cd|8*K);bBP" H@h~<@K 9`8B9p"xg$cd|8*K;bBP" H@h~<@KKK(KK| @K C  BrbSlogCleanup``T>;aA;;`b;@|!}&`aA!xp!B8h8|xc$!,&|*A pA  , @ K"| @ b , @ 8, " @Ahp,@88a $"|0P8! (H PA(,#A8a8TP8l8HA(H8bx&| *H ?e`a8bKu88b08xH9A(8bx&8c|W`HA(8bK)0P|5@AX|5@@ b`c|5 @|&| @8a8H F!A(,#@L8"B9b9a x $|H*Ky~?@8y8b8xH5A(H8b8cx&| H A(8bK!AXa|#@@ b`cwe, Adp`A؈ , @HKQ| @b , @88b08xHuA(88b8cx&| x$|@*H=A(8bKQ0P| @Ab0X|#@@ b`cb0|# @A`w8`8PJ8!@|px} !Aa!AaN KKK K|` @xK8<a`r`!`b$bEH CA(,#A8 bH: -~4@@8`8hcQaТQQQ(QȈQ :.0Qԡ#Q8!@CQcQAHaPQQX`R#Rh!pCR4RH ;IA(,Aa?H ;5A(,A@, -@aAH ;A(,AlaBH ;A(,AXC, -@LaDH :A(,A8aEH :A(,A$8aH 7A((#@aH :A(,AaH :A(,A, .A , :@ԈaH :iA(,AaH :UA(,A, .A , :@aH :-A(,AaH :A(,Ap8a H 6A((#@\a H 9A(,AH,@,@,3:@jm8a88h8DHA(8a8H 8a`,A 8a H 7A(`s8a8X@H 85`,@,A ,@, A ,A0,A$,A,A,A<,AAb, x$|d*@`;8KyA(,,@, 8apA~.@H .A((#aDAH 1!A(,aAH 1 A(,aAH 0A(,aAH 0A(y$,8p|nA|8eaH +`8aDH .9A(o8aH .)A(o8aH .A(o8aH . A(o9o,@cszs ,@crzR K8{;@8bP8xVHA("!8bx&8c| *x$|8*HA(8bK`p@cd8bؘx&| *HA(8bK;@}]bH 2A(,#@4aР4p A`"8B9 b9a `x $|H*K%P~?@KH 1A(,@, AT,:A(e, Ap`AԈ , @KA| @b , @88b08xHeA(8H8b8cx&| x$|@*H)A(8bK=0P|>@AX|>@@ b`ca|h A`w8`8KKeKDK]K|` @K e, Ap`AԈ , @K| @b , @88b08xHAA(8H8b8cx&| x$|@*HA(8bK0P|>@AX|>@@ b`ca|h A`w8`8KKAKDK9K|` @K Hax&| *H 'q`8bKb, A8b8P8xH9A(8b8x&8c|8SW H A(8bKPb`|>@c@8K,8b88xHA(8b88cx&|[@HA(8bKP|>@AX|>@@ b`cwK8"9Bba jx $|H*K5P~?@Kb8,H 'A(,#AlKh8}Y8 8H 5y`Kd8}a8DH %`8a H (QA(}8a `H (AA(}8a4H (1A(}8aH (!A(}K: 86K-}K8a8R4H )5`,AT8a8X`H )`,A88a8XlH (`,@K8a8R4H (`,A8a8RpH (`,@\ApK8a8RH (`,A8a8RH (`,@K8a8QH (a`,Al8a8R|H (E`,@KL8a8QH (%`,A(8a8QH ( `,A 8a8QH '`,@K8a8H '`,A8a8QH '`,A8a8QH '`,@0K8a8XDH 'u`,AD8a8XHH 'Y`,A(8a8XLH '=`,A 8a8XPH '!`,A8a8XTH '`,A8a8XXH &`,A8a8X\H &`,@K8aH $A((#A@8aH $A((#A,8aH $A((#A8aH $A((#@8{;@8bP8xVHiA("a8bx&8c|8*x$|8*H)A(8bK=B`r@cd!8bؘx&| *HA(8bK;@K\8a H #A((#A88a H #A((#A$8a `H #A((#A8a4H #A((#AK8z8b8xHeA(8H8b8cx&|@H5A(8bKIP~>@AX|>@@ b`c8bwx&| HA(8bKK8"9Bbad) y)$|H*K˭P~?@K0bThTzTpK88b08xHAA(H8bx&|8cx$|@*HA(8bK0bP| @Ab0X|#@@ b`chbpa0| @@8KߤKEK|,;K|K5KH| @KP C! BraRunGet|}&H .A`;;aA;@!xp; ;h`:XP::aHA@:`:@!80:: ( 99!1bb aHPp!X!(: !`AhbAx!8|8,&x$ 88ct|{!*8a8`;`A;aa 08!@H!P;`aXa`ahapaxa;`a;`a;`a;`aaa;`a;`AcpA , @bKb| @b , @b;B80cC8xH%A(@bH8zAHx$x&|"|0*HA(8bKPb0|#@AX|#@@ b`bhp0|$@@8b)-@, Aab0,@a8aؒ "|0P8H -iA(,#Aa88a8!A8l8HA(B)-@`b08CcCH `,@_b1(, @2c9, A_b9, @_D@_48=8 P, A0`p, A`!`, @ap<8P0=ffbpBxbBX<#AFH A(,#APx, -|`&ab:8SH `,Ahb8VH `,ALbؠ, ##A<HP|2x|:x|cxh..|`yAbH UA((#AWb88 p88U0x8T8 8 \9 09!9A8(H *9A(a8a 8VXH `,}&} @U,A,A,A , @Ux8a 8VH `-@,A ,@UH8a 8VH U`,}&} @,A ,@U8a 8VH `,~&~ @T,@T8a 8VdH `,}&} @,A , @T8a 8SH `,@,A ,@Tt8a 8VH `,@,@TL8a 8VpH Y`,}&} @,A , @T8a 8WH !`,@,A ,@S8a 8W,H `,@,@S8a 8$H `,@, @S} V>| LJ}&} LF~&~ ASD8a 8VH y`,AS(b, |&| @, ARU>| | T>LF| LFARt, A| @b, A} @4b, A$, @, LBqA4| @Fb, @, LBqAF| Al8a H 5A(a8aH QA(X, A| AQAQ|p,Aa|h AQTAQLa|h A<A4@,,#@P| APd,#@Pah~&~ A0A(`, @@X|(@`d-#A~ APAO~ A0A(`, A@aX|(@OD@~ ANPANHb, |&8a H A(aTp>xh|xA| @MAM ,;bAMc8c8xHA(98tcF}x&b|9HұA(cKś@M c8Λc8xH}A(acEbx&|9HYA(cKm;AL@,#@L| APd,#@Kb, |&| @, AK`a99 |PT>!-B5xah|h @, @||(@l-7@8xb`H A(,#@\a`4p @H A(,@a|` 8,A `, Ap`ex,#@Lb)-@(|AT>|(AaTg>|(AT>a@H, A(ax,,$A , Ax, A$haa8xAA@K4,#Ac`!,;ab,A,@A`b8c8xHϵA(8tcFx&| *HϑA(bK@cqxxK];8T>q|`y@TbЈ)-@, A (@b, @Dh|y@ 4,;A ,``,A @b)-@L,7Atb, @d`, @@?Pp;x($8AP88xAHKH`$x(1@`K@, A, @;b0~#@, @H`fb88xHA(cx&|:HA(bKA0bX| @@b0|# @@c, A0b-A, A,<@b, @8, A, A, A, AAxe, ATp`AȈ , @8K| @b , @ b808xH̵A(8t8x&| x$|0*H́A(bK0| @AbX| @@b0|# @A`8`88!| (} 0!8A@aHPX`hp!xAaH KeKK]K|` @xKe, Ap`AȈ , @K| @b , @b808xHAA(8t8x&| x$|0*H A(bK!0| @AbX| @@b0|# @A`a8KKMKPKEK$|` @K,cK-AK\e, Ap`AȈ , @K| @b , @b808xH A(8t8x&| x$|0*HA(bK0| @AbX| @@b0|# @A`8`8KXKKPKK$|` @K,b808xHEA(8tx&|:H%A(bK90| @AbX| @@b0|# @@cb-AdKTb808xHȵA(cx&|:HȕA(bKA0bX| @@Kb808xHUA(8tx&|:@H5A(bKI0| @AbX| @@b0|# @@cK|b808xHA(8tx&8|3HǡA(bKA"0XH |@LB0BAb0|# @@c,%@b,@;@``?@`!c@;ZC|$p@8@bT,@<`8W||p|*x$x|:|P,@8WH A`bH A(8W|`HyA(:1x~ yA |0x@A\bx&| H1A(bKEB)-@KLH `Khbx&| *HA(bK88q,%ALb8WHŵA(bx&| *HřA(bK;@b؛K8)HQ``eb8WHYA(bx&| *H=A(Kb8WH%A(bx&| HA(bKKA,%@b8W`HA(b808xHġA(8tx&8|3HuA(bKA"0XH |@LB0BAb0|# @@cb)-@KTb8WHA(KDbbx&| *H ``tccK;`K`pH A(,AbH AA(`q8-aabH A(,#@ta|A|`|qP9|||`yA4 | A(```!cx|`yA | @,#@b,;Aab8WHA(c8c8xHA(8tacFx&| *HµA(cK;@c:|0x@A(w|`yA, =@`ww|wyA`pH aA(,AHKbx&| *H )``tcK9;`K 8cH A(a~1K|bbx&| *H ``tbK!9,1A, @b}$@, @Tb88xHA(a8 x&|: H]A(bKqAbX| @@, Atb, A}8(@, Ab8c8xHA(acE8Wx&|6HA(bKћ@cbn, @d@nK}`}%@d,, @|@, Ab88xH1A(acE08Wx&|6HA(bKAbX| @@88`@K|`)-@4Kb88xHA(acE08Wx&|6HaA(bKuAtbX| @@hK`b88xH%A(acE08Wx&|6HA(bK AK~8(@@T, Ab8c8xHA(acE8Wx&|6HA(bK@cb8y8xHQA(acEx&| H1A(bKEAXa|#@@ b`e, Ap`AЈ , @Ku| @b , @b808xHA(a8x&| x$|0*HeA(bKy0| @Ab0X|#@@ b`b0|# @A`8`8KKKHKK|` @K$b8c8xHA(acE8Wx&|6HA(bK@ Kb8c8xHqA(acE8Wx&|6HIA(bK]@Ke, Ap`AȈ , @K| @b , @b808xHA(a8x&| x$|0*HA(bK0| @AbX| @@b0|# @A`8`8K KKPKK$|` @K,b8c8xHA(acE8Wx&|6HA(bK雳@ Kb88xHA(a8`x&|: HyA(bK|.@AX|.@@K$b88xH1A(a8 x&|: H A(bK!AbX| @@Kb88xHA(a80x&|: HA(bKa T`>} | LB0BAKbx&| *H a``tbKq;`K|aq:#xK@ Kx,K, A`a`, @ hA)-@Kdۄ)-@KH`8H `KK`xK,#@4P, A`d,#AKePKlKQ99`88` a(K9#b8cFax$pc|*|8*K:P"H@Bh9}<@K@9"b8 8`KwcH A(,A0|#yAd, =@`|#yMAaH 9A(,@/AaH !A(,A| @a| A@(~yA(ax |@a, @(`!1x~ yAax |@K:8a 8VxH ]`-@(b, @( c/#@(, @f, LBqA'8a 8SH `,@ b(/ @, LBqA `x, Aa,#}&} LNBAa8|t:xт@, AT:@H`B(AcB, @  0, +A, -A, &ABd/,@ 0a|#A| 0OBBA, OB1LNBAA|, A, Ad, A\,;bA$a(8T>|h | LFA  0, *A, @A , &@xc8c8xHuA(8tcF~x&|:HIA(cK]@c;Kc8c8xHA(8tcF~x&|:HA(cK雳@c;KTbx&| *H ``tcK;`KA , @a,#A@@la,#/ $LZLNAP, A, A8, A0,;bAc8c8xHA(8t9cF}bx&|:HA(cK՛@cb, @ ;K0c8c8xHiA(acEbx&|9HEA(cKY@c;Kbx&| *H ``tcK;`K 0@$,0#A!,0$A!,0+A!,0-A!,0=A!@-0*A ,0@A ,0&A @`@ap,T>| LFA8a 8SH M`,@ ,0+A,0$@t8aH A(q 8aH A(1a8 1`H `,@Laq, @ xaAߌ8a 8VH `,@  0xb- LNSBA$`o8a H j`q88- 8a8/H A(, @|X)|Bx|Bx,|#xh.|3x,A\|#x|3yAԈ, $A, +A*,#,A AA, A, A, @ބX|Bx|Bxh.|+x|;xU>| ,@t,AX,$Al,+Ad,;bA b9|, @ b088xHEA(aacGx&|@HA(bK10bX} |@LB0BA0r| @@crb), Ax)b8/-8aH A(|ct8x,$*@8, A,5, @ b, A,, @ X|2x|2x|cxh.|`x,A, $At, +Alb, @\, @P,@8aH A(@1`$8a8/H A(,#A| AA8a 8 \8H`aP, A`d``e```!H 1`,AX~yA pK8aؐH A(8c8x$| *KypaxapncH `8a8 H `:A$8dTf>8T>b- @, @(, @8a 8VH 9`,@|d,#@l, @`f, AT, LNBA@x, Aڰ X |:x|:x|x|3yAڌ, @(a8|t:xт@, ALad:B(AcB 0, +A$, -A, &AB@ 0a|#A| A, A, A, Ax,;bA@a(8T>|h | LFAh 0, *A\, @AT, &ALKbx&| *H ``tcKz;`K,$,$LFA, A, A, A,;bAhc8c8xHAA(8tcF~x&|:HA(cKz)@HK@bx&| *H ``tcKy;`Kt 0,0#A ,0$A ,0+A ,0-A ,0=A aH8 1H u`,@ P,0*A <,0@A 4H 0, @@ a8` 0, &aA ؈, $A  0x8a H c`q888a8/H }A(X|zx,$|zxh.|#x|3x@ )|#x|3x,,A l,@*,/ L1A T,$A HAt, $Ah, @\, @P,@8aH )A(@1`$8a8/H A(,#A| @h8a8 H `88pTg>8T>- @8a 8VH `,@b, LNAx, A@,$@4 , +@, A, A80K8蘁8e8Th>T >!08a 8VH `,@b, LNAa`H uA(|pyA8b, Ab, @\8a 8$H `,@@8a 08H i`,@(b0@b8@H A(|pyApH aA(,A8pH A(08p8@%H A(|pyApH !A(,AԬpH A(,AԘ8pH A(0KԀ8a 8$H `,@8a 08H `,@bh,$A8a H i`,@b08 \bH I`,Ab, LNBA8a \8R4H `,A8a \8RH `,Ab8R4H `,Ab8RH `,A8a \8RpH `,A`8a \8R|H `,AD8a \8RH q`,A(,;bAc8c8xH]A(0:8tx9 \x&|8Wl8H!A(cKt5@(c8Ǜc8xHA(0bx&|808HA(cKs՛;8a(H 9A(,A,A, Ab,;Alc8c8xH]A(x8tx&|9`H9A(cKsM@c;KTbx&| *H ``tcKs ;`Kpc8c8xHA(b080x&|8HA(cKrKbx&| *H y``tcKr;`Kb84H 1`,AK,;bAb88xHA(098tx9 \8Wlx&|8HA(bKq}<@AX|<@@KDbx&| *H ``tbKqKT8!8a H iA(8c8!x$| *K h8 eH =`K9 b8 8HK8K0 X|*x|*x|`yAb, Ax, Ap80Kh8a 8 \8H`aP, A`d``e````!H Q`,At~yA pKa:H 1A(8c8x$| *KmpaxapecH `Kxx, AK8H A(8c8x$| *KlapncH ߕ`pxKh8aH AA(@1`!*$K9,@,@,@Ԉ,Ab, A, A,;bAxc8c8xHA(8tcF}x&|:`HA(cKn՛@c;K@bx&| *H ށ``tcKn;`KdABqJF 1a N R0!  a`A @ȁ &ȁ0&!:z *K 8 bK8bK8aH A(0b1`1h1, @lK8a8H `K qKj8a \H ʝA(: 8~8x$| *Kg-qb, |&K89 8}x$| *Kl]qx!``qb, AXKH89 8}x$| *Kl `q8``888a (Kx````!bH A(`o`b8-aH ̵A(,#@|x@w|`yA, =@`ww|wyMA<aH A(,@A|KK`@ϔKD8cH 1A(`KLhwH A(a8-awH A(,#Ax8cH A(aKdKjEPK$Ko199`88` a(K, @P?~ yADa, A````!1x~ yAa, AKb, |&Kc8c8xHyA(acEbx&|9HUA(cKUiKbx&| *H -``tcKU=;`KAKa,/A`, A`n8aaH `,@~ A4A,8T>e,#|&KdaX|A,/A@@a`ahA8K ۃ8Ka8H =``- @K, AT@ ahA0|g0P,|@T>aKۃK`8H ù``- @K`, A` |AaX|A, @8`H Y``, @KKg=PK4Kl)98`8`8a (K|AK8abH ƽ`,AKp8.8a8 088D HA(8a8H y`,A8| @dKP8K8a H YA((#A8a \H EA((#@8bK8a 8VH `,@K8a 8VH `,AD8a 8VH `,A(8a 8VH ũ`,A 8a 8VdH ō`,A8a 8SH q`,A8a 8VH U`,A8a 8VH 9`,A8a 8VH `,A8a 8WH `,Ad8a 8VpH `,AH8a 8WH `,A,8a 8W H ĭ`,A8a 8W,H đ`,A8a 8$H u`,A8bK,;bAxb8z8xHQA(8t9cF8x&|@H!A(bKP5}<@A0X|<@@(K bx&| *H ``tbKOKhb808xHA(8tcE8Rx&|WhHA(bKOb0X| | @LB0BAb0|#(@@cKb808xH%A(8tcE8Qx&|WhH~A(bKOb0X| | @LB0BAb0|#(@@cK,b808xH~A(8tcE8Vx&|WhH~mA(bKNb0X| | @LB0BAb0|#(@@cKbbx&| *H ``tccKN;`KTbAb|@b,;Apb8c8xH}A(98tcEx&|H}A(bKM|8@@cK4bx&| *H I``tbKMYKp9bK HWPzH A(,@P,/A@cDo``!H `,cDA}{yA oKPWhcCH -A(8-acCH A(,#@KX8cH A(a@l,0AdKD8$K(;|`|xxT8+@8#K(KcC8QH `,A8cC8QH `,AcC8QH `,AcC8QH }`,AcC8QH a`,AcC8R4H E`,@8*8`@aK8&8` aKb0P, A8``````!8c|+y@PaXKb889;FK¼bThTzTpAKdKG-KHKG%K| @K$"C d BraSlogRead|}&aAT>;!;@;!ab8,$8|xc$|*A pAb , @ KF=b| @b , @ ; 8x80cHy]A(@8}Hx&x$|"|@*Hy!A(cKI5Pb0|#@AX|#@@b`8bhp0|$@@888a "|(P8H A(,#A 88ap8TP8l8HxaA( dp8"8a||"|P8H UA(,#A P8a8TP8l8HwA(a8H IA(,#@b|@`bd, A@8b8x8ycHuA(8}x&| HuA(8bKEAX|>@@b`8;bd, A4p`Ab , @KAb| @b , @8b8x80Hu!A(8}8x&| x$|@*HtA(8bKE0| @Ab0X|#@@ b`b0|#@A`8`*} 808! |!AaN K@KK@K|` @K8<`}``cdcH A(,#A````!;bH A(,:(A`@Ԉ, #, A08S8l`@, #, LFA8@899!H ŵA(,8alA8VXH M`8Vd,8alA,H 5`8Vp,8alAH `,@8a8D88HsA(,>8a@48H `88C8,a@tHe``~8a8pH `8V|,cA,H )A(|zybcDA8H āA(,AcdbcH A(,#@4p At"8B9 b9p c`x $|H*K]=;Pb BH@"h~>@K cH A(,@,:A0cCH A(,At8 "9Bcb9 pcx $|H*K\;Pb BH@"h~>@KlaH }A(,At8 "B9b9 p c x $|H*K\;Pb BH@"h~>@KcH A(,A8 "9Bcb9 pc(x $|H*K[;Pb BH@"h~>@K`8"9Bb9p cx $|H*K[!;Pb BH@"h~>@K89 "Bc9bpchx $|H*KZ;Pb BH@"h~>@K89"Bc9bpcx $|H*KZA;Pb BH@"h~>@KcDbH A(,@X89 "Bc9bpchx $|H*KY;Pb BH@"h~>@K;b 8x8zpccHnUA(BH@8}8x&|@Hn%A(cK>9P~>@AX|>@@b`8"h8cؘx&| HmA(cK=K8"9Bb9p cx $|H*KX;Pb BH@"h~>@K\8"9Bb9p cx $|H*KX;Pb BH@"h~>@KK9yK\K9qK0| @K8 C  BraSlogCleanup|}&aA``!T>;`T>U>a5;@aA; ;!xp!Bba8c 8, |x$||!*A,pA , @K89| @b , @8,  @Ahp,@88a $"|0P8!H AA(,#A88a8TP8l8HjA(H8bx&| *H `a8bK: 88b08xHjA(8bx&8c|W`HjaA(8bK:ub0BP|3@AX|3@@ b`#|3 @|&| @8a8H mA(,#@<8"9`B9ax$i|8*KT~?@ 8y8b8xHiA(H8b8cx&| Hi]A(8bK9qAXa|#@@ b`#6e, AXp`AЈ , @aA!xp"!8,& 8|xc$|*ApA , @KB| @b , @t8, B "@Ahp ,@x8a8 "|0P8ĐH )A(,#A8a8TP8l8HLA(H8bx&| *H `a 8bK88b08xHLqA(8b x&8c|W`HLMA(8bKa0P~ @Ab0X|#@@ b`b0 } @@8a 8H ]A(,#@L8"B9b9a  x $|H*K6 ~?@8y 8b8xHKqA(H8b 8cx&| HKIA(8bK]AXa |#@@ b`e, Adp`A؈ , @HK| @b , @88b08xHJA(88b8cx&| x$|@*HJyA(8bK0P| @Ab0X|#@@ b`b0 |# @A`8`8 ` Z8! P|px} !Aa!AaN KQKKIK|` @xK8<`w``bbH A(,#AD,5A XbHP:@` : 9: :ch} @```!;b؈, A, #AH A((#A Lb8 h8 <8 8U099!9A8`p9a4ax9:H A(, A P8a hH A((#@ < h, v@ 0a iH A(,A a jH A(,A a kH A(,Aa lH A(,Aa mH A(,Äa nH A(,Aa oH mA(,A8a H A(,AT8a H A((# @@a H A(,A,a H A(,Aa H yA(,Aa H eA(,A , -@a H EA(,AЈa H 1A(,A , -@a H A(,Aa H A(,A8aH A((#@taH A(,A`aH A(,AL,0.A ,0:@8aH A(,A$aH A(,A, .A , :@aH ]A(,AaH IA(,A8aH A((# @aH !A(,AaH A(,AaH A(,AaH A(,Ap, -@daH A(,APaH A(,A<, -@0aH A(,AaH }A(,A8aH MA((#@aH UA(,AaH AA(,Ä, .A , :@aH A(,AaH A(,A, .A , :@|aH A(,AhaH A(,AT8a`H A((#@@a`H A(,A,8a4H qA((#A8aH ]A((#A8aH IA((#A,0:@8.8a8 88DHDA(8a8H `,A8a`H A(`pb, x$|d*@X88K8 hH ``~8 <8c H `8~ 8 88DHCuA(8~!888DHCYA(@8~584H E`bbbH A(,#@4p A`"8B9 b9a  `x $|H*K- P~?@K4bH uA(,@, A4,;Ae, Ap`AĈ , @K| @b , @88b08xHB)A(8H8b8cx&| x$|@*HAA(8bKAXb0|#@@ b`A`8`8KK9KTK1K(|` @K0e, Ap`AĈ , @K | @b , @88b08xHAA(8H8b8cx&| x$|@*H@A(8bKAXb0|#@@ b`A`8`8KxK %KTK K(|` @K0Ha x&| *H U`8bKi88bP8xH@-A(8b8 x&8c|8UPW H?A(8bKP b`|>@@8KL8"9Bba  x $|H*K* P~?@K8EKa~HK8{8bP8x(H?5A(8o x &|H*x $|H*H>A(8bK@c8bx&| *H>A(8bK;`Kt8z 8b8xH>A(8H8b 8cx&|@H>eA(8bKy P~>@AX|>@@8bx&| H>A(8bK-KbHP: :` 9.:c :Ch} @``!;b؈, A, #AH A((#Ab8 h8 <8 8U099!9A8`p9a4ax99H A(, A8a hH EA((#@ h, v@a iH A(,Apa jH A(,A\a kH mA(,AHa lH YA(,A4a mH EA(,A a nH 1A(,A a oH A(,A8a H A(,A8a H ~IA((# @a H QA(,Aa H =A(,Ala H )A(,AXa H A(,AD , -@8a H A(,A$a H A(,A , -@a H A(,Aa H A(,A8aH }}A((#@ȈaH A(,AaH qA(,A,/.A ,/:@aH IA(,AxaH 5A(,Ad, .A , :@PaH A(,A!xp8~!q8c~|cxc$ ؈,$|*ApA , @KQ| @b , @t8,  @Ahp ,@8a8 "|0P8ԐH iA(,#A8a8TP8l8H3A(H8bx&| *H s`a 8bK88b08xH3A(8b x&8c|W`H3A(8bK0P~ @Ab0X|#@@ b`Cb0 } @@8a 8H zA(,#@88"9`B9a x$i|8*K ~?@8y 8b8xH2A(H8b 8cx&| H2A(8bKAXa |#@@ b`CVe, AXp`AЈ , @;;aA;`;@b|!}&T>`aA!xp!A"88|xc$,&|*A\pAD , @@K"| @$b , @ 8, " @ADhp,@8a8 "|0P8H lA(,#Al8a8TP 8l8H5A(H8bx&| *H [`a 8bK)88b08xHA(8bx&8c|W`HA(8bK0P~ @Ab0X|#@@ b`cb0} @@8a8H aA(,#@L8"B9b9a x $|H*K1~?@8y8b8xHA(H8b8cx&| HA(8bKAXa|#@@ b`cwe, Adp`A؈ , @HK | @b , @88b08xH-A(88b8cx&| x$|@*HA(8bK 0P| @Ab0X|#@@ b`cb0|# @A`w8`88!|px} !Aa!AaN KKKK|` @xK8<`v``bbH _A(,#A,4A $bHP:b`:C :#h} @````!;b؈, A0, #A(H Y}A((#A 8 bp9a ax9 |9 P8$9aa98888T|9X9!,9A98t9aHa9H i)A(`n, A 8aH XA((#@ Ĉ, s@ aH h)A(,A aH hA(,A aH hA(,A |aH gA(,A haH gA(,A TaH gA(,A @aH gA(,A ,8aH X-A((#@ aH gA(,A aH guA(,A aH gaA(,A 8aH WA((# @ ȈaH ZA(,A aH ZA(,A aH ZA(,A aH ZA(,A x, -@ laH ZA(,A XaH ZuA(,A D, -@ 8aH ZUA(,A $aH ZAA(,A 8aXH WA((#@aXH ZA(,AaYH ZA(,AԉZ,/.A ,/:@a[H YA(,Aa\H YA(,A], .A , :@a^H YA(,Apa_H YA(,A\8a,H V]A((# @Ha,H YeA(,A4a-H YQA(,A a.H Y=A(,A a/H Y)A(,A0, -@a1H Y A(,A؈a2H XA(,AĈ3, -@a4H XA(,Aa5H XA(,A8aH UA((#@|aH XA(,AhaH XA(,AT, .A , :@@aH X]A(,A,aH XIA(,A, .A , :@aH X!A(,AaH X A(,A8a H TA((#@Ȉa H WA(,A8a H TA((#A8a |H TA((#A8a PH TA((# Ax,/:@8.Z]8a88X8DHUA(8a8H V%`,A8a H TA(`o,>@b, x$|d*@`88Kk-8H Q``}88c H Q`8} 88X8DHA(8}!8,88DHA(@8}58 PH Q`, @,@<,@bbbH XA(,#@4p A`"8B9 b9a `x $|H*KP~?@KbH XA(,@, A4,:Ae, Ap`AĈ , @K)| @b , @88b08xHMA(8H8b8cx&| x$|@*HA(8bK%AXb0|#@@ b`cA`w8`8K4K]KTKUK(|` @K0e, Ap`AĈ , @K| @b , @88b08xH9A(8H8b8cx&| x$|@*HA(8bKAXb0|#@@ b`cA`w8`8K KIKTKAK(|` @K0Ha x&| *H Ny`8bKލ88bP8xHQA(8b8x&8c|8TW H!A(8bK5Pb`|>@c@8KL8"9Bba jx $|H*KP~?@K8aH8TH Qe`,@}`,@(8aH8TH Q=`,@}aK8aH OA(}dK8aH OA(}H8aH OA(}L8aH QA(=P8atH NA(8c8x$| *K}X8tH L`KP8a$H OIA(}DK488Ke}hK8a8TH PY`,@ r, @0s, A88at8TH P%`,AK8at8TH P`,AK8{;@8bP8xHH A(8bx &8c|H*x $|H*H A(8bKt@cd8bx&| *H uA(8bKۉ;@K8z8b8xH EA(8H8b8cx&|@H A(8bK)P~>@AX|>@@t8bwx&| H A(8bKKbHP:.b`8 :Ch"(}$(@``!;b؈, A8, #A0H L]A((#A8 bp9a ax9 |9 P8$9aa98888T|9X9!,9A98t9aHa9H \ A(`n, A,8aH KA((#@, s@ aH [ A(,AaH ZA(,AaH ZA(,AЈaH ZA(,AaH ZA(,AaH ZA(,AaH ZA(,A8aH K A((#@laH ZiA(,AXaH ZUA(,ADaH ZAA(,A08aH JA((# @aH MA(,AaH MA(,AaH MA(,AaH MA(,Ä, -@aH MiA(,AaH MUA(,A, -@aH M5A(,AxaH M!A(,Ad8aXH IA((#@PaXH LA(,A@b, x$|d*@;8K^8H D``}88c H D`8} 88X8DHA(8}!8,88DHmA(@8}58 PH DY`, @,@,@$bbbH KA(,#AK8aH8TH G`,@}`,@(8aH8TH G`,@}aK8aH FaA(}dK8aH FMA(}H8aH F=A(}L8aH HYA(=P98atH EqA(8c8x$| *K}X8tH CI`K8a$H EA(}DK88K\]}hKX8a8TH F`,@r, @0s, A8at8TH F`,AK8at8TH F`,AlK8{;@8bP8xQH}A(8b8cx&|@*x $|H*HAA(8bKUt@cd(8bؘx&| *HA(8bK;@K8"9Bbad) y)$|H*KP~?@KbThTzАTpKL88b08xH]A(H8bx&|8cx$|@*H!A(8bK50bP| @Ab0X|#@@ b`chbpa0| @@8KKaK,;KKQK| @K"C$ BrsRunGet|}&ۡہ`T>;aA;`;@!axAp!h`XP!A"ab8 8c,#|xc$|*A pAb , @ Kb| @b , @ ; 8x80cH1A(@8xHx$|0*x&|"HA(cKPb0|#@AX|#@@ b`cbhp0|$@@8 8a8SdHA(8a8Sl!Aa     paxH-A(b8XcH EA(,#@\b|@bd, App`Ab , @PK]b| @b , @$; 8x80cH}A(@88Hx$|0*x&|"@HIA(cK]Pb0|#@AX|#@@ b`cbhp0|$@A`c8`8|ˡ8!} PX`!hApax!AaN KKKK|` @pK8~c"B9Pxg$cd|8* KE; 8x8yccHA(H@8cx&|" HA(cKb`p|<@c@bhcK8<`w``bbH C!A(,#ApP:bH:`.Bh"~$@H: 9h``!;b؈, #, A<@, #A,H =A((#b8SA8889X9!,H MA(`n8a8S, #@tH >`-@(,aAXH ?A(,aADH ?A(,A48a8TH >e`-@,A, :@ aaA8a8TH >-`8T,8aAH >`,A8a8SH =`,A`8a8@H =`,@PbbbH A}A(,#@4p A~9`8 BcP"xg$9cd`|8*K; 8x8yccHeA(H@8cx&|" H=A(cKQb`p|<@c@0bhcK$bH @A(,@,?A@ۿ,:@, @0;4bd, Ap`Ab , @K9b| @b , @; 8x80cHYA(@8|cHx$|0*x&|"@H%A(cK9Pb0|#@AX|#@@ b`cbhp0|$@A`cc8KK]KDKUK|` @K 884H 9A(8c8x$| *K584H 7m``K8~cB9P"xg$c|8*eK=; 8x8yccHA(H@8cx&|" HA(cKb`p|<@c@bhcK8a8H :}`8,aAH %`,@8a8T48H 89A(,@l8t48H 6Q`;@8a8T(H :`,@@88aH :`8,8aA H 9`8,aAH `,@8a8T@8H 7A(,@8aH :A(K8a8D88HA(K8a8D88HA(KX8a8D88HiA(K 8x8{ 8bPHAA(@c8bx$8c|8*x&| *H A(8bK@`8bf@c`x&| *HA(8bKK8a8T(H 8`,@4K(8a8TH 8q`,A8T8aH 8Y`,A8S8aH 8A`,@K 8b8x8zPH5A(@Hc8b88cx&|"@HA(8bKPpb`|?@c@8@H8bؘx&| HA(8bKKK9KHK1K| @K$"C0 BrLinkSizeGetT>9 |}&aA!;;;`aA`!xp!ahxbp8܈!,&8|xc$|*ApA܈ , @K| @ , @ 8;B08xcCH)A(@8zHhx&x$|"|@*HA(cCKPb0|#@AX|#@@ b`bhp0|$@@8b8cXaH 8A(,#@\b|@~, Alp`A , @PKـ| @Ĉ , @, 8;08xcHA(@8H8x&x$|"|@*@HA(cKPb0|#@AX|#@@ b`bhp0|$@A`8`8@:8!0|px} !Aa!AaN KKKK|` @xK8"9BbbPcc) y)$|H*Kڹ 8ycf;8xcHuA(H@8}x&|" HMA(cKab`p|;@@bhK8<`z``c$cEH 6A(,#A,3ApHhbP`@:X :8h }@9````!;b؈, A , #@, #A H 0qA((#A84b8899!8SH @yA(`p4, #@8a48SH 2`.@4,AaH 3A(,ApaH 3 A(,A\8a48SH 1`-@,A8, :@8.A@8appH 1y`,Abd8apH 1a`,@xc$bcEH 4A(,#@4p A"8B9 b9bP cc`x $|H*K 8ycf;8xcHA(H@8}x&|" HA(cKb`p|;@@4bhK(cCH 4=A(,@,;@ , @L;8, @x, A `~, A p`A܈ , @K| @ , @ 8;08xcHA(@8cHx&x$|"|@*@HA(cKPb0|#@AX|#@@ b`bhp0|$@A`c8KKK4KK|` @K88}8H ,A(8c8x$| *Kə88H *``}Kt8"9BbbP ccx $|H*Kՙ 8ycf;8xcHUA(H@8}x&|" H-A(cKAb`p|;@@bhK8a88SH +A(,@pah8H u`,@X8b8c8H )`;`8a48SH -`,A,;A8K8appH -]`,Abd8apH -E`,A8ahH `,@88a8H *A(.A(8a88H *A(,@@(b88c8H (`8;`Kb88c8H (`8;`K`8ap888DHA(@K88{8bP8xHiA("8ox& | *x $|H*H1A(8bKE8b@cx&ؘ| *HA(8bK Kx8a48SH +`,@ K8z8bP8xHA(8b88cx&|@HA(8bKPbp|=@@88bx&| H9A(8bKMKpH:`:@.hbP`@:8 :h }@````!;b؈, Ax, #@, #AdH (A((#A84b8899!8SH 8A(`n4, #@8a48SH *E`.@4,A؈aH +]A(,AĈaH +IA(,A8a48SH )`-@8,A, :@ AޚAAP@l8appH )`,Ax88a8SH 'A(,@Xah8H E`,@@8b8c8H %`;`8a48SH )Q`,A,,;Ac$bcEH ,A(,#AK\8appH )`,A8ahH `,@88a8H &A(.A,8a88H &A(,@t@K8a88H &A(.@K8ap888DHA(@K8{8bPo8xH]A(8b8cx&|@*x $|H*H!A(8bK58b@cx&ؘ| *HA(8bKK8a48SH '`,@KKUKhKMKD| @KH C BrOldNameGet|}&aA`;!;;@; :aA!xp!baxb88c,#|xc$|*A pAb , @K1b| @b , @: 8x80bHQA(@8vxHx$|0*x&|"HA(bK1Pb0|#@AX|#@@ b`Cbhp0|$@@88ap808eHA(8ax808tHA(ax8H )A(,#@49bCpxc|*x$|8*Ke;P" h~?@8b8x8ycHA(@H8}xx&|" HA(8bKAX|?@@ b`CbWd, ATp`Ab , @4K5b| @b , @8b8x80H]A(@8}8Hx$|0*x&|" H)A(8bK=0| @Ab0X|#@@ b`Cb0|#@A`W8`8 8!|px} !Aa!AaN K KKK|` @|K`v<`b`bH &A(,#A88A:HA(8a` 8"px| P8lh`H A(,#AH ``e8a8SPHiA("0b $@bn, Aa 8H A(,#@b|@, dAlp`A , @PKy| @ , @( 8;08xcHșA(@88Hx&x$|"|@* H]A(cKqPb0|#@AX|#@@ b`cbhp0|$@A`c8`8`Z8!P|px} !Aa!AaN K5KK-K|` @xK8"9Bb9p c x $|H*KU, dA p`A܈ , @K| @ , @ 8;08xcHA(@88Hx&x$|"|@* HƍA(cKPb0|#@AX|#@@ b`cbh0| @A`c8`8K4KK8KK|` @K`yX,$@T |#yA08aH `b<c%`cH aA(,#A,7@ 0X0:bP@H~ @:}@b B`"h````!b8SH E`,@(bcc%H A(,#@,/:@H@K,@ :b0., @88bbf8xHA(@b88 8Sx&|uHıA(8bKP~3@AX|3@@ b`chp}3@@8-, @p8b808xH9A(@(b88x&|uHA(8bK%AX|3@@ b`c@8|4p AT"8B9 b9 bp `x $|H*KKDc#H -A(,@,:A(KT8"9Bb bp jx $|H*K-Kx&b|b8uHA(K8b808xHA(@Xb88x&|tH¥A(8bKAX|3@@ b`c@8Kx&b|b8tHQA(Kx&b|b8S8 uH%A(Kt8b8bf8xHA(@Pb88 8Sx&|t`HA(8bKP~3@A4X|3@@0K$x&b|b8S8 thHA(Kb0:P ph~3@}3@Kbx&| *H I``u8bKYKb8\80898S9!H AA(,A8a]8SH `,A48a]8SH `,At8a]8$H `,@\,@T8a8QH y`,@88a8H a`,@ 8a8H I`,@888pH%``d8a H 5`8a88H!`8 88H``d8a H `8a pH `,#A,A||cx|`v|8Tz>Kh8a88H`8cH z`a8aH A(x"x"|8a 8x"|8| !8lH9A(, Ä, @b,/@b808xHA(8t8 8 8Sx&|t@HA(bKLNBAr0bp| @@cd;K8bx&| *H y``tbK9KT8a H A(,@, @b,/@db808xHA(8t8 8 8Sx&|uHA(bKLNBA,K$bx&| *H ``tbK9Kx"8 bBb 9bpx$|8*K;@K8a08H 1`,@88a0H `,A 9K\8apH9`,#A,A||cx|`v|8Tz>K"&*.#28C68a HA(0p|@, A, @, A,/b@b808xH]A(8t88 x&|u`H9A(bKMLNBAr0bp| @@cd;8a88)8H``d`p-A @8abH `9K8aH xQ`,A,/b@a808xH}A(8ta8x&|tHYA(aKmLNBAr0bp| @@cd9|;K<bx&| *H ``taK KPbx&| *H ``tbK9KD8aPH yM`,@x, @b,/@tb808xHmA(8t88 x&|vHIA(bK]0bP| @LRBArbp| @@cd;8a88)8H``d`p-A@8abH `K8aH v]`,A,/b@ha808xHA(8ta8x&|uHeA(aKy0bP| @LRBAKbx&| *H -``taK=Kxbx&| *H ``tbK9Kh8a 8H `,A088a H `,@K8a0H IA(`n8a 888DHA(KX0:bP@H~ @:}@b B`"h`!b8SH %`,@$bcc%H A(,#AKb8\80898S9!H %A(,A8a]8SH `,A8a]8SH `,At8a]8$H `,@`,@X8a8QH ]`,@<8a8H E`,@$8a8H -`,@ 888pH ``d8a H `8a88H`8 88H``d8a H `8a pH`,#A,A||cx|`v|8Tz>Kl8a88H`8cH p`a8aH A(x"x"|8a 8x"|8| !8lHA(, Ä, @b,/@b808xHA(8t8 8 8Sx&|t@HA(bKLNBAr0bp| @@cd;K<bx&| *H ]``tbKm9KT8a H eA(,@, @b,/@db808xHA(8t8 8 8Sx&|uHA(bKLNBA,K$bx&| *H ``tbK9Kx"8 9bBb bpx$|8*Ki;@K 8a08H `,@|88a0H `,@dp8aH%`,#A,A||cx|`v|8Tz>K("&*.#28C68a HA(, A, @, A,/b@b808xH]A(8t88 x&|u`H9A(bKMLNBAr0bp| @@cd;8a88)8H``d`p-A@(8abH `K8aH oU`,A,/b@a808xHA(8ta8x&|tH]A(aKqLNBAr0bp| @@cd9|;K@bx&| *H ``taK KPbx&| *H ``tbK9KH8aPH pQ`,@, @b,/@tb808xHqA(8t88 x&|vHMA(bKa0bP| @LRBArbp| @@cd;8a88)8H``d`p-A@48abH `K 8aH ma`,A,/b@ha808xHA(8ta8x&|uHiA(aK}0bP| @LRBAKbx&| *H 1``taKAKxbx&| *H ``tbK9Kh8a0H A(8a 888DHA(K8aH `K8aH `K8a! 8Sd HA(8aꈡ8Sl!Aa뉁!pax!HA(8a8H `||xThK9`b"99pBfc8STx $|H*KKh9`b"9pBifc8x $|H*KiKKzKKzK| @K"C BrArchCleanup|}&aA!aA!xph`8!a@~84p8|,$x$|*A8bpAb , @t8, @dBpAXb , @L8, @`|,$mA ,$M@$ah|AxUdxP(|,$gA ,$G@,,Ax`KH,HHHHlHHHHxHHHdHH,HHHHHH|H HH HHhH HHTHHH~x; 8x8pccHA(H@8~x&|"HA(cKnP| @AXbp| @@b`8bh8pK8b8x8pHA(8b8cx&|HUA(8bKniPbp~ @AX| @@8b8x8pH A(8b8cx&|HA(8bKmAXbp| @@pKbC8 H `,A`|,$mA ,$M@$ah|AxUdxP(|,$gA ,$G@L,Ax`K88b8x8pHA(:>8b8cx&| *HA(8bKkPbp~ @AX| @@8b8x8pHIA(98b8cx&| *H!A(8bKk5AXbp| @@pKbC8 H `,AXbC8 H ޭ`,@QA8:2q,#A4``!H ߥA(,A:Ĉq:1,#@, A,2~|, A|q`o8 H !`,A|a8 H `,Ada8 H `,ALa8 H `,A4a8 H `,Aa8 H ݩ`,@b#H MA(,aAl`|A`, @xrH A(nT`>`|,$mA ,$M@$ah|AxUdxP(|,$gA ,$G@,Ax`Kx8b8x8pHA(:>8b8cx&| *HA(8bKhPbp~ @AX| @@8b8x8pHA(98b8cx&| *HaA(8bKhuAXbp| @@pKbC8 (H `,A\bC8 |d,#mA ,#M@ ah|A\xUdr|c,#gA ,#G@a@,A,xK8b8x8pHAA(:>8b8cx&| *HA(8bKf%Pbp~ @AX| @@8b8x8pHA(98b8cx&| *HA(8bKeAXbp| @@pKbC8 HH E`,A\8 XbH %`,A08 hbH `,A8 xbH `,A8 bH `,A8 bH `,A8 bH ح`,A8 bH ؕ`,A8 bH }`,A8 bH e`,A8 bH M`,Ax8 bH 5`,Ad8 bH `,AP8 bH `,A<8 bH `,A(8 bH `,A8 0bH ׽`,A8 ,A<`8B?| A, @acH ǵA(@dKDHaH_(H\HYHWhHULHSHSHQHP`HNTHLhHJHHHFHDTHBDH?$H,AT<`8B?| AD,AD, @8acH A(@dKטHx HuHsHr,Ho\Hm8b8x8pH1A(8b8cx&|HA(8bKOpbP| @AbX| @@ 888b8x8pH~A(8b8cx&|H~A(8bKNpbP| @AbX| @@ 88pK; 8x8pccH~%A(H@8~8x&|"H}A(cKNP|=@A K8b8x8pH}A(8b8cx&|H}A(8bKMpbP| @AbX| @@ 88pK8bH !`,@:d`t, A@```!H A(,, A:@t:,#@uH aA(aT`>,Ad<`8B?| AT,'A,, @ acH A(@dKԨ8b8x8pH|YA(8b8cx&|H|)A(8bKL=pbP| @AbX| @@ 888b8x8pH{A(8b8cx&|H{A(8bKKpbP| @AbX| @@ 88pK; 8x8pccH{MA(H@8~8'x&|"H{A(cKK-P|=@AHK8b8x8pHzA(8b8cx&|HzA(8bKJpbP| @AbX| @@ 88pK8bH I`,A8bH 1`,At8bH `,A`8bH `,AH8bH `,A48bH `,A8bH `,A8bH `,A8bH `,A8(bH q`,A88bH Y`,A8HbH A`,A8\bH )`,A|8tbH `,Ad8bH `,AP8bH `,A88bH `,A$8bH `,A 8bH `,A8bH `,A8bH i`,A8bH Q`,A8bH 9`,A8bH !`,A8bH `,Ap8 bH `,AX80bH `,A@8,A<`8B?| A, @xacH A(zK8HxHHHHHHHHHHHHHHHHlH$HPH|HHH8b8x8pH]A(8b8cx&|H]]A(8bK-qpbP| @AbX| @@ 888b8x8pH] A(8b8cx&|H\A(8bK,pbP| @AbX| @@ 88pK8b8x8pH\A(8b8cx&|H\]A(8bK,qpbP| @AbX| @@ 88pK8)bH `,A8)bH `,Ax8)bH `,Ad8)bH `,AL8)bH `,A88)bH y`,A 8* bH a`,A 8*bH I`,A8*$bH 1`,A8*4bH `,@:u, AD`s:@````!H aA(|s:Ru:|s,#@a8DbH `,@H, @8a8cH m`|`4T~zKHxH,HH8b8x8pHZQA(8b8cx&|HZ!A(8bK*5pbP| @AbX| @@ 888b8x8pHYA(8b8cx&|HYA(8bK)pbP| @AbX| @@ 88pKb8H =`,@K8*HbH !`,@:u`s, A8:@``!H qA(|s:Ru:|s,#@a8DbH `,@8, @(a8cH }`|`4T~zqK8b8x8pHXqA(8b8cx&|HXAA(8bK(UpbP| @AbX| @@ 888b8x8pHWA(8b8cx&|HWA(8bK'pbP| @AbX| @@ 88pKb8H ]`,@ K8*XbH A`,@:u`s, A8:@``!H A(|s:Ru:|s,#@a8DbH `,@8, @(a8cH `|`4T~zK8b8x8pHVA(8b8cx&|HVaA(8bK&upbP| @AbX| @@ 888b8x8pHVA(8b8cx&|HUA(8bK%pbP| @AbX| @@ 88pKb8H }`,@@K8*lbH a`,A8*|bH I`,A8*bH 1`,A8*bH `,A8*bH `,Ax8*bH `,A`8*bH `,AL8*bH `,A48+ bH `,A 8+ bH `,A8+8bH q`,A8+HbH Y`,A8+\bH A`,A8+lbH )`,A8+|bH `,A8+bH `,A8+bH `,Ap8+bH `,AX8+bH `,AD8+bH `,A,8+bH `,A8,bH i`,A8,0bH Q`,A8,DbH 9`,A8,\bH !`,A8,pbH `,A8,bH `,A8,bH `,Ax8,bH `,Ad8,bH `,AL8,bH `,A88,bH y`,A 8,bH a`,A 8- bH I`,A8-$bH 1`,A8-4bH `,A8-HbH `,A8-XbH `,A8-lbH `,A8-|bH `,Ap8-bH `,A\8-bH `,AD8-bH q`,A08-bH Y`,A8-bH A`,A8-bH )`,A8-bH `,A8.bH `,A8.bH `,A8.(bH `,A8.@bH `,A8.PbH `,Ah8.dbH `,AT8.tbH i`,A<8.bH Q`,A(8.bH 9`,A8.bH !`,A8.bH `,A8.bH `,A8.bH `,A8.bH `,A8/bH `,A8/bH `,At8/ bH y`,A`8/4bH a`,AH8/DbH I`,@P:u, AD`s:@````!H A(|s:Ru:|s,#@a8DbH `,@, @a8cH `|`4T~zCKHuHsbH y`,@d:d`t, A@```!H zA(,, A:@t:,#@uH wA(aT`>,A,A, @HȐhKLH|H HHHHHDHHH4HHHH8b8x8pH4A(8b8cx&|H4A(8bKpbP| @AbX| @@ 888b8x8pH4EA(8b8cx&|H4A(8bK1pbP| @AbX| @@ 88pK8b8x8pH3A(8b8cx&|H3A(8bKpbP| @AbX| @@ 88pK8>bH w)`,A8> bH w`,A8>0bH v`,A8>LbH v`,A8>XbH v`,Ah8>hbH v`,AP8>tbH v`,A88>bH vi`,A$8>bH vQ`,A 8>bH v9`,A8>bH v!`,A8>bH v `,A8>bH u`,A8>bH u`,A8>bH u`,A8?bH u`,At8?(bH u`,A\8?@bH uy`,AH8?PbH ua`,A08?hbH uI`,A8?xbH u1`,A8?bH u`,A8?bH u`,HW\8?bH t`,HWP8?bH t`,HWD8?bH t`,HW88?bH t`,HW,8?bH t`,HW 8?bH tq`,HW8@ bH tY`,HW8@$bH tA`,HV8@4bH t)`,HV8@DbH t`,HV8@\bH s`,HV8@pbH s`,HV8@bH s`,HV8@bH s`,HV8@bH s`,A~8@bH s`,A~8@bH si`,A|8@bH sQ`,A|8@bH s9`,Az8AbH s!`,Az8AbH s `,@:u, AD`s:@````!H qQA(|s:Ru:|s,#@a8DbH r`,@`, @Pa8cH r]`|`4T~z BKH HH|H4HHHH$HPHp8b8x8pH.)A(8b8cx&|H-A(8bK pbP| @AbX| @@ 888b8x8pH-A(8b8cx&|H-A(8bKpbP| @AbX| @@ 88pKb8H q`,@K8A(bH p`,@:u`s, A@:@````!H oAA(|s:Ru:|s,#@a8DbH py`,@8, @(a8cH pM`|`4T~z*K8b8x8pH,AA(8b8cx&|H,A(8bK%pbP| @AbX| @@ 888b8x8pH+A(8b8cx&|H+A(8bKpbP| @AbX| @@ 88pKb8H o-`,@K8A,AT<`8B?| AD, @acH fA(z 4K{8b8x8pH#YA(8b8cx&|H#)A(8bK=pbP| @AbX| @@ 888b8x8pH"A(8b8cx&|H"A(8bKpbP| @AbX| @@ 88pK8b8x8pH"YA(8b8cx&|H")A(8bK=pbP| @AbX| @@ 88pK(8DbH e`,AK8DbH e`,AK8DbH e`,AJ8DbH eu`,AJ8DbH e]`,AH8DbH eE`,AH8DbH e-`,AH8DbH e`,AH8EbH d`,AF8E$bH d`,AF8E4bH d`,AF8EHbH d`,AFt8EdbH d`,AD8EtbH d`,ADt8EbH dm`,AB8EbH dU`,ABl8EbH d=`,A@ 8EbH d%`,A?8EbH d `,A> 8EbH c`,A=8FbH c`,A< 8FbH c`,A;8F(bH c`,A: 8F8bH c`,A98FLbH c}`,A8 8F`bH ce`,A78FxbH cM`,A6 8FbH c5`,A58FbH c`,@<:d`t, A<``!H dA(,, At:@lt:,#@uH aaA(aT`>,Ad<`8B?| AT, @acH a%A(z 8Kv8b8x8pHiA(8b8cx&|H9A(8bKMpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 88pK8b8x8pHiA(8b8cx&|H9A(8bKMpbP| @AbX| @@ 88pK(8FbH ``,A2L8FbH ``,A248FbH ``,A28FbH ``,A/8FbH `m`,A/8GbH `U`,A.T8GbH `=`,A.<8G$bH `%`,A,T8G4bH ` `,A,<8GHbH _`,A*H8G\bH _`,A*08GtbH _`,A'8GbH _`,A'8GbH _`,A'8GbH _}`,A%L8GbH _e`,A%48GbH _M`,A%8HbH _5`,A#48HbH _`,A#8H,bH _`,A!48H,A<`8B?| A, @acH [A(z dKq88b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHiA(8b8cx&|HAA(8bKUpbP| @AbX| @@ 88pK8b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 88pK(8IXbH [M`,aA8IhbH [1`,Ab8IxH [`,Ab8IH [`,ADb8IH Z`,A,b8IH Z`,Ab8IH Z`,A b8IH Z`,A xb8IH Z`,aA \8IbH Zm`,A Db8JH ZU`,A ,b8JH Z=`,A b8J0H Z%`,A b8JHH Z `,A b8JTH Y`,A tb8JhH Y`,A \b8JH Y`,A b8JH Y`,Ab8JH Y`,aA8JbH Yy`,Axb8JH Ya`,A`b8JH YI`,AHb8JH Y1`,Ab8JH Y`,aA8KbH X`,A|b8KH X`,Adb8K$H X`,ALb8K4H X`,@Kl8KHbH X`,@Kl8K\bH X}`,@Kl8KtbH Xa`,@Klb8KbcH X=`,@Kl8KbH X!`,@Klh8KbH X`,@KlL8KbH W`,@Kl08KbH W`,@Kk8KbH W`,@Kk8L bH W`,@Kk8LbH Wy`,@Kk8L,bH W]`,@Kk8L@bH WA`,@Kkd8LPbH W%`,@KkH8L`bH W `,@Kk,8LpbH V`,@Kk8LbH V`,@Kj8LbH V`,@Kj8LbH V`,@Kj8LbH V}`,@Kj8LbH Va`,@Kj8LbH VE`,@Kjh8LbH V)`,@KjL; 8xp8ccHA(H@8~x&|"`HA(cKP|=@AX|=@@b`8h8apKKiauH S}A((#A, @@ahKi8b8x8pHAA(8b8cx&|HA(8bK%pbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 88pKauH R=A((#A, @@apKhP8b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HYA(8bKmpbP| @AbX| @@ 88pKa:t`s, A8:@``!H QQA(|s:Rt:|s,#@a8DbH R`,@8, @(a8cH R]`|`4T~zKf8b8x8pHQA(8b8cx&|H!A(8bK5pbP| @AbX| @@ 888b8x8pH A(8b8cx&|H A(8bKݽpbP| @AbX| @@ 88pKb8H Q=`,A; 8x8pccH -A(H@8~x&|"H A(cK P|=@@Kn$KauH NA((#AD, @@a8Kd8b8x8pH A(8b8cx&|H QA(8bKepbP| @AbX| @@ 888b8x8pH A(8b8cx&|H A(8bKpbP| @AbX| @@ 88pKaca, @@aXKc; 8x8pccH IA(@8~Hx&|"H A(cK%P|=@AX|=@@b`8h8 8x;p8ccH A(H@8~x&|"H A(cKڙP|=@AX|=@@b`8bh8pKaca, @@aPKb(; 8x8pccH A(@8~Hx&|"H A(cKP|=@AX|=@@b`8h8 8x;p8ccH YA(H@8~x&|"H -A(cKAP|=@AX|=@@b`8bh8pK@aK`a:d`t, A<``!H MA(,, At:@lt:,#@uH KA(aT`>,A<`8B?| A, @acH JA(z hK`X8b8x8pH A(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HaA(8bKupbP| @AbX| @@ 88pK8b8x8pH A(8b8cx&|HA(8bKpbP| @AbX| @@ 88pK(a:d`t, A@```!H KuA(,, At:@lt:,#@uH HA(aTc>,A<`| A, @acH HA(z lK^8b8x8pHA(8b8cx&|HA(8bKխpbP| @AbX| @@ 888b8x8pHIA(8b8cx&|H!A(8bK5pbP| @AbX| @@ 88pK8b8x8pHA(8b8cx&|HA(8bKԭpbP| @AbX| @@ 88pK(aca, @a K\@; 8x8pccH A(@8~Hx&|"HA(cKP|=@AX|=@@b`8h8 8x;p8ccHqA(H@8~x&|"HEA(cKYP|=@AX|=@@b`8bh8pKa:d`t, AH`````!H GA(,, Ap:@ht:,#@uH E!A(aT`>,A$,'A, @ acH DA(0d KZ|8b8x8pH-A(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKљpbP| @AbX| @@ 88pK8b8x8pH-A(8b8cx&|HA(8bKpbP| @AbX| @@ 88pK,a:t`s, A<:@```!H BA(|s:Rt:|s,#@a8DbH D)`,@8, @(a8cH C`|`4T~zKX@8b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHqA(8b8cx&|HIA(8bK]pbP| @AbX| @@ 88pKb8H B`,AK|Ka:t`s, A8:@``!H A!A(|s:Rt:|s,#@a8DbH BY`,@8, @(a8cH B-`|`4T~zGKVp8b8x8pH!A(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HyA(8bK͍pbP| @AbX| @@ 88pKb8H A `,AKzKaca, @a KU; 8x8pccHA(@8~Hx&|"HA(cK̥P|=@AX|=@@b`8h8 8x;p8ccH1A(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pKa:t`s, A@:@````!H =A(|s:Rt:|s,#@a8DbH ?)`,@8, @(a8cH >`|`4T~zvKS@8b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHqA(8b8cx&|HIA(8bK]pbP| @AbX| @@ 88pKb8H =`,AKwKa:t`s, A8:@``!H ,AKsp,@Ksd, @ acH 85A(@dKM8b8x8pHuA(8b8cx&|HEA(8bKYpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 88pK8b8x8pHuA(8b8cx&|HEA(8bKYpbP| @AbX| @@ 88pK$a:d`t, A<``!H 8A(,, Ax:@pt:,#@uH 61A(aT`>,AKq0,@Kq$, @ acH 5A(@dKK8b8x8pH5A(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bK¡pbP| @AbX| @@ 88pK8b8x8pH5A(8b8cx&|HA(8bKpbP| @AbX| @@ 88pK$a:t`s, AD:@`````!H 3A(|s:Rt:|s,#@a8DbH 5)`,@8, @(a8cH 4`|`4T~z KI@8b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHqA(8b8cx&|HIA(8bK]pbP| @AbX| @@ 88pKb8H 3`,AKmKa:t`s, A8:@``!H 2!A(|s:Rt:|s,#@a8DbH 3Y`,@8, @(a8cH 3-`|`4T~zAKGp8b8x8pH!A(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HyA(8bKpbP| @AbX| @@ 88pKb8H 2 `,AKkKauH /A((#AƄ, @@aKF8b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHAA(8b8cx&|HA(8bK-pbP| @AbX| @@ 88pKa:d`t, A@```!H 1A(,, At:@lt:,#@uH /A(aTc>,@Kj<`| @Ki, @b00KDX8b8x8pH A(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HaA(8bKupbP| @AbX| @@ 88pK8b8x8pH A(8b8cx&|HA(8bKpbP| @AbX| @@ 88pK(auH ,}A((#A, @@a`KB8b8x8pHAA(8b8cx&|HA(8bK%pbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 88pKa:t`s, A8:@``!H +A(|s:Rt:|s,#@a8DbH ,`,@8, @(a8cH ,`|`4T~zK@8b8x8pHA(8b8cx&|HaA(8bKupbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 88pKb8H +}`,AKe,@K]p<`8B?| @K]\, @acH "-A(zK78b8x8pHqA(8b8cx&|HAA(8bKUpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 88pK8b8x8pHqA(8b8cx&|HAA(8bKUpbP| @AbX| @@ 88pK a:t`s, A@:@````!H 1A(|s:Rt:|s,#@a8DbH !i`,@8, @(a8cH !=`|`4T~z 7K58b8x8pH1A(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHܱA(8b8cx&|H܉A(8bKpbP| @AbX| @@ 88pKb8H `,AKYKa:t`s, A8:@``!H aA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH m`|`4T~zK38b8x8pHaA(8b8cx&|H1A(8bKEpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HڹA(8bKpbP| @AbX| @@ 88pKb8H M`,AKX Ka:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~z K18b8x8pHّA(8b8cx&|HaA(8bKupbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 88pKb8H }`,AKV,@KP0<`8B?| @KP, @ acH A(@dxK*|8b8x8pH-A(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHѭA(8b8cx&|HхA(8bKpbP| @AbX| @@ 88pK8b8x8pH-A(8b8cx&|HA(8bKpbP| @AbX| @@ 88pKa:t`s, A<:@```!H A(|s:Rt:|s,#@a8DbH )`,@8, @(a8cH `|`4T~zwK(@8b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHqA(8b8cx&|HIA(8bK]pbP| @AbX| @@ 88pKb8H `,AKLKa:t`s, A8:@``!H !A(|s:Rt:|s,#@a8DbH Y`,@8, @(a8cH -`|`4T~z K&p8b8x8pH!A(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pH͡A(8b8cx&|HyA(8bKpbP| @AbX| @@ 88pKb8H  `,AKJKa:t`s, A8:@``!H QA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH ]`|`4T~zvK$8b8x8pHQA(8b8cx&|H!A(8bK5pbP| @AbX| @@ 888b8x8pHA(8b8cx&|H˩A(8bKpbP| @AbX| @@ 88pKb8H =`,aAKHKauH )A((#A, @@aK#<8b8x8pHA(8b8cx&|HʽA(8bKpbP| @AbX| @@ 888b8x8pHmA(8b8cx&|HEA(8bKYpbP| @AbX| @@ 88pK@aK"@aK!auH A((#AH, @@ahK!8b8x8pHɅA(8b8cx&|HUA(8bKipbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 88pKauH A((#A, @@aK 8b8x8pHEA(8b8cx&|HA(8bK)pbP| @AbX| @@ 888b8x8pHA(8b8cx&|HǝA(8bKpbP| @AbX| @@ 88pKa:t`s, A<:@```!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~zK8b8x8pHƑA(8b8cx&|HaA(8bKupbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 88pKb8H }`,AKC,@KB<`8B?| @KB, @acH mA(zK8b8x8pHıA(8b8cx&|HāA(8bKpbP| @AbX| @@ 888b8x8pH1A(8b8cx&|H A(8bKpbP| @AbX| @@ 88pK8b8x8pHñA(8b8cx&|HÁA(8bKpbP| @AbX| @@ 88pK a:d`t, AH`````!H A(,, At:@lt:,#@uH aA(aT`>,AK@`,d@K@T, @acH %A(zK8b8x8pHiA(8b8cx&|H9A(8bKMpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 88pK8b8x8pHiA(8b8cx&|H9A(8bKMpbP| @AbX| @@ 88pK(a:d`t, A@```!H A(,, A|:@tt:,#@uH !A(aTc>,@K> <`| @K> , @acH A(z PKp8b8x8pH!A(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HyA(8bKpbP| @AbX| @@ 88pK8b8x8pH!A(8b8cx&|HA(8bKpbP| @AbX| @@ 88pK a:d`t, AH`````!H A(,, A|:@tt:,#@uH A(aT`>,@K;<`8B?| @K;, @acH A(z xK 8b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHQA(8b8cx&|H)A(8bK=pbP| @AbX| @@ 88pK8b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 88pK a:d`t, AH`````!H 5A(,, A|:@tt:,#@uH A(aT`>,@K9<`8B?| @K9l, @acH =A(z |K8b8x8pHA(8b8cx&|HQA(8bKepbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 88pK8b8x8pHA(8b8cx&|HQA(8bKepbP| @AbX| @@ 88pK a:t`s, A@:@````!H AA(|s:Rt:|s,#@a8DbH y`,@8, @(a8cH M`|`4T~zK8b8x8pHAA(8b8cx&|HA(8bK%pbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 88pKb8H -`,AK5Ka:t`s, A8:@``!H qA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH }`|`4T~z K8b8x8pHqA(8b8cx&|HAA(8bKUpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 88pKb8H ]`,AK4Ka:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~zBK 8b8x8pHA(8b8cx&|HqA(8bKpbP| @AbX| @@ 888b8x8pH!A(8b8cx&|HA(8bK pbP| @AbX| @@ 88pKb8H `,AK2LKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~zK 8b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHQA(8b8cx&|H)A(8bK=pbP| @AbX| @@ 88pKb8H `,AK0|Ka:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH 9`,@8, @(a8cH `|`4T~z K P8b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HYA(8bKmpbP| @AbX| @@ 88pKb8H `,AK.Ka:t`s, A8:@``!H 1A(|s:Rt:|s,#@a8DbH i`,@8, @(a8cH =`|`4T~z K8b8x8pH1A(8b8cx&|HA(8bKpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKpbP| @AbX| @@ 88pKb8H `,AK,Ka:t`s, A8:@``!H aA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH m`|`4T~zK8b8x8pHaA(8b8cx&|H1A(8bK~EpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bK}pbP| @AbX| @@ 88pKb8H M`,AK+ Ka:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~zK8b8x8pHA(8b8cx&|HaA(8bK|upbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bK{pbP| @AbX| @@ 88pKb8H }`,AK),@K<`8B?| @K, @ acH mA(@dtK8b8x8pHA(8b8cx&|H}A(8bKlpbP| @AbX| @@ 888b8x8pH-A(8b8cx&|HA(8bKlpbP| @AbX| @@ 88pK8b8x8pHA(8b8cx&|H}A(8bKkpbP| @AbX| @@ 88pK@aK,@K <`8B?| @K , @acH НA(z0K08b8x8pHA(8b8cx&|HA(8bK]pbP| @AbX| @@ 888b8x8pHaA(8b8cx&|H9A(8bK]MpbP| @AbX| @@ 88pK8b8x8pHA(8b8cx&|HA(8bK\pbP| @AbX| @@ 88pK @aKp@a@K\@a8KHa:d`t, A<``!H A(,, A|:@tt:,#@uH aA(aTc>,@K `<`| @K L, @acH A(z pK8b8x8pHaA(8b8cx&|H1A(8bK[EpbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKZpbP| @AbX| @@ 88pK8b8x8pHaA(8b8cx&|H1A(8bKZEpbP| @AbX| @@ 88pK aca, @@aK; 8x8pccHA(@8~Hx&|"HiA(cKY}P|=@AX|=@@b`8h8 8x;p8ccH A(H@8~x&|"HA(cKXP|=@AX|=@@b`8bh8pKa:d`t, A@```!H uA(,, A|:@tt:,#@uH A(aT`>,@K<`8B?| @K, @acH }A(z4K8b8x8pHA(8b8cx&|HA(8bKWpbP| @AbX| @@ 888b8x8pHAA(8b8cx&|HA(8bKW-pbP| @AbX| @@ 88pK8b8x8pHA(8b8cx&|HA(8bKVpbP| @AbX| @@ 88pK a:t`s, A@:@````!H ȁA(|s:Rt:|s,#@a8DbH ɹ`,@8, @(a8cH ɍ`|`4T~z%K8b8x8pHA(8b8cx&|HQA(8bKUepbP| @AbX| @@ 888b8x8pHA(8b8cx&|HA(8bKTpbP| @AbX| @@ 88pKb8H m`,AK,Ka:t`s, A8:@``!H ƱA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH ǽ`|`4T~zK8b8x8pHA(8b8cx&|HA(8bKSpbP| @AbX| @@ 888b8x8pH1A(8b8cx&|H A(8bKSpbP| @AbX| @@ 88pKb8H Ɲ`,AK\Ka:d`t, A@```!H DžA(,, A|:@tt:,#@uH A(aT`>,@K<`8B?| @K, @acH čA(z LK 8b8x8pHA(8b8cx&|HA(8bKQpbP| @AbX| @@ 888b8x8pHQA(8b8cx&|H)A(8bKQ=pbP| @AbX| @@ 88pK8b8x8pHA(8b8cx&|HA(8bKPpbP| @AbX| @@ 88pK @aK`aca, @@aK4; 8x8pccHA(@8~Hx&|"HA(cKOP|=@AX|=@@b`8h8 8x;p8ccHeA(H@8~x&|"H9A(cKOMP|=@AX|=@@b`8bh8pKayAP```!~H ƱA(8 ,c@8H A(,#A(y@@aK֔; 8x8pccH~]A(H@8~x&|"H~)A(cKN=P|=@AX|=@@b`8h8 8x;p8ccH}A(H@8~x&|"@H}A(cKMP|=@AX|=@@b`8bh8pKa,>A;.!8.~H •A(8.a8||yNAXa8cH iA(|yya@l.9A48|H A((#Ax.<@~H A((#AA ,98|@(H A((#Ax8;`;@Ĉ|,#A4``!H A(||Ѯ;Z;{||Ю,#@ay@@aK,; 8x8pccH{A(H@8~8x&|"hH{A(cKKP| @AX| @@b`8bh8pKP8yH iA((#APKa8.,$A 8; 8x8pccH{A(H@8~8x&|"hHzA(cKJP|=@A8pbX| @@4K$~H A((#AH@.<@K~H }A(8(#A K|8. 8x;p8ccHz=A(H@8~8x&|"hHzA(cKJP|=@AXK a,>A;@.8.~H )A(8a|}yNA0~H A((#ATațC.=@~H qA((#A@t8;;`Ĉ},#A0`!H A(|}ٮ;{;|}خ,#@y@@@aK 8}H A((#@; 8x8pccHxA(H@8~8x&|"hHxA(cKHP| @AX| @@b`8bh8pK<8. 8x;p8ccHxA(H@8~8x&|"hHwA(cKGP| @AdX| @@dKTatH A(,@<8 bH A(,#A$, @@aKϐ8b8x8pHwAA(8b8cx&|HwA(8bKG%Pbp| @AX| @@ 888b8x8pHvA(8b8cx&|HvA(8bKFPbp| @AX| @@ 88pK; 8x8pccHv5A(H@8~x&|"HvA(cKFP| @AX| @@b`8h8 8x;p8ccHuA(H@8~x&|"@HuuA(cKEP| @@K֠K֌a:t`s, AD:@`````!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~z K8b8x8pHtA(8b8cx&|HtQA(8bKDePbp| @AX| @@ 888b8x8pHtA(8b8cx&|HsA(8bKCPbp| @AX| @@ 88pKb8H m`,A; 8x8pccHs]A(H@8~x&|"Hs)A(cKC=P| @@KTK@a:t`s, A8:@``!H AA(|s:Rt:|s,#@a8DbH y`,@8, @(a8cH M`|`4T~zuKʐ8b8x8pHrAA(8b8cx&|HrA(8bKB%Pbp| @AX| @@ 888b8x8pHqA(8b8cx&|HqA(8bKAPbp| @AX| @@ 88pKb8H -`,AKKa:t`s, A8:@``!H qA(|s:Rt:|s,#@a89bH `,@(, @@aK8b8x8pHpA(8b8cx&|HpQA(8bK@ePbp| @AX| @@ 888b8x8pHpA(8b8cx&|HoA(8bK?Pbp| @AX| @@ 88pKb89 H m`,AKDKa:t`s, A8:@``!H A(|s:Rt:|s,#@a88bH `,@(, @@aK8b8x8pHnA(8b8cx&|HnA(8bK>Pbp| @AX| @@ 888b8x8pHnAA(8b8cx&|HnA(8bK>-Pbp| @AX| @@ 88pKb88H `,A88bH `,A88bH }`,AKTKa,>Al8;;`},#+@d````!H A(|}ٮ;{;|}خ,#@y@@aK ; 8x8pccHlA(H@8~x&|"HlA(cK<P| @AX| @@b`8bh8pKTa:d`t, AD````!H 5A(,, A:@t:,#@uH A(aT`>,@K̘,'@Ǩ,A(, @acH 9A(zxK8b8x8pHk}A(8b8cx&|HkMA(8bK;aPbp| @AX| @@ 888b8x8pHjA(8b8cx&|HjA(8bK:Pbp| @AX| @@ 88pK; 8x8pccHjqA(H@8~8x&|"Hj=A(cK:QP| @@KhKT8b8x8pHjA(8b8cx&|HiA(8bK9Pbp| @AX| @@ 88pKa:t`s, AD:@`````!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~z K8b8x8pHhA(8b8cx&|HhA(8bK8Pbp| @AX| @@ 888b8x8pHhAA(8b8cx&|HhA(8bK8-Pbp| @AX| @@ 88pKb8H `,AKȄKa,>A;.!8.~H A(8.a8||yNAXa8cH A(|yya@t.9@~H =A((#A@t.<@~H A((#AA ,98|@(H A((#Ax8;`;@Ĉ|,#A4``!H A(||Ѯ;Z;{||Ю,#@ay@@aK; 8x8pccHfUA(H@8~8x&|"hHfA(cK61P| @AX| @@b`8bh8pKP8yH A((#APK8|H A((#A Ax.<@Kpa8.,$A 8; 8x8pccHeIA(H@8~8x&|"hHeA(cK5%P| @AXbp| @@K~H A(8(#A Kt8. 8x;p8ccHdA(H@8~8x&|"hHd]A(cK4qP| @APKLa,>A;@.8.~H A(8a|}yNA0~H A((#A\ațC.=@~H A((#A@|8;;`Ĉ},#A8```!H A(|}ٮ;{;|}خ,#@y@8@aK\8}H 9A((#@x; 8x8pccHcA(H@8~8x&|"hHbA(cK2P| @AX| @@b`8bh8pK<8. 8x;p8ccHbeA(H@8~8x&|"hHb-A(cK2AP| @AdX| @@dKTa:t`s, AD:@`````!H 1A(|s:Rt:|s,#@a8DbH i`,@8, @(a8cH =`|`4T~z K8b8x8pHa1A(8b8cx&|HaA(8bK1Pbp| @AX| @@ 888b8x8pH`A(8b8cx&|H`A(8bK0Pbp| @AX| @@ 88pKb8H `,AKKa:t`s, A8:@``!H aA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH m`|`4T~z`K8b8x8pH_aA(8b8cx&|H_1A(8bK/EPbp| @AX| @@ 888b8x8pH^A(8b8cx&|H^A(8bK.Pbp| @AX| @@ 88pKb8H M`,AK$K@aKXa:d`t, A<``!H %A(,, A|:@tt:,#@uH qA(aT`>,AK<`8B?| @Kt, @acH -A(zK8b8x8pH]qA(8b8cx&|H]AA(8bK-UPbp| @AX| @@ 888b8x8pH\A(8b8cx&|H\A(8bK,Pbp| @AX| @@ 88pK8b8x8pH\qA(8b8cx&|H\AA(8bK,UPbp| @AX| @@ 88pK a:t`s, A@:@````!H 1A(|s:Rt:|s,#@a8DbH i`,@8, @(a8cH =`|`4T~z 'K8b8x8pH[1A(8b8cx&|H[A(8bK+Pbp| @AX| @@ 888b8x8pHZA(8b8cx&|HZA(8bK*Pbp| @AX| @@ 88pKb8H `,AKKa:d`t, A@```!H A(,, A:@xt:,#@uH QA(aT`>,@Kh<`8B?| @KT, @ acH A(@dK8b8x8pHYMA(8b8cx&|HYA(8bK)1Pbp| @AX| @@ 888b8x8pHXA(8b8cx&|HXA(8bK(Pbp| @AX| @@ 88pK8b8x8pHXMA(8b8cx&|HXA(8bK(1Pbp| @AX| @@ 88pKa:t`s, A<:@```!H A(|s:Rt:|s,#@a8DbH I`,@8, @(a8cH `|`4T~zK`8b8x8pHWA(8b8cx&|HVA(8bK&Pbp| @AX| @@ 888b8x8pHVA(8b8cx&|HViA(8bK&}Pbp| @AX| @@ 88pKb8H `,AKKa:t`s, A8:@``!H AA(|s:Rt:|s,#@a8DbH y`,@8, @(a8cH M`|`4T~zAK8b8x8pHUAA(8b8cx&|HUA(8bK%%Pbp| @AX| @@ 888b8x8pHTA(8b8cx&|HTA(8bK$Pbp| @AX| @@ 88pKb8H -`,AKKauH A((#A$, @@axK08b8x8pHSA(8b8cx&|HSA(8bK#Pbp| @AX| @@ 888b8x8pHSaA(8b8cx&|HS9A(8bK#MPbp| @AX| @@ 88pK; 8x8pccHRA(H@8~8x&|"`HRA(cK"P| @@KK@aK|auH MA((#AT, @@aPK`8b8x8pHRA(8b8cx&|HQA(8bK!Pbp| @AX| @@ 888b8x8pHQA(8b8cx&|HQiA(8bK!}Pbp| @AX| @@ 88pKa:t`s, A8:@``!H aA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH m`|`4T~z LK8b8x8pHPaA(8b8cx&|HP1A(8bK EPbp| @AX| @@ 888b8x8pHOA(8b8cx&|HOA(8bKPbp| @AX| @@ 88pKb8H M`,AK$Ka:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~zOK8b8x8pHNA(8b8cx&|HNaA(8bKuPbp| @AX| @@ 888b8x8pHNA(8b8cx&|HMA(8bKPbp| @AX| @@ 88pKb8H }`,AKTKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~zNK8b8x8pHLA(8b8cx&|HLA(8bKPbp| @AX| @@ 888b8x8pHLAA(8b8cx&|HLA(8bK-Pbp| @AX| @@ 88pKb8H `,AKKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH )`,@8, @(a8cH `|`4T~zK@8b8x8pHJA(8b8cx&|HJA(8bKPbp| @AX| @@ 888b8x8pHJqA(8b8cx&|HJIA(8bK]Pbp| @AX| @@ 88pKb8H `,AKKa:t`s, A8:@``!H !A(|s:Rt:|s,#@a8DbH Y`,@8, @(a8cH -`|`4T~zKp8b8x8pHI!A(8b8cx&|HHA(8bKPbp| @AX| @@ 888b8x8pHHA(8b8cx&|HHyA(8bKPbp| @AX| @@ 88pKb8H `,AKKa:t`s, A8:@``!H QA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH ]`|`4T~z K8b8x8pHGQA(8b8cx&|HG!A(8bK5Pbp| @AX| @@ 888b8x8pHFA(8b8cx&|HFA(8bKPbp| @AX| @@ 88pKb8H =`,AKKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~zrK8b8x8pHEA(8b8cx&|HEQA(8bKePbp| @AX| @@ 888b8x8pHEA(8b8cx&|HDA(8bKPbp| @AX| @@ 88pKb8H m`,AKDKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~zK8b8x8pHCA(8b8cx&|HCA(8bKPbp| @AX| @@ 888b8x8pHC1A(8b8cx&|HC A(8bKPbp| @AX| @@ 88pKb8H `,AKtKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~z^K08b8x8pHAA(8b8cx&|HAA(8bKPbp| @AX| @@ 888b8x8pHAaA(8b8cx&|HA9A(8bKMPbp| @AX| @@ 88pKb8H `,AKKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH I`,@8, @(a8cH `|`4T~zK`8b8x8pH@A(8b8cx&|H?A(8bKPbp| @AX| @@ 888b8x8pH?A(8b8cx&|H?iA(8bK}Pbp| @AX| @@ 88pKb8H `,AKKa:t`s, A8:@``!H AA(|s:Rt:|s,#@a8DbH y`,@8, @(a8cH M`|`4T~zK8b8x8pH>AA(8b8cx&|H>A(8bK%Pbp| @AX| @@ 888b8x8pH=A(8b8cx&|H=A(8bK Pbp| @AX| @@ 88pKb8H -`,AKKa,>A8;;`Ĉ},#A<````!H 9A(|}ٮ;{;|}خ,#@c8:H %A(8,#aA~H y`8:,ATaȘy@P, @Kt, @Kda@8KLa8:a8KaKa,>A;:8~;@; Ĉ{,#A8```!H ~ A(|{ɮ;9~;Z|{Ȯ,#@Acc8:H A(8,#aA~H M`,ATațy@\, @KL, @KA;:8~;@; Ĉ{,#A0`!H |A(|{ɮ;9~;Z|{Ȯ,#@Acc8:H A(8,#aA~H ~-`,ATațy@d, @K,, @Ka@8Ka8:a8KaKa:t`s, AD:@`````!H {A(|s:Rt:|s,#@a8DbH })`,@8, @(a8cH |`|`4T~z K@8b8x8pH8A(8b8cx&|H8A(8bKPbp| @AX| @@ 888b8x8pH8qA(8b8cx&|H8IA(8bK]Pbp| @AX| @@ 88pKb8H {`,AKKauH yA((#A, @@aHK8b8x8pH7A(8b8cx&|H7aA(8bKuPbp| @AX| @@ 888b8x8pH7A(8b8cx&|H6A(8bKPbp| @AX| @@ 88pKa:t`s, A8:@``!H xA(|s:Rt:|s,#@a8DbH z`,@8, @(a8cH y`|`4T~z K08b8x8pH5A(8b8cx&|H5A(8bKPbp| @AX| @@ 888b8x8pH5aA(8b8cx&|H59A(8bKMPbp| @AX| @@ 88pKb8H x`,AKKa:t`s, A8:@``!H wA(|s:Rt:|s,#@a8DbH xI`,@8, @(a8cH x`|`4T~z?K`8b8x8pH4A(8b8cx&|H3A(8bKPbp| @AX| @@ 888b8x8pH3A(8b8cx&|H3iA(8bK}Pbp| @AX| @@ 88pKb8H v`,AKKa:t`s, A8:@``!H uAA(|s:Rt:|s,#@a8DbH vy`,@8, @(a8cH vM`|`4T~zK8b8x8pH2AA(8b8cx&|H2A(8bK%Pbp| @AX| @@ 888b8x8pH1A(8b8cx&|H1A(8bKPbp| @AX| @@ 88pKb8H u-`,AKKa:t`s, A8:@``!H sqA(|s:Rt:|s,#@a8DbH t`,@8, @(a8cH t}`|`4T~zyK8b8x8pH0qA(8b8cx&|H0AA(8bKUPbp| @AX| @@ 888b8x8pH/A(8b8cx&|H/A(8bKPbp| @AX| @@ 88pKb8H s]`,AK4Ka:t`s, A8:@``!H qA(|s:Rt:|s,#@a8DbH r`,@8, @(a8cH r`|`4T~zqK8b8x8pH.A(8b8cx&|H.qA(8bKPbp| @AX| @@ 888b8x8pH.!A(8b8cx&|H-A(8bK Pbp| @AX| @@ 88pKb8H q`,AKdKa:t`s, A8:@``!H oA(|s:Rt:|s,#@a8DbH q `,@8, @(a8cH p`|`4T~z 5K 8b8x8pH,A(8b8cx&|H,A(8bKPbp| @AX| @@ 888b8x8pH,QA(8b8cx&|H,)A(8bK=Pbp| @AX| @@ 88pKb8H o`,AKKa:t`s, A8:@``!H nA(|s:Rt:|s,#@a8DbH o9`,@8, @(a8cH o `|`4T~z 2KP8b8x8pH+A(8b8cx&|H*A(8bKPbp| @AX| @@ 888b8x8pH*A(8b8cx&|H*YA(8bKmPbp| @AX| @@ 88pKb8H m`,AKKa:t`s, A8:@``!H l1A(|s:Rt:|s,#@a8DbH mi`,@8, @(a8cH m=`|`4T~zK8b8x8pH)1A(8b8cx&|H)A(8bKPbp| @AX| @@ 888b8x8pH(A(8b8cx&|H(A(8bKPbp| @AX| @@ 88pKb8H l`,AKKa:t`s, A8:@``!H jaA(|s:Rt:|s,#@a8DbH k`,@8, @(a8cH km`|`4T~zmK8b8x8pH'aA(8b8cx&|H'1A(8bKEPbp| @AX| @@ 888b8x8pH&A(8b8cx&|H&A(8bKPbp| @AX| @@ 88pKb8H jM`,AK$Ka:t`s, A8:@``!H hA(|s:Rt:|s,#@a8DbH i`,@8, @(a8cH i`|`4T~zMK}8b8x8pH%A(8b8cx&|H%aA(8bKuPbp| @AX| @@ 888b8x8pH%A(8b8cx&|H$A(8bKPbp| @AX| @@ 88pKb8H h}`,AKTKa:t`s, A8:@``!H fA(|s:Rt:|s,#@a8DbH g`,@<, @,a8cH g`a|`4T~zK| 8b8x8pH#A(8b8cx&|H#A(8bKPbp| @AX| @@ 888b8x8pH#=A(8b8cx&|H#A(8bK)Pbp| @AX| @@ 88pKb8H f`,AKKa:t`s, AD:@`````!H dA(|s:Rt:|s,#@a8DbH f`,@8, @(a8cH e`|`4T~z Kz08b8x8pH!A(8b8cx&|H!A(8bKPbp| @AX| @@ 888b8x8pH!aA(8b8cx&|H!9A(8bKMPbp| @AX| @@ 88pKb8H d`,AKKa:t`s, A8:@``!H cA(|s:Rt:|s,#@a8DbH dI`,@8, @(a8cH d`|`4T~zKx`8b8x8pH A(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHA(8b8cx&|HiA(8bK}Pbp| @AX| @@ 88pKb8H b`,AKKa:t`s, A8:@``!H aAA(|s:Rt:|s,#@a8DbH by`,@8, @(a8cH bM`|`4T~zkKv8b8x8pHAA(8b8cx&|HA(8bK%Pbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pKb8H a-`,AK~Ka:t`s, A8:@``!H _qA(|s:Rt:|s,#@a8DbH ``,@8, @(a8cH `}`|`4T~z'Kt8b8x8pHqA(8b8cx&|HAA(8bKUPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pKb8H _]`,AK|4Ka:t`s, A8:@``!H ]A(|s:Rt:|s,#@a8DbH ^`,@8, @(a8cH ^`|`4T~zxKr8b8x8pHA(8b8cx&|HqA(8bKPbp| @AX| @@ 888b8x8pH!A(8b8cx&|HA(8bK Pbp| @AX| @@ 88pKb8H ]`,AKzdKa:t`s, A8:@``!H [A(|s:Rt:|s,#@a8DbH ] `,@8, @(a8cH \`|`4T~z Kq 8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHQA(8b8cx&|H)A(8bK=Pbp| @AX| @@ 88pKb8H [`,AKxKa:t`s, A8:@``!H ZA(|s:Rt:|s,#@a8DbH [9`,@8, @(a8cH [ `|`4T~z ;KoP8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHA(8b8cx&|HYA(8bKmPbp| @AX| @@ 88pKb8H Y`,AKvKa:t`s, A8:@``!H X1A(|s:Rt:|s,#@a8DbH Yi`,@8, @(a8cH Y=`|`4T~z :Km8b8x8pH1A(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pKb8H X`,AKtKa:t`s, A8:@``!H VaA(|s:Rt:|s,#@a8DbH W`,@8, @(a8cH Wm`|`4T~z CKk8b8x8pHaA(8b8cx&|H1A(8bKEPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pKb8H VM`,AKs$Ka:t`s, A8:@``!H TA(|s:Rt:|s,#@a8DbH U`,@8, @(a8cH U`|`4T~z Ki8b8x8pHA(8b8cx&|HaA(8bKuPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pKb8H T}`,AKqTKa:t`s, A8:@``!H RA(|s:Rt:|s,#@a8DbH S`,@8, @(a8cH S`|`4T~zKh8b8x8pHA(8b8cx&|HA(8bKߥPbp| @AX| @@ 888b8x8pHAA(8b8cx&|HA(8bK-Pbp| @AX| @@ 88pKb8H R`,AKoKauH PA((#A, @@aKf8b8x8pHaA(8b8cx&|H1A(8bKEPbp| @AX| @@ 888b8x8pH A(8b8cx&|H A(8bKPbp| @AX| @@ 88pK@a Kexa:d`t, A<``!H REA(,, A|:@tt:,#@uH OA(aT`>,AKm<`|@Km, @ acH OQA(@dKd8b8x8pH A(8b8cx&|H aA(8bKuPbp| @AX| @@ 888b8x8pH A(8b8cx&|H A(8bKPbp| @AX| @@ 88pK8b8x8pH A(8b8cx&|H aA(8bKuPbp| @AX| @@ 88pK a:d`t, AH`````!H OA(,, :L#BAxt:,#@uH MAA(aT`>, @KkX<`8B?| @KkD, @ acH LA(@dKb8b8x8pH =A(8b8cx&|H A(8bK!Pbp| @AX| @@ 888b8x8pH A(8b8cx&|H A(8bK٩Pbp| @AX| @@ 88pK8b8x8pH =A(8b8cx&|H A(8bK!Pbp| @AX| @@ 88pKa:d`t, AD````!H MA(,, A|:@tt:,#@uH JA(aT`>,AKi<`8B?| @Kh, @acH JA(z|K`@8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHqA(8b8cx&|HIA(8bK]Pbp| @AX| @@ 88pK8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pK auH HeA((#Al, @@aK^x8b8x8pH)A(8b8cx&|HA(8bK Pbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKՕPbp| @AX| @@ 88pKa:d`t, AH`````!H JA(,, A|:@tt:,#@uH GaA(aT`>,@Kex<`8B?| @Ked, @acH GA(z @K\8b8x8pHaA(8b8cx&|H1A(8bKEPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pK8b8x8pHaA(8b8cx&|H1A(8bKEPbp| @AX| @@ 88pK a:d`t, AH`````!H GA(,, A:@xt:,#@uH EA(aT`>,AKc(,'@Kc,A, @acH DA(zKZ\8b8x8pH A(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHA(8b8cx&|HeA(8bKyPbp| @AX| @@ 88pK8b8x8pH A(8b8cx&|HA(8bKPbp| @AX| @@ 88pKa:d`t, AD````!H EuA(,, A|:@tt:,#@uH BA(aTc>,@K`<`| @K`, @acH B}A(z KX8b8x8pHA(8b8cx&|HA(8bKϥPbp| @AX| @@ 888b8x8pHAA(8b8cx&|HA(8bK-Pbp| @AX| @@ 88pK8b8x8pHA(8b8cx&|HA(8bKΥPbp| @AX| @@ 88pK a:d`t, AH`````!H C%A(,, A:@t:,#@uH @qA(aT`>,@K^<`8B?| @K^t<`|A(, @acH @A(z `KU8b8x8pHaA(8b8cx&|H1A(8bKEPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pK; 8x8pccHUA(H@8~<x&|"H!A(cK5P| @@K]LK]88b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pKa:d`t, A@```!H @UA(,, A:@t:,#@uH =A(aT`>,@K[,'@K[,A(, @acH =YA(zKR8b8x8pHA(8b8cx&|HmA(8bKʁPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bK Pbp| @AX| @@ 88pK; 8x8pccHA(H@8~8x&|"H]A(cKqP| @@KZKZt8b8x8pH%A(8b8cx&|HA(8bK Pbp| @AX| @@ 88pKa:d`t, A<``!H =A(,, A|:@tt:,#@uH :A(aTc>,@KX<`| @KX, @acH :A(z8KP08b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHaA(8b8cx&|H9A(8bKMPbp| @AX| @@ 88pK8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pK a:d`t, AH`````!H ;EA(,, Ap:@ht:,#@uH 8A(aTc>,@KV<`| @KV, @ȐlKM8b8x8pHA(8b8cx&|HmA(8bKŁPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bK Pbp| @AX| @@ 88pK8b8x8pHA(8b8cx&|HmA(8bKāPbp| @AX| @@ 88pK,a:d`t, AD````!H 9A(,, A|:@tt:,#@uH 6QA(aT`>,@KTh<`8B?| @KTT, @acH 6 A(zKK8b8x8pHQA(8b8cx&|H!A(8bK5Pbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bK½Pbp| @AX| @@ 88pK8b8x8pHQA(8b8cx&|H!A(8bK5Pbp| @AX| @@ 88pK a:d`t, AH`````!H 6A(,, A|:@tt:,#@uH 4A(aT`>,@KR<`8B?| @KR, @acH 3A(zKIP8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHA(8b8cx&|HYA(8bKmPbp| @AX| @@ 88pK8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pK a:d`t, AH`````!H 4eA(,, A|:@tt:,#@uH 1A(aT`>,@KO<`8B?| @KO, @acH 1mA(zKG8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pH1A(8b8cx&|H A(8bKPbp| @AX| @@ 88pK8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pK a:d`t, AH`````!H 2A(,, A|:@tt:,#@uH /aA(aT`>,@KMx<`8B?| @KMd, @acH /A(zKD8b8x8pHaA(8b8cx&|H1A(8bKEPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pK8b8x8pHaA(8b8cx&|H1A(8bKEPbp| @AX| @@ 88pK a:t`s, A@:@````!H -!A(|s:Rt:|s,#@a8DbH .Y`,@8, @(a8cH .-`|`4T~zKKBp8b8x8pH!A(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHA(8b8cx&|HyA(8bKPbp| @AX| @@ 88pKb8H - `,AKIKa:t`s, A8:@``!H +QA(|s:Rt:|s,#@a8DbH ,`,@8, @(a8cH ,]`|`4T~zK@8b8x8pHQA(8b8cx&|H!A(8bK5Pbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pKb8H +=`,AKHKa:t`s, A8:@``!H )A(|s:Rt:|s,#@a8DbH *`,@8, @(a8cH *`|`4T~zK>8b8x8pHA(8b8cx&|HQA(8bKePbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pKb8H )m`,AKFDKa:t`s, A8:@``!H 'A(|s:Rt:|s,#@a8DbH (`,@8, @(a8cH (`|`4T~zDK=8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pH1A(8b8cx&|H A(8bKPbp| @AX| @@ 88pKb8H '`,AKDtKa:t`s, A8:@``!H %A(|s:Rt:|s,#@a8DbH '`,@8, @(a8cH &`|`4T~zCK;08b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHaA(8b8cx&|H9A(8bKMPbp| @AX| @@ 88pKb8H %`,AKBKa:d`t, A@```!H &A(,, A:@t:,#@uH $A(aT`>,@KB<`8B?| @KB,A, @acH #A(z K9D8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHuA(8b8cx&|HMA(8bKaPbp| @AX| @@ 88pK8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pKa:d`t, A<``!H $eA(,, A|:@tt:,#@uH !A(aT`>,@K?<`8B?| @K?, @acH !mA(zK78b8x8pHޱA(8b8cx&|HށA(8bKPbp| @AX| @@ 888b8x8pH1A(8b8cx&|H A(8bKPbp| @AX| @@ 88pK8b8x8pHݱA(8b8cx&|H݁A(8bKPbp| @AX| @@ 88pK a:t`s, A@:@````!H qA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH }`|`4T~z K48b8x8pHqA(8b8cx&|HAA(8bKUPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pKb8H ]`,AK<4Ka:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~zHK28b8x8pHڡA(8b8cx&|HqA(8bKPbp| @AX| @@ 888b8x8pH!A(8b8cx&|HA(8bK Pbp| @AX| @@ 88pKb8H `,AK:dKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH  `,@8, @(a8cH `|`4T~z !K1 8b8x8pHA(8b8cx&|HءA(8bKPbp| @AX| @@ 888b8x8pHQA(8b8cx&|H)A(8bK=Pbp| @AX| @@ 88pKb8H `,AK8KauH A((#A, @@a0K/8b8x8pHqA(8b8cx&|HAA(8bKUPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pKauH mA((#At, @@a K.8b8x8pH1A(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHձA(8b8cx&|HՉA(8bKPbp| @AX| @@ 88pKa:d`t, A@```!H %A(,, A|:@tt:,#@uH qA(aT`>,@K5<`8B?| @K5t, @acH -A(z HK,8b8x8pHqA(8b8cx&|HAA(8bKUPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pK8b8x8pHqA(8b8cx&|HAA(8bKUPbp| @AX| @@ 88pK a:t`s, A@:@````!H 1A(|s:Rt:|s,#@a8DbH i`,@8, @(a8cH =`|`4T~z *K*8b8x8pH1A(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHѱA(8b8cx&|HщA(8bKPbp| @AX| @@ 88pKb8H `,AK1KauH  A((#@K~, @@aK)8b8x8pHA(8b8cx&|HНA(8bKPbp| @AX| @@ 888b8x8pHMA(8b8cx&|H%A(8bK9Pbp| @AX| @@ 88pKa:t`s, AD:@`````!H A(|s:Rt:|s,#@a8DbH I`,@8, @(a8cH `|`4T~zK'`8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHΑA(8b8cx&|HiA(8bK}Pbp| @AX| @@ 88pKb8H `,AK.Ka:t`s, A8:@``!H AA(|s:Rt:|s,#@a8DbH y`,@8, @(a8cH M`|`4T~z 0K%8b8x8pHAA(8b8cx&|HA(8bK%Pbp| @AX| @@ 888b8x8pHA(8b8cx&|H̙A(8bKPbp| @AX| @@ 88pKb8H -`,AK-Ka:t`s, A8:@``!H qA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH }`|`4T~zK#8b8x8pHqA(8b8cx&|HAA(8bKUPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pKb8H ]`,AK+4Ka:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~zK!8b8x8pHɡA(8b8cx&|HqA(8bKPbp| @AX| @@ 888b8x8pH!A(8b8cx&|HA(8bK Pbp| @AX| @@ 88pKb8H `,AK)dKauH }A((#@Ku, @@a@K 8b8x8pH=A(8b8cx&|H A(8bK!Pbp| @AX| @@ 888b8x8pHǽA(8b8cx&|HǕA(8bKPbp| @AX| @@ 88pKauH 9A((#@Kt<, @@aKH8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHyA(8b8cx&|HQA(8bKePbp| @AX| @@ 88pKa:d`t, AH`````!H A(,, A|:@tt:,#@uH 1A(aT`>,@K&H<`8B?| @K&4, @acH A(zK8b8x8pH1A(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHıA(8b8cx&|HĉA(8bKPbp| @AX| @@ 88pK8b8x8pH1A(8b8cx&|HA(8bKPbp| @AX| @@ 88pK a:t`s, A@:@````!H A(|s:Rt:|s,#@a8DbH )`,@8, @(a8cH `|`4T~z K@8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHqA(8b8cx&|HIA(8bK]Pbp| @AX| @@ 88pKb8H `,AK"Ka:t`s, A8:@``!H !A(|s:Rt:|s,#@a8DbH Y`,@8, @(a8cH -`|`4T~z Kp8b8x8pH!A(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHA(8b8cx&|HyA(8bKPbp| @AX| @@ 88pKb8H  `,AK Ka:d`t, A@```!H A(,, At:@lt:,#@uH AA(aT`>,@K X,'@K L, @acH A(z K8b8x8pHIA(8b8cx&|HA(8bK-Pbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pK8b8x8pHIA(8b8cx&|HA(8bK-Pbp| @AX| @@ 88pK(a:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH I`,@8, @(a8cH `|`4T~z K`8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHA(8b8cx&|HiA(8bK}Pbp| @AX| @@ 88pKb8H `,AKKa:t`s, A8:@``!H AA(|s:Rt:|s,#@a8DbH y`,@<, @,a8cH M`|`4T~u>K8b8x8pH=A(8b8cx&|H A(8bK!Pbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pKb8H )`,AKKa:t`s, AD:@`````!H aA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH m`|`4T~zK8b8x8pHaA(8b8cx&|H1A(8bKEPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pKb8H M`,AK$KauH =A((#@Ke@, @@aXKL8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pH}A(8b8cx&|HUA(8bKiPbp| @AX| @@ 88pKa:t`s, AD:@`````!H AA(|s:Rt:|s,#@a8DbH y`,@8, @(a8cH M`|`4T~zK8b8x8pHAA(8b8cx&|HA(8bK%Pbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pKb8H -`,AKKauH A((#@Kb , @@a`K ,8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pH]A(8b8cx&|H5A(8bKIPbp| @AX| @@ 88pKa:t`s, AD:@`````!H !A(|s:Rt:|s,#@a8DbH Y`,@8, @(a8cH -`|`4T~z!K p8b8x8pH!A(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHA(8b8cx&|HyA(8bKPbp| @AX| @@ 88pKb8H `,AKK@aK a:t`s, AD:@`````!H 1A(|s:Rt:|s,#@a8DbH i`,@8, @(a8cH =`|`4T~zK 8b8x8pH1A(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pKb8H `,AKKa:t`s, A8:@``!H aA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH m`|`4T~zK8b8x8pHaA(8b8cx&|H1A(8bKEPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bK~Pbp| @AX| @@ 88pKb8H M`,AK$Ka:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~z,@K<`| @K, @ acH }A(@dXK 8b8x8pHA(8b8cx&|HA(8bKsPbp| @AX| @@ 888b8x8pH=A(8b8cx&|HA(8bKs)Pbp| @AX| @@ 88pK8b8x8pHA(8b8cx&|HA(8bKrPbp| @AX| @@ 88pKa:t`s, A<:@```!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~z K8b8x8pHA(8b8cx&|HQA(8bKqePbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKpPbp| @AX| @@ 88pKb8H m`,AKDKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~z K8b8x8pHA(8b8cx&|HA(8bKoPbp| @AX| @@ 888b8x8pH1A(8b8cx&|H A(8bKoPbp| @AX| @@ 88pKb8H `,AKtK@a(Ka,>A;@.8.~H A(8a|}yNA0~H EA((#A`ațC.=@~H A((#A@8Ĉ},#AD;;`````!H )A(|}ٮ;{;|}خ,#@y@4@aK8}H ߉A((#@t; 8x8pccHaA(H@8~8x&|"hH)A(cKm=P| @AX| @@b`8bh8pK<8. 8x;p8ccHA(H@8~8x&|"hH}A(cKlP| @AdX| @@dKTa:t`s, AD:@`````!H ށA(|s:Rt:|s,#@a8DbH ߹`,@8, @(a8cH ߍ`|`4T~z K8b8x8pHA(8b8cx&|HQA(8bKkePbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKjPbp| @AX| @@ 88pKb8H m`,AKDKa:t`s, A8:@``!H ܱA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH ݽ`|`4T~z "K8b8x8pHA(8b8cx&|HA(8bKiPbp| @AX| @@ 888b8x8pH1A(8b8cx&|H A(8bKiPbp| @AX| @@ 88pKb8H ܝ`,AKtKa:d`t, A@```!H ݅A(,At, @lt::,#@uH A(aT`>,@K<`8B?| @K, @ȐXK,8b8x8pHA(8b8cx&|HA(8bKgPbp| @AX| @@ 888b8x8pH]A(8b8cx&|H5A(8bKgIPbp| @AX| @@ 88pK8b8x8pHA(8b8cx&|HA(8bKfPbp| @AX| @@ 88pK,a:t`s, A<:@```!H ءA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH ٭`|`4T~zK8b8x8pHA(8b8cx&|HqA(8bKePbp| @AX| @@ 888b8x8pH!A(8b8cx&|HA(8bKe Pbp| @AX| @@ 88pKb8H ؍`,AKdKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~z|K 8b8x8pHA(8b8cx&|HA(8bKcPbp| @AX| @@ 888b8x8pHQA(8b8cx&|H)A(8bKc=Pbp| @AX| @@ 88pKb8H ֽ`,AKKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH 9`,@8, @(a8cH `|`4T~z KP8b8x8pHA(8b8cx&|HA(8bKaPbp| @AX| @@ 888b8x8pHA(8b8cx&|HYA(8bKamPbp| @AX| @@ 88pKb8H `,AKKa:t`s, A8:@``!H 1A(|s:Rt:|s,#@a8DbH i`,@8, @(a8cH =`|`4T~z K8b8x8pH1A(8b8cx&|HA(8bK`Pbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bK_Pbp| @AX| @@ 88pKb8H `,AKKa:t`s, A8:@``!H aA(|s:Rt:|s,#@a8DbH ҙ`,@8, @(a8cH m`|`4T~zK8b8x8pHaA(8b8cx&|H1A(8bK^EPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bK]Pbp| @AX| @@ 88pKb8H M`,AK$Ka:t`s, A8:@``!H ϑA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH Н`|`4T~zBK8b8x8pHA(8b8cx&|HaA(8bK\uPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bK[Pbp| @AX| @@ 88pKb8H }`,AKTKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~z (K8b8x8pHA(8b8cx&|HA(8bKZPbp| @AX| @@ 888b8x8pHAA(8b8cx&|HA(8bKZ-Pbp| @AX| @@ 88pKb8H ͭ`,AKKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH )`,@8, @(a8cH `|`4T~zK@8b8x8pHA(8b8cx&|HA(8bKXPbp| @AX| @@ 888b8x8pHqA(8b8cx&|HIA(8bKX]Pbp| @AX| @@ 88pKb8H `,AKKa:t`s, A8:@``!H !A(|s:Rt:|s,#@a8DbH Y`,@8, @(a8cH -`|`4T~zKp8b8x8pH!A(8b8cx&|HA(8bKWPbp| @AX| @@ 888b8x8pHA(8b8cx&|HyA(8bKVPbp| @AX| @@ 88pKb8H `,AKKa:t`s, A8:@``!H QA(|s:Rt:|s,#@a8DbH ɉ`,@8, @(a8cH ]`|`4T~zLKݠ8b8x8pHQA(8b8cx&|H!A(8bKU5Pbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKTPbp| @AX| @@ 88pKb8H =`,AKKa:t`s, A8:@``!H ƁA(|s:Rt:|s,#@a8DbH ǹ`,@8, @(a8cH Ǎ`|`4T~z 'K8b8x8pHA(8b8cx&|HQA(8bKSePbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKRPbp| @AX| @@ 88pKb8H m`,AKDKa:t`s, A8:@``!H ıA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH Ž`|`4T~zwK8b8x8pHA(8b8cx&|HA(8bKQPbp| @AX| @@ 888b8x8pH1A(8b8cx&|H A(8bKQPbp| @AX| @@ 88pKb8H ĝ`,AKtKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~zaK08b8x8pHA(8b8cx&|HA(8bKOPbp| @AX| @@ 888b8x8pHaA(8b8cx&|H9A(8bKOMPbp| @AX| @@ 88pKb8H `,AKߤKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH I`,@8, @(a8cH `|`4T~z K`8b8x8pH~A(8b8cx&|H}A(8bKMPbp| @AX| @@ 888b8x8pH}A(8b8cx&|H}iA(8bKM}Pbp| @AX| @@ 88pKb8H `,AKKa:d`t, A@```!H A(,A, @xt::,#@uH 1A(aTc>,@KH<`| @K4, @acH A(z KԀ8b8x8pH|1A(8b8cx&|H|A(8bKLPbp| @AX| @@ 888b8x8pH{A(8b8cx&|H{A(8bKKPbp| @AX| @@ 88pK8b8x8pH{1A(8b8cx&|H{A(8bKKPbp| @AX| @@ 88pK @aKa:d`t, AD````!H A(,A, @xt::,#@uH A(aT`>,@K<`8B?| @K, @acH A(z DK 8b8x8pHyA(8b8cx&|HyA(8bKIPbp| @AX| @@ 888b8x8pHyQA(8b8cx&|Hy)A(8bKI=Pbp| @AX| @@ 88pK8b8x8pHxA(8b8cx&|HxA(8bKHPbp| @AX| @@ 88pK aca, @aKH; 8x8pccHxA(@8~Hx&|"HwA(cKGP| @AX| @@b`8h8 8x;p8ccHwyA(H@8~x&|"HwMA(cKGaP| @AX| @@b`8bh8pKaca, @aXK; 8x8pccHvA(@8~Hx&|"HvA(cKFP| @AX| @@b`8h8 8x;p8ccHv!A(H@8~x&|"HuA(cKF P| @AX| @@b`8bh8pKa:d`t, AH`````!H A(,A, @|t::,#@uH A(aTc>,@K<;`| @K, @ acH A(@dlK8b8x8pHtA(8b8cx&|HtA(8bKDPbp| @AX| @@ 888b8x8pHtMA(8b8cx&|Ht%A(8bKD9Pbp| @AX| @@ 88pK8b8x8pHsA(8b8cx&|HsA(8bKCPbp| @AX| @@ 88pKa:t`s, A<:@```!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~zK8b8x8pHrA(8b8cx&|HraA(8bKBuPbp| @AX| @@ 888b8x8pHrA(8b8cx&|HqA(8bKAPbp| @AX| @@ 88pKb8H }`,AKTKa:d`t, A@```!H eA(,A, @|t::,#@uH A(aT`>,@K<`8B?| @KѴ, @ acH mA(@dhK8b8x8pHpA(8b8cx&|Hp}A(8bK@Pbp| @AX| @@ 888b8x8pHp-A(8b8cx&|HpA(8bK@Pbp| @AX| @@ 88pK8b8x8pHoA(8b8cx&|Ho}A(8bK?Pbp| @AX| @@ 88pKa:t`s, A<:@```!H qA(|s:Rt:|s,#@a8DbH `,@8, @(a8cH }`|`4T~zK8b8x8pHnqA(8b8cx&|HnAA(8bK>UPbp| @AX| @@ 888b8x8pHmA(8b8cx&|HmA(8bK=Pbp| @AX| @@ 88pKb8H ]`,AK4Ka:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~zK8b8x8pHlA(8b8cx&|HlqA(8bK<Pbp| @AX| @@ 888b8x8pHl!A(8b8cx&|HkA(8bK< Pbp| @AX| @@ 88pKb8H `,AKdKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~z~K 8b8x8pHjA(8b8cx&|HjA(8bK:Pbp| @AX| @@ 888b8x8pHjQA(8b8cx&|Hj)A(8bK:=Pbp| @AX| @@ 88pKb8H `,AKʔKa:d`t, A@```!H A(,A, @xt::,#@uH A(aT`>,@K<`8B?| @K, @acH A(zK@8b8x8pHhA(8b8cx&|HhA(8bK8Pbp| @AX| @@ 888b8x8pHhqA(8b8cx&|HhIA(8bK8]Pbp| @AX| @@ 88pK8b8x8pHgA(8b8cx&|HgA(8bK7Pbp| @AX| @@ 88pK @a(K@aKla:d`t, A@```!H 5A(,A, @|t::,#@uH A(aTc>,@Kǘ<`| @KDŽ, @ acH =A(@dK8b8x8pHf}A(8b8cx&|HfMA(8bK6aPbp| @AX| @@ 888b8x8pHeA(8b8cx&|HeA(8bK5Pbp| @AX| @@ 88pK8b8x8pHe}A(8b8cx&|HeMA(8bK5aPbp| @AX| @@ 88pKa:t`s, A<:@```!H AA(|s:Rt:|s,#@a8DbH y`,@8, @(a8cH M`|`4T~z K8b8x8pHdAA(8b8cx&|HdA(8bK4%Pbp| @AX| @@ 888b8x8pHcA(8b8cx&|HcA(8bK3Pbp| @AX| @@ 88pKb8H -`,AKKa:d`t, A@```!H A(,A, @xt::,#@uH aA(aT`>,AKx<`8B?| @Kd, @acH A(zK8b8x8pHbaA(8b8cx&|Hb1A(8bK2EPbp| @AX| @@ 888b8x8pHaA(8b8cx&|HaA(8bK1Pbp| @AX| @@ 88pK8b8x8pHaaA(8b8cx&|Ha1A(8bK1EPbp| @AX| @@ 88pK a:t`s, A@:@````!H !A(|s:Rt:|s,#@a8DbH Y`,@8, @(a8cH -`|`4T~zKp8b8x8pH`!A(8b8cx&|H_A(8bK0Pbp| @AX| @@ 888b8x8pH_A(8b8cx&|H_yA(8bK/Pbp| @AX| @@ 88pKb8H `,AKKa:d`t, A@```!H A(,A|, @tt::,#@uH AA(aT`>,@KX,@KL, @ acH A(@ddK8b8x8pH^EA(8b8cx&|H^A(8bK.)Pbp| @AX| @@ 888b8x8pH]A(8b8cx&|H]A(8bK-Pbp| @AX| @@ 88pK8b8x8pH]EA(8b8cx&|H]A(8bK-)Pbp| @AX| @@ 88pK$a:d`t, A<``!H A(,A, @|t::,#@uH A(aT`>,@K<`8B?| @K, @ acH A(@dpKL8b8x8pH[A(8b8cx&|H[A(8bK+Pbp| @AX| @@ 888b8x8pH[}A(8b8cx&|H[UA(8bK+iPbp| @AX| @@ 88pK8b8x8pHZA(8b8cx&|HZA(8bK*Pbp| @AX| @@ 88pKa:d`t, AD````!H eA(,A, @|t::,#@uH A(aTc>,@K<`| @K, @ acH mA(@d`K8b8x8pHYA(8b8cx&|HY}A(8bK)Pbp| @AX| @@ 888b8x8pHY-A(8b8cx&|HYA(8bK)Pbp| @AX| @@ 88pK8b8x8pHXA(8b8cx&|HX}A(8bK(Pbp| @AX| @@ 88pKa:d`t, AD````!H A(,A, @|t::,#@uH aA(aTc>,@Kx<`| @Kd, @ acH A(@d\K8b8x8pHW]A(8b8cx&|HW-A(8bK'APbp| @AX| @@ 888b8x8pHVA(8b8cx&|HVA(8bK&Pbp| @AX| @@ 88pK8b8x8pHV]A(8b8cx&|HV-A(8bK&APbp| @AX| @@ 88pKa:d`t, AD````!H A(,A, @xt::,#@uH A(aTc>,AK(<;`| @K, @acH A(z K`8b8x8pHUA(8b8cx&|HTA(8bK$Pbp| @AX| @@ 888b8x8pHTA(8b8cx&|HTiA(8bK$}Pbp| @AX| @@ 88pK8b8x8pHTA(8b8cx&|HSA(8bK#Pbp| @AX| @@ 88pK a:d`t, AH`````!H uA(,A, @|t::,#@uH A(aT`>,@K<`8B?| @K, @ acH }A(@dK 8b8x8pHRA(8b8cx&|HRA(8bK"Pbp| @AX| @@ 888b8x8pHR=A(8b8cx&|HRA(8bK")Pbp| @AX| @@ 88pK8b8x8pHQA(8b8cx&|HQA(8bK!Pbp| @AX| @@ 88pKa:d`t, AD````!H %A(,A, @|t::,#@uH qA(aT`>,@K<`8B?| @Kt, @ acH -A(@dK8b8x8pHPmA(8b8cx&|HP=A(8bK QPbp| @AX| @@ 888b8x8pHOA(8b8cx&|HOA(8bKPbp| @AX| @@ 88pK8b8x8pHOmA(8b8cx&|HO=A(8bKQPbp| @AX| @@ 88pKa:d`t, AD````!H A(,A, @|t::,#@uH !A(aT`>,@K8<`8B?| @K$, @ acH A(@d|Kl8b8x8pHNA(8b8cx&|HMA(8bKPbp| @AX| @@ 888b8x8pHMA(8b8cx&|HMuA(8bKPbp| @AX| @@ 88pK8b8x8pHMA(8b8cx&|HLA(8bKPbp| @AX| @@ 88pKa:t`s, A<:@```!H A(|s:Rt:|s,#@a8DbH `,@8, @(a8cH `|`4T~z +K08b8x8pHKA(8b8cx&|HKA(8bKPbp| @AX| @@ 888b8x8pHKaA(8b8cx&|HK9A(8bKMPbp| @AX| @@ 88pKb8H `,AKKa:t`s, A8:@``!H A(|s:Rt:|s,#@a8DbH I`,@8, @(a8cH `|`4T~z K`8b8x8pHJA(8b8cx&|HIA(8bKPbp| @AX| @@ 888b8x8pHIA(8b8cx&|HIiA(8bK}Pbp| @AX| @@ 88pKb8H `,AKKa:t`s, A8:@``!H AA(|s:Rt:|s,#@a8DbH y`,@8, @(a8cH M`|`4T~z &K8b8x8pHHAA(8b8cx&|HHA(8bK%Pbp| @AX| @@ 888b8x8pHGA(8b8cx&|HGA(8bKPbp| @AX| @@ 88pKb8H -`,AKKaca, @a XK ; 8x8pccHFA(@8~Hx&|"HFA(cKP| @AX| @@b`8h8 8x;p8ccHFQA(H@8~x&|"HF%A(cK9P| @AX| @@b`8bh8pKa:t`s, A@:@````!H A(|s:Rt:|s,#@a8DbH I`,@8, @(a8cH `|`4T~zuK`8b8x8pHEA(8b8cx&|HDA(8bKPbp| @AX| @@ 888b8x8pHDA(8b8cx&|HDiA(8bK}Pbp| @AX| @@ 88pKb8H `,AKKa:t`s, A8:@``!H AA(|s:Rt:|s,#@a8DbH y`,@8, @(a8cH M`|`4T~z K8b8x8pHCAA(8b8cx&|HCA(8bK%Pbp| @AX| @@ 888b8x8pHBA(8b8cx&|HBA(8bKPbp| @AX| @@ 88pKb8H -`,AKKa:d`t, A@```!H A(,A, @xt::,#@uH aA(aTc>,AKx<`| @Kd, @acH A(zTK8b8x8pHAaA(8b8cx&|HA1A(8bKEPbp| @AX| @@ 888b8x8pH@A(8b8cx&|H@A(8bKPbp| @AX| @@ 88pK8b8x8pH@aA(8b8cx&|H@1A(8bKEPbp| @AX| @@ 88pK a:t`s, A@:@````!H !A(|s:Rt:|s,#@a8DbH Y`,@8, @(a8cH -`|`4T~zpKp8b8x8pH?!A(8b8cx&|H>A(8bKPbp| @AX| @@ 888b8x8pH>A(8b8cx&|H>yA(8bKPbp| @AX| @@ 88pKb8H `,AKKa:d`t, A@```!H A(,A, @xt::,#@uH AA(aT`>,AKX<`8B?| @KD, @acH A(z ,K8b8x8pH=AA(8b8cx&|H=A(8bK %Pbp| @AX| @@ 888b8x8pH,AK8<`| @K$, @acH {A(z tKp8b8x8pH9!A(8b8cx&|H8A(8bK Pbp| @AX| @@ 888b8x8pH8A(8b8cx&|H8yA(8bKPbp| @AX| @@ 88pK8b8x8pH8!A(8b8cx&|H7A(8bKPbp| @AX| @@ 88pK aca, @@aK; 8x8pccH7aA(@8~Hx&|"H7)A(cK=P| @AX| @@b`8h8 8x;p8ccH6A(H@8~x&|"H6A(cKP| @AX| @@b`8bh8pKa:d`t, A@```!H {5A(,AP, @Ht::,#@acH xA(aT`>,AK<`8B?| @Kb, A,AL, A<`8 @| A,, @acH wA(zK8b8x8pH5AA(8b8cx&|H5A(8bK%Pbp| @AX| @@ 888b8x8pH4A(8b8cx&|H4A(8bKPbp| @AX| @@ 88pK 8x8p;ccH45A(@<Ha8 @(y&|`A88~H3A(8bKP| @@KK8b8x8pH3A(8b8cx&|H3A(8bKPbp| @AX| @@ 88pKPa:d`t, AH`````!H xA(,A, @t::,#@acH uaA(aT`>,AKx<`8B?| @Kdb, A,A,, A<`8 @| A , @acH tA(ztKp8b8x8pH2!A(8b8cx&|H1A(8bKPbp| @AX| @@ 888b8x8pH1A(8b8cx&|H1yA(8bKPbp| @AX| @@ 88pK8b8x8pH1!A(8b8cx&|H0A(8bKPbp| @AX| @@ 88pKauH rA((#@Kݘ, @@aK8b8x8pH0UA(8b8cx&|H0%A(8bK9Pbp| @AX| @@ 888b8x8pH/A(8b8cx&|H/A(8bKPbp| @AX| @@ 88pKauH qQA((#@KT, @@axK`8b8x8pH/A(8b8cx&|H.A(8bKPbp| @AX| @@ 888b8x8pH.A(8b8cx&|H.iA(8bK}Pbp| @AX| @@ 88pKa:t`s, A8:@``!H paA(|s:Rt:|s,#@a8DbH q`,@8, @(a8cH qm`|`4T~z -K8b8x8pH-aA(8b8cx&|H-1A(8bKEPbp| @AX| @@ 888b8x8pH,A(8b8cx&|H,A(8bKPbp| @AX| @@ 88pKb8H pM`,AK$Ka:t`s, A8:@``!H nA(|s:Rt:|s,#@a8DbH o`,@8, @(a8cH o`|`4T~zK8b8x8pH+A(8b8cx&|H+aA(8bKuPbp| @AX| @@ 888b8x8pH+A(8b8cx&|H*A(8bKPbp| @AX| @@ 88pKb8H n}`,AKTKa:d`t, A@```!H oeA(,A, @xt::,#@uH lA(aT`>,@K<`8B?| @K, @acH lmA(zK8b8x8pH)A(8b8cx&|H)A(8bKPbp| @AX| @@ 888b8x8pH)1A(8b8cx&|H) A(8bKPbp| @AX| @@ 88pK8b8x8pH(A(8b8cx&|H(A(8bKPbp| @AX| @@ 88pK a,>A;:8>Ĉy,#AD;`;@````!H j9A(|yѮ;Z>;{|yЮ,#@ac#8:H m%A(,#8aA~H k}`,ATațy@X, @K|, @Kla@8谤KTa8:a8KaKayA;;@:~cc``!H hA((#@8{8:H l-A(a,#A~H j`,A`ațCyA~ccK, @K~|, @K~la@8తK~Ta8:a8KaKa,>A;:8>Ĉy,#A8;`;@`!H hA(|yѮ;Z>;{|yЮ,#@ac#8:H kA(,#8aA~H i]`,ATațy@d, @K}\, @K}La@8ذK}4a8:a8KaKa,>A;@.8.~H j5A(a|}yNA48~H fA((#A`ațC.=@~H f}A((#A@8Ĉ},#AD;;`````!H fA(|}ٮ;{;|}خ,#@y@4@aK| 8}H eA((#@t; 8x8pccH#A(H@8~8x&|"hH#A(cKP| @AX| @@b`8bh8pK<8. 8x;p8ccH#A(H@8~8x&|"hH"A(cKP| @AdX| @@dKTa,>A;@.8.~H gA(a|}yNA48~H deA((#A`ațC.=@~H d=A((#A@8Ĉ},#AD;;`````!H dIA(|}ٮ;{;|}خ,#@y@4@aKy8}H cA((#@t; 8x8pccH!A(H@8~8x&|"hH!IA(cK]P| @AX| @@b`8bh8pK<8. 8x;p8ccH A(H@8~8x&|"hH A(cKP| @AdX| @@dKTa,>A;.!8.~H eA(a||yNA`88.a8cH eA(|yya@p.9@~H aA((#Aa@p.<@~H aA((#AA ,9@(8|H aA((#At8Ĉ|,#A8;`;@`!H aA(||Ѯ;Z;{||Ю,#@ay@@aKwL; 8x8pccHA(H@8~8x&|"hHA(cKP| @AX| @@b`8bh8pKP8yH `A((#APK8|H `mA((#A A|.<@Kta8.,$A 8; 8x8pccH A(H@8~8x&|"hHA(cKP| @AXbp| @@K~H _A(a8(#A Kt8. 8x;p8ccHQA(H@8~8x&|"hHA(cK-P| @ALKHa,>A;@.8.~H b=A(a|}yNA48~H ^A((#AXațC.=@~H ^A((#A@x8Ĉ},#A<;;```!H ^A(|}ٮ;{;|}خ,#@y@<@aKt8}H ]A((#@|; 8x8pccHA(H@8~8x&|"hHA(cKP| @AX| @@b`8bh8pK<8. 8x;p8ccH%A(H@8~8x&|"hHA(cKP| @AdX| @@dKTa,>A0;.!8.~H `A(a||yNAd88.a8cH _A(|yya@.9@~H \IA(a(#Aa@.<@ ~H \A(a(#AA$,9@88|H [A(a(#A8Ĉ|,#AD;`;@``!H \ A(||Ѯ;Z``;{||Ю,#@ܘqay@@aKq; 8x8pccHMA(H@8~8x&|"hHA(cK)P| @AX| @@b`8bh8pKP8yH ZA(a(#ALK8|H ZA(a(#A A`.<@xKXa8.,$A 8; 8x8pccH9A(H@8~8x&|"hHA(cKP| @AXbp| @@K~H YA(a8(#A KT8. 8x;p8ccHA(H@8~8x&|"hHIA(cK]P| @ADKHa,>A;@.8.~H \mA(a|}yNA48~H XA((#AXațC.=@~H XA((#A@x8Ĉ},#A<;;```!H XA(|}ٮ;{;|}خ,#@y@<@aKnL8}H X)A((#@|; 8x8pccHA(H@8~8x&|"hHA(cKP| @AX| @@b`8bh8pK<8. 8x;p8ccHUA(H@8~8x&|"hHA(cK1P| @AdX| @@dKTua, @@aKl; 8x8pccHA(@8~Hx&|"HqA(cKP|=@AX|=@@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pKua, @@aKk; 8x8pccHUA(@8~Hx&|"HA(cK1P|=@AX|=@@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pKa:d`t, AD````!H W%A(,A, @t::,#@uH TqA(aT`>,@Kr,'@Kr|,@K, @ acH T%A(@dKi8b8x8pHeA(8b8cx&|H5A(8bKIPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pK8b8x8pHeA(8b8cx&|H5A(8bKIPbp| @AX| @@ 88pKa:d`t, A<``!H TA(,A, @t::,#@uH R!A(aT`>,@Kp8<`8B?| @Kp$,'A,, @ acH QA(@dKg`8b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 888b8x8pHA(8b8cx&|HiA(8bK}Pbp| @AX| @@ 88pK; 8x8pccHA(H@8~8'x&|"H A(cKP| @@KnKn8b8x8pH A(8b8cx&|H iA(8bK}Pbp| @AX| @@ 88pKaca, @@aKe; 8x8pccH A(@8~Hx&|"H A(cKܵP| @AX| @@b`8h8 8x;p8ccH AA(H@8~x&|"H A(cK)P| @AX| @@b`8bh8pKa:t`s, A@:@````!H NA(|s:Rt:|s,#@a8bH O9`,@(, @@aKc`8b8x8pH A(8b8cx&|H A(8bKPbp| @AX| @@ 888b8x8pH A(8b8cx&|H iA(8bK}Pbp| @AX| @@ 88pKb8H M`,A8bH M`,A8bH M`,A8bH M`,A8bH M`,Ah8bH M`,AKj\KH,>A;@.8.~H NA(a|}yNA48~H KEA((#A`ațC.=@~H KA((#A@8Ĉ},#AD;;`````!H K)A(|}ٮ;{;|}خ,#@y@4@aK`8}H JA((#@t; 8x8pccHaA(H@8~8x&|"hH)A(cK=P|=@AX|=@@b`8bh8pK<8. 8x;p8ccHA(H@8~8x&|"hH}A(cKבP|=@AdX|=@@dKTa:d`t, A<``!H L5A(,A, @|t::,#@uH IA(aT`>,@Kg<`8B?| @Kg, @ acH I=A(@ddK^8b8x8pH}A(8b8cx&|HMA(8bKaPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bKPbp| @AX| @@ 88pK8b8x8pH}A(8b8cx&|HMA(8bKaPbp| @AX| @@ 88pKa:t`s, A<:@```!H GAA(|s:Rt:|s,#@a8TbH Hy`,@, @a8TbH HI`,@8a@K\8\bH H!`,@8a@K\\8dbH G`,@8a@K\4bH FA(@dK\8b8x8pHA(8b8cx&|HA(8bKӱPbp| @AX| @@ 888b8x8pHMA(8b8cx&|H%A(8bK9Pbp| @AX| @@ 88pKlb8\H F`,AD8dbH F`,A,:, A@```!H GA(,Ah, @`u::,#@acH DA(aT`>,@Kc,'@Kb,@KK8b8x8pH A(8b8cx&|HA(8bKPbp| @AX| @@ 88pK8acauH FA(,@, .AKb,:ad,#AH:````!H FEA(,At,Alu::,#@, @DacH EA( a@!#@Ka$@KaKX8b8x8pHA(8b8cx&|HmA(8bKЁPbp| @AX| @@ 888b8x8pHA(8b8cx&|HA(8bK Pbp| @AX| @@ 88pK8b8x8pHA(8b8cx&|HmA(8bKρPbp| @AX| @@ 88pK,a;}`{, A<;```!H A9A(|{;};|{,#@a8McH B`,@T, @@acKV; 8x8pccHaA(H@8}x&|"H-A(cKAP| @AX| @@b`8h8 8x;p8ccHA(H@8~x&|"HA(cK͵P| @AX| @@b`8bh8pKc8MH A1`,A8McH A`,AK]K|a;d`}, A<``!H BA(,A, @};;,#@~H ?QA(aT`>,@K]h<`8cB?|@K]T, @ acH ? A(@dKTx; 8x8pccHAA(H@8}x&|"H A(cK!P| @AX| @@b`8h8 8x;p8ccHA(H@8~x&|"HA(cK˕P| @AX| @@b`8bh8pK; 8x8pccHA(H@8~x&|"HA(cKP| @AX| @@b`8bh8pK,>Ah8~Ĉ{,#A@;;```!H A(|~yaA8~8:H >A(|}yA|>@A؈, RA, BA, HA , G@~,#:A$,#AA,#SA,#RA ,#D@$|P,ATcH =A(,@<,>AA4,>IA,,>PA$,>XA,>DA,>SA ,>Y@,cH =A(,@,>AA,>DA; 8x8pccH5A(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pK,@KWh<`8cB?|@KWT, @ acH 9 A(@dhKNx; 8x8pccHAA(H@8}x&|"H A(cK!P| @AX| @@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKŕP| @AX| @@b`8bh8pK; 8x8pccHA(H@8~x&|"HA(cKP| @AX| @@b`8bh8pKa;d`}, AH`````!H 9uA(,A, @};;,#@~H 6A(aT`>,@KT,'@KT̀,@Kd, @ acH 6uA(@d`KK; 8x8pccHA(H@8}x&|"HuA(cKÉP| @AX| @@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKP| @AX| @@b`8bh8pK; 8x8pccHA(H@8~x&|"HMA(cKaP| @AX| @@b`8bh8pKa;d`}, A@```!H 6A(,A, @};;,#@~H 41A(aT`>,@KRH,'@KR<~H 4A(@dP, @KId|y8~Ĉ{,#A8;;`!H 3iA(|{;~;|{,#@cc8:H 6UA(,#aA@cH 5A(,A,y@x@acXKH; 8x8pccHA(H@8~x&|"HMA(cKaP| @AX| @@b`8bh8pKP; 8x8pccHA(H@8~x&|"HA(cKP| @AX| @@b`8bh8pKa;}`{, A<;```!H 1yA(|{;};|{,#@a8cH 2`,@, @a8cH 2`,@8a@LKF8McH 2`,@8a@LKF8McH 2Y`,@8a@LKFpcH 0A(@dLKFX; 8x8pccH!A(H@8}x&|"HA(cKP| @AX| @@b`8h8 8x;p8ccHA(H@8~x&|"HaA(cKuP| @AX| @@b`8bh8pKDc8MH 0`,A8McH 0`,A~,#-A08a|d(,#A<*`!H 1A(,AX, @P~;;,#@acH /A(aT`>,@KM(,'@KMKh; 8x8pccH-A(H@8~x&|"HA(cK P| @AX| @@b`8bh8pK4H 0A(,A8Kaca~H -A(~ac, PA, RAKL accH 0YA(,@,>.AKKac, .A\;ad,#A<;`!H 0A(,A,A~;;,#@, @4@dBd8cH /YA(>DKB; 8x8pccHaA(H@8}x&|"H-A(cKAP| @AX| @@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKP| @AX| @@b`8bh8pK; 8x8pccH9A(H@8~x&|"HA(cKP| @AX| @@b`8bh8pKcH -A(,@KIpK;}`{, A8;``!H *A(|{;};|{,#@a8McH ,`,@p, @8a@,@AK@ cAK?; 8x8pccHA(H@8}x&|"HA(cKP|<@AX|<@@b`8h8 8x;p8ccH1A(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pKc8M$H *`,A8M(cH *}`,Ah8M,cH *e`,AP8McH *M`,A88M0cH *5`,A 8M4cH *`,A8M8cH *`,A8McH )`,A8MA;@.8.~H *MA(a|}yNA48~H &A((#AXațC.=@~H &A((#A@x8Ĉ},#A<;;```!H &A(|}ٮ;{;|}خ,#@y@<@a8K<,8}H & A((#@|; 8x8pccHA(H@8~8x&|"hHA(cKP|=@AX|=@@b`8bh8pK<8. 8x;p8ccH5A(H@8~8x&|"hHA(cKP|=@AdX|=@@dKTa,>APbH;Xbp;@:"@ :`h~ @8Ĉt,#A@:`:@```!H $A(|t:R:s|t,#@a8:```!:s-A48}: ,AA8,T,2@A,AAt,@ ,2@H,A,@ ,2@@P,2AH,2PA ,2R@tTbCH &A(,,.@@TtH &yA(,A@A:QK$y@a@a0K908x8b8pAQHA(8b8cx&| *HA(8bKAp|<@@pKhAA;@.8.~H #A(a|}yNA48~H uA((#A`ațC.=@~H MA((#A@8Ĉ},#AD;;`````!H YA(|}ٮ;{;|}خ,#@y@4@a(K48}H A((#@t; 8x8pccHܑA(H@8~8x&|"hHYA(cKmP| @AX| @@b`8bh8pK<8. 8x;p8ccHA(H@8~8x&|"hHۭA(cKP| @AdX| @@dKT,>A|~ccH aA((#Ax8{,#A@;;```!H yA(|{;~;|{,#@y@@a K2; 8x8pccHA(H@8~8x&|"`HڍA(cKP|=@AX|=@@b`8bh8pKPa;d`}, A@```!H %A(,A, @};;,#@~H qA(aTc>,@K:<;`|@K:t, @ acH -A(@dK1; 8x8pccHaA(H@8}x&|"H-A(cKAP| @AX| @@b`8h8 8x;p8ccHA(H@8~x&|"HءA(cKP| @AX| @@b`8bh8pK; 8x8pccH9A(H@8~x&|"HA(cKP| @AX| @@b`8bh8pK8uacH +aA( !@KUDMp@KU4a8 H Y`,@T, @acH A(a@8 #cH `,@a@H#28 cH `,@a@Mx#28 cH `,@M|a@#2K.c8 H `,AK.M|a@#2K.c8 H Q`,@Klc8 H 5`,@8K ; 8x8pccH!A(H@8}x&|"HA(cKP|<@AX|<@@b`8h8 8x;p8ccHՍA(H@8~x&|"HaA(cKuP|=@AX|=@@b`8bh8pKa8 H `,A8 aH `,A8 aH `,Al8 aH `,AT8 aH `,A<; 8xp8ccHԁA(H@8~x&|"HMA(cKaP|=@AX|=@@b`88@8xh"H8p8bcx&|HA(8bKP|>@@K5 KQa,>A ;.Mp;:8:~H A(a8,#A(|# @A8.~H A(a|{y@.;@~H 9A((#ATA8{H !A((#AA;@.8.~H A(a|}yNA48~H aA((#A\ațC.=@~H 9A((#A@|8Ĉ},#A@;;````!H IA(|}ٮ;{;|}خ,#@y@8@aK%8}H A((#@x; 8x8pccH́A(H@8~8x&|"hHIA(cK]P|=@AX|=@@b`8bh8pK<8. 8x;p8ccHA(H@8~8x&|"hH̝A(cKP|=@AdX|=@@dKTa,>A;@.8.~H A(a|}yNA48~H %A((#A`ațC.=@~H A((#A@8Ĉ},#AD;;`````!H  A(|}ٮ;{;|}خ,#@y@4@aK#8}H iA((#@t; 8x8pccHAA(H@8~8x&|"hH A(cKP| @AX| @@b`8bh8pK<8. 8x;p8ccHʕA(H@8~8x&|"hH]A(cKqP| @AdX| @@dKT,>A|~ccH A((#Ax8{,#A@;;```!H )A(|{;~;|{,#@y@@aK!; 8x8pccHuA(H@8~8x&|"`H=A(cKQP|=@AX|=@@b`8bh8pKPyA,`!~H A((#A(y@@aK ; 8x8pccHȉA(H@8}8x&|"`HUA(cKiP|<@AX|<@@b`8bh8pKTyA4```!~H A((#A(y@@aK; 8x8pccHǙA(H@8}8x&|"`HeA(cKyP|<@AX|<@@b`8bh8pKT;d`}, A<``!H A(,A, @};;,#@~H QA(aT`>,@KDP<`8cB?|@KD<, @ acH A(@dKx; 8x8pccHAA(H@8}x&|"H A(cK!P|<@AX|<@@b`8h8 8x;p8ccHŭA(H@8~x&|"HŁA(cKP|=@AX|=@@b`8bh8pK; 8x8pccHA(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pK;d`}, A<``!H A(,A, @};;,#@~H A(aT`>,@KA<`8cB?|@KA, @ acH A(@dK; 8x8pccHA(H@8}x&|"HÍA(cKP|<@AX|<@@b`8h8 8x;p8ccH-A(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pK; 8x8pccH™A(H@8~x&|"HeA(cKyP|=@AX|=@@b`8bh8pK;d`}, A<``!H A(,A, @};;,#@~H QA(aT`>,@K?P<`8cB?|@K?<, @ acH  A(@dKx; 8x8pccHAA(H@8}x&|"H A(cK!P|<@AX|<@@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pK; 8x8pccHA(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pK;d`}, A<``!H A(,A, @};;,#@~H A(aT`>,@K<<`8cB?|@K<, @ acH A(@dK; 8x8pccHA(H@8}x&|"HA(cKP|<@AX|<@@b`8h8 8x;p8ccH-A(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pK; 8x8pccHA(H@8~x&|"HeA(cKyP|=@AX|=@@b`8bh8pK;d`}, A<``!H A(,A, @};;,#@~HQA(aT`>,@K:P<`8cB?|@K:<, @ acH A(@dKx; 8x8pccHAA(H@8}x&|"H A(cK!P|<@AX|<@@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pK; 8x8pccHA(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pK;d`}, A<``!HA(,A, @};;,#@~HA(aT`>,@K7<`8cB?|@K7, @ acHA(@dK; 8x8pccHA(H@8}x&|"HA(cKP|<@AX|<@@b`8h8 8x;p8ccH-A(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pK; 8x8pccHA(H@8~x&|"HeA(cKyP|=@AX|=@@b`8bh8pK;d`}, A<``!HA(,A, @};;,#@~HQA(aT`>,@K5P<`8cB?|@K5<, @ acH A(@dKx; 8x8pccHAA(H@8}x&|"H A(cK!P|<@AX|<@@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pK; 8x8pccHA(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pKa;d`}, AH`````!HuA(,A, @};;,#@~HA(aT`>,@K<`8cB?|@K, @ acH}A(@dK ; 8x8pccHA(H@8}x&|"H}A(cKP| @AX| @@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKP| @AX| @@b`8bh8pK; 8x8pccHA(H@8~x&|"HUA(cKiP| @AX| @@b`8bh8pK;d`}, A<``!HA(,A, @};;,#@~HAA(aT`>,@K0@<`8cB?|@K0,, @ acHA(@dK h; 8x8pccH1A(H@8}x&|"HA(cKP|<@AX|<@@b`8h8 8x;p8ccHA(H@8~x&|"HqA(cKP|=@AX|=@@b`8bh8pK; 8x8pccH A(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pK;d`}, A<``!HuA(,A, @};;,#@~HA(aT`>,@K-<`8cB?|@K-, @ acH}A(@dK; 8x8pccHA(H@8}x&|"H}A(cKP|<@AX|<@@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pK; 8x8pccHA(H@8~x&|"HUA(cK~iP|=@AX|=@@b`8bh8pK;d`}, A<``!HA(,A, @};;,#@~HAA(aT`>,@K+@<`8cB?|@K+,, @ acHA(@dKh; 8x8pccH1A(H@8}x&|"HA(cK}P|<@AX|<@@b`8h8 8x;p8ccHA(H@8~x&|"HqA(cK|P|=@AX|=@@b`8bh8pK; 8x8pccH A(H@8~x&|"HA(cK{P|=@AX|=@@b`8bh8pK;d`}, A<``!HuA(,A, @};;,#@~HA(aT`>,@K(<`8cB?|@K(, @ acH}A(@dK; 8x8pccHA(H@8}x&|"H}A(cKzP|<@AX|<@@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKzP|=@AX|=@@b`8bh8pK; 8x8pccHA(H@8~x&|"HUA(cKyiP|=@AX|=@@b`8bh8pK;d`}, A<``!HA(,A, @};;,#@~HAA(aT`>,@K&@<`8cB?|@K&,, @ acHA(@dKh; 8x8pccH1A(H@8}x&|"HA(cKxP|<@AX|<@@b`8h8 8x;p8ccHA(H@8~x&|"HqA(cKwP|=@AX|=@@b`8bh8pK; 8x8pccH A(H@8~x&|"HA(cKvP|=@AX|=@@b`8bh8pK,>Ax~ccHmA((#At8{,#A<;;``!HA(|{;~;|{,#@y@@aK ; 8x8pccHA(H@8~8x&|"`HA(cKuP|=@AX|=@@b`8bh8pKP,>A;@.8.~HA(a|}yNA48~H A((#AXațC.=@~HA((#A@x8Ĉ},#A<;;```!HA(|}ٮ;{;|}خ,#@y@<@aK|8}HYA((#@|; 8x8pccH1A(H@8~8x&|"hHA(cKt P|=@AX|=@@b`8bh8pK<8. 8x;p8ccHA(H@8~8x&|"hHMA(cKsaP|=@AdX|=@@dKT,>A|~ccHA((#Ax8{,#A@;;```!HA(|{;~;|{,#@y@@aK; 8x8pccHeA(H@8~8x&|"`H-A(cKrAP|=@AX|=@@b`8bh8pKPa,>AbH;:p;c8~;Ĉc,#AD;@;$``!HA(;Zy;9~;|cЮ,#@ܓ8ba; ;`z::::|!:`:@``!;9,~ &~( A 8:~,A $,5A ,A A8Aȉ,.@$,@,5A ,A,.A,5@ ,A,A ,@`,8@H,7A,@H,.A@,3A,7@,6A,4A ,.AdcCHeA((#AH,@,,.A$,3AcC8 H`,@~( @(,.A ,2ATcCH A((#2A@A;PAKy@$!@aK8x8b8pAB HA(@8b8cx&| *HyA(8bKnP|7@ApbX|#@@8b`8bhpKDcC8 H`,A8 cCH`,A8MhcCH`,A8PcCH`,A8PcCH`,A8PcCH`,At8MjcCHu`,A\A8xB 88bpHeA(@8b8cx&| *H9A(8bKmMP|7@AKAKAKaHA(,AKlAtKlcC8OH`,A8OcCH`,A8PcCH`,A8PcCHy`,A8PcCHa`,A8P cCHI`,Ap8PcCH1`,@TKTcC8MH`,A 8OcCH`,A8McCH`,AAxKpcC8OH`,A8MfcCH߭`,AA@K8A8K0cC8OH߅`,@XKPcC8OHi`-8OlcCHU`@X-AcC8OH9`,A8OcCH!`,A8OcCH `,@KcC8OH`-8OlcCH`@-AKcC8OH޹`-8OlcCHޥ`@-@TKdcC8OlHޅ`-A8OcCHm`,A8OcCHU`,A8OcCH=`,@ AKAKcC8MH`-8McCH`@-:`@ :@KcC8N@H`,A8N|cCH`,A8NcCHݩ`,A8O cCHݑ`,A8OHcCHy`,@ :@KcC8MHY`-8McCHE`@\-MsA@cC8N@H%`,A(8O cCH `,A8OHcCH`,@KcC8MH`-8McCH`@-MsAKcC8MHܡ`-8McCH܍`@-MsAKHcC8MHi`-A8McCHQ`,A8NcCH9`,A8NcCH!`,A8N0cCH `,A8N@cCH`,Ah8NTcCH`,AP8NhcCH`,A88N|cCH۩`,A 8NcCHۑ`,A8NcCHy`,A8NcCHa`,A8NcCHI`,A8NcCH1`,A8NcCH`,A8O cCH`,Ax8OcCH`,A`8O4cCH`,AH8OHcCHڹ`,A0ALKDcC8MHڙ`-8McCHڅ``ocC8MHq`@0-,;{ @:z @::`KcC8MH1`-8McCH`@,@KcC8MH`,8McC}&H`} AcC8MH`,AA`KX8xB 88bpHA(@8b8cx&| *HA(8bKePX|7@|@LB0BA,KcC8:HA(|pyNa@hKHaca, @@aK,; 8x8pccHA(@8~Hx&|"HA(cKdP| @AX| @@b`8h8 8x;p8ccH]A(H@8~x&|"H1A(cKdEP| @AX| @@b`8bh8pKaca, @@a0K; 8x8pccHA(@8~Hx&|"HeA(cKcyP| @AX| @@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKbP| @AX| @@b`8bh8pKaca, @@a(K|; 8x8pccHEA(@8~Hx&|"H A(cKb!P| @AX| @@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKaP| @AX| @@b`8bh8pKa;}`{, A<;```!HqA(|{;};|{,#@a8DcHԩ`,@P, @@aK; 8x8pccHuA(H@8}x&|"HAA(cK`UP| @AX| @@b`8h8 8x;p8ccHA(H@8~x&|"HA(cK_P| @AX| @@b`8bh8pKc8HE`,AKKa;}`{, A@;````!HсA(|{;};|{,#@a8DcHҹ`,@P, @@aK; 8x8pccHA(H@8}x&|"HQA(cK^eP| @AX| @@b`8h8 8x;p8ccHA(H@8~x&|"HA(cK]P| @AX| @@b`8bh8pKc8HU`,AK,Ka,>A;:8:~HҝA(a8,#A>c#H A((#A8y,#A<;`;@``!H)A(|yѮ;Z>;{|yЮ,#@a8@ața8cH A(a,#A;y@<, A@a Kp; 8x8pccH9A(H@8~8 x&|"H A(cK\P| @AX| @@b`8bh8pKX; 8x8pccHA(H@8~x&|"HmA(cK[P| @AX| @@b`8bh8pK8: 8x;p8ccHA(H@8~x&|"HA(cKZP| @AhXbp| @@dKT; 8x8pccHuA(H@8~x&|"HAA(cKZUP| @AK|aca, @@aK ; 8x8pccHA(@8~Hx&|"HA(cKYP| @AX| @@b`8h8 8x;p8ccH=A(H@8~x&|"HA(cKY%P| @AX| @@b`8bh8pKyA0``!~HʥA((#A(y@@aK; 8x8pccHYA(H@8}8x&|"`H%A(cKX9P|<@AX|<@@b`8bh8pKT;}`{, AD;`````!HA(|{;};|{,#@a8PcHI`,@P, @@aKL; 8x8pccHA(H@8}x&|"HA(cKVP|<@AX|<@@b`8h8 8x;p8ccHA(H@8~x&|"HUA(cKViP|=@AX|=@@b`8bh8pKc8P$H`,A8P,cH`,A8P4cHɵ`,AKtKh;}`{, AD;`````!HA(|{;};|{,#@a8P<cH)`,@P, @@aK,; 8x8pccHA(H@8}x&|"HA(cKTP|<@AX|<@@b`8h8 8x;p8ccHaA(H@8~x&|"H5A(cKTIP|=@AX|=@@b`8bh8pKc8PHH`,A8PTcHǭ`,A8P`cHǕ`,AKTKhua, @@aKی; 8x8pccHUA(@8~Hx&|"HA(cKS1P|=@AX|=@@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKRP|=@AX|=@@b`8bh8pKua, @@aK8; 8x8pccHA(@8~Hx&|"HA(cKQP|=@AX|=@@b`8h8 8x;p8ccHiA(H@8~x&|"H=A(cKQQP|=@AX|=@@b`8bh8pKua, @@aK; 8x8pccHA(@8~Hx&|"HuA(cKPP|=@AX|=@@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKOP|=@AX|=@@b`8bh8pKua, @@aKא; 8x8pccHYA(@8~Hx&|"H!A(cKO5P|=@AX|=@@b`8h8 8x;p8ccH~A(H@8~x&|"H~A(cKNP|=@AX|=@@b`8bh8pKaca, @@aK8; 8x8pccH~A(@8~Hx&|"H}A(cKMP| @AX| @@b`8h8 8x;p8ccH}iA(H@8~x&|"H}=A(cKMQP| @AX| @@b`8bh8pKaca, @@aK; 8x8pccH|A(@8~Hx&|"H|qA(cKLP| @AX| @@b`8h8 8x;p8ccH|A(H@8~x&|"H{A(cKKP| @AX| @@b`8bh8pKa;d`}, AH`````!HuA(,A, @};;,#@~HA(aT`>,@K<`8cB?|@K, @ acH}A(@dK; 8x8pccHzA(H@8}x&|"Hz}A(cKJP| @AX| @@b`8h8 8x;p8ccHzA(H@8~x&|"HyA(cKJP| @AX| @@b`8bh8pK; 8x8pccHyA(H@8~x&|"HyUA(cKIiP| @AX| @@b`8bh8pKa;8PhcH`,AP, ADc```!HA(,A, @̈~;;,#@~H!A(aT`>,@K8<`8cB?|@K$, @HacHA(a@T`>,dAK88b8ȘjK ; 8x8pccHwA(H@8}x&|"HwA(cKGP| @AX| @@b`8h8 8x;p8ccHwUA(H@8~x&|"Hw)A(cKG=P| @AX| @@b`8bh8pK; 8x8pccHvA(H@8~x&|"HvA(cKFP| @AX| @@b`8bh8pK,>A~ccH%A((# A|8{,#AD;;````!H9A(|{;~;|{,#@y@@aKͼ; 8x8pccHuA(H@8~8 x&|"`HuMA(cKEaP|=@AX|=@@b`8bh8pKP,>A~ccHA((# A|8{,#AD;;````!HA(|{;~;|{,#@y@@aK|; 8x8pccHtEA(H@8~8 x&|"`Ht A(cKD!P|=@AX|=@@b`8bh8pKP@aK@aK˴@aKˠ@aKˌ@aKx@aKd;d`}, A<``!H5A(,A(, @ };;,#@|HA(aT`>,@K,'@Kt,AT, @ acH9A(@dpKʤ; 8x8pccHrmA(H@8~x&|"Hr9A(cKBMP|=@AX|=@@b`8h8 8x;p8ccHqA(H@8~x&|"HqA(cKAP|=@AX|=@@b`8bh8pK; 8x8pccHqEA(H@8}c8x&|"HqA(cKA%P|<@@KP| @AX| @@b`8h8 8x;p8ccHnA(H@8~x&|"HmA(cK>P| @AX| @@b`8bh8pKa8 H`,A8 aHi`,A8 aHQ`,Al8 aH9`,AT8 aH!`,A<; 8xp8ccHmA(H@8~x&|"HlA(cK<P| @AX| @@b`88@8xh"H8p8bcx&|HlqA(8bK<P| @@K͜K͈a8cacHA(Pl!@KMp@Ka8 H`,@T, @acHA(a@8 #tcH`,@a@H#t2t8 cHq`,@a@Mx#t2t8 cHA`,@M|a@#t2tKPc8 H`,AK4M|a@#t2tKc8 H`,@Klc8 H`,@8K ; 8x8pccHjA(H@8}x&|"HjyA(cK:P| @AX| @@b`8h8 8x;p8ccHjA(H@8~x&|"HiA(cK:P| @AX| @@b`8bh8pKa8 H}`,A8 aHe`,A8 aHM`,Al8 aH5`,AT8 aH`,A<; 8xp8ccHi A(H@8~x&|"HhA(cK8P| @A X| @@ K;}`{, AD;`````!HA(|{;};|{,#@a8DcH`,@P, @@aPK; 8x8pccHgA(H@8}x&|"HgA(cK7P|<@AX|<@@b`8h8 8x;p8ccHgQA(H@8~x&|"Hg%A(cK79P|=@AX|=@@b`8bh8pKc8H`,AKtK;d`}, A<``!HA(,A, @};;,#@~HA(aT`>,AK<`|@K, @ acHA(@dHK; 8x8pccHeA(H@8}x&|"HeA(cK5P|<@AX|<@@b`8h8 8x;p8ccHeQA(H@8~x&|"He%A(cK59P|=@AX|=@@b`8bh8pK; 8x8pccHdA(H@8~x&|"HdA(cK4P|=@AX|=@@b`8bh8pKaca, @@a@K,; 8x8pccHcA(@8~Hx&|"HcA(cK3P| @AX| @@b`8h8 8x;p8ccHc]A(H@8~x&|"Hc1A(cK3EP| @AX| @@b`8bh8pKaca, @@a8K; 8x8pccHbA(@8~Hx&|"HbeA(cK2yP| @AX| @@b`8h8 8x;p8ccHbA(H@8~x&|"HaA(cK1P| @AX| @@b`8bh8pKaca, @@a0K|; 8x8pccHaEA(@8~Hx&|"Ha A(cK1!P| @AX| @@b`8h8 8x;p8ccH`A(H@8~x&|"H`A(cK0P| @AX| @@b`8bh8pKaca, @@a(K$; 8x8pccH_A(@8~Hx&|"H_A(cK/P| @AX| @@b`8h8 8x;p8ccH_UA(H@8~x&|"H_)A(cK/=P| @AX| @@b`8bh8pKaca, @@a K; 8x8pccH^A(@8~Hx&|"H^]A(cK.qP| @AX| @@b`8h8 8x;p8ccH]A(H@8~x&|"H]A(cK-P| @AX| @@b`8bh8pKaca, @@aKt; 8x8pccH]=A(@8~Hx&|"H]A(cK-P| @AX| @@b`8h8 8x;p8ccH\A(H@8~x&|"H\yA(cK,P| @AX| @@b`8bh8pKaca, @@aK; 8x8pccH[A(@8~Hx&|"H[A(cK+P| @AX| @@b`8h8 8x;p8ccH[MA(H@8~x&|"H[!A(cK+5P| @AX| @@b`8bh8pKaca, @@aK; 8x8pccHZA(@8~Hx&|"HZUA(cK*iP| @AX| @@b`8h8 8x;p8ccHYA(H@8~x&|"HYA(cK)P| @AX| @@b`8bh8pKaca, @@aKl; 8x8pccHY5A(@8~Hx&|"HXA(cK)P| @AX| @@b`8h8 8x;p8ccHXA(H@8~x&|"HXqA(cK(P| @AX| @@b`8bh8pKaca, @@aK; 8x8pccHWA(@8~Hx&|"HWA(cK'P| @AX| @@b`8h8 8x;p8ccHWEA(H@8~x&|"HWA(cK'-P| @AX| @@b`8bh8pKua, @@aK; 8x8pccHVA(@8~Hx&|"HVQA(cK&eP|=@AX|=@@b`8h8 8x;p8ccHUA(H@8~x&|"HUA(cK%P|=@AX|=@@b`8bh8pKua, @@axKl; 8x8pccHU5A(@8~Hx&|"HTA(cK%P|=@AX|=@@b`8h8 8x;p8ccHTA(H@8~x&|"HTqA(cK$P|=@AX|=@@b`8bh8pKua, @@apK; 8x8pccHSA(@8~Hx&|"HSA(cK#P|=@AX|=@@b`8h8 8x;p8ccHSIA(H@8~x&|"HSA(cK#1P|=@AX|=@@b`8bh8pKua, @@ahK; 8x8pccHRA(@8~Hx&|"HRUA(cK"iP|=@AX|=@@b`8h8 8x;p8ccHQA(H@8~x&|"HQA(cK!P|=@AX|=@@b`8bh8pK;}`{, A8;``!HA(|{;};|{,#@a8DcH`,@P, @@a`K; 8x8pccHPA(H@8}x&|"HPA(cK P|<@AX|<@@b`8h8 8x;p8ccHP1A(H@8~x&|"HPA(cK P|=@AX|=@@b`8bh8pKc8H`,AKTKua, @@aXK; 8x8pccHOUA(@8~Hx&|"HOA(cK1P|=@AX|=@@b`8h8 8x;p8ccHNA(H@8~x&|"HNA(cKP|=@AX|=@@b`8bh8pKua, @@aPK8; 8x8pccHNA(@8~Hx&|"HMA(cKP|=@AX|=@@b`8h8 8x;p8ccHMiA(H@8~x&|"HM=A(cKQP|=@AX|=@@b`8bh8pKua, @@aHK; 8x8pccHLA(@8~Hx&|"HLuA(cKP|=@AX|=@@b`8h8 8x;p8ccHLA(H@8~x&|"HKA(cKP|=@AX|=@@b`8bh8pK8 uacHA(a,#A8$acHA(a,#@@, AP, @@a@KD; 8x8pccHK A(H@8}x&|"HJA(cKP|<@AX|<@@b`8h8 8x;p8ccHJyA(H@8~x&|"HJMA(cKaP|=@AX|=@@b`8bh8pK; 8x8pccHIA(H@8~x&|"HIA(cKP|=@AX|=@@b`88@8xh"H8p8bcx&|HIEA(8bKYP|>@@KpKD8$8`HuA(aK; 8x8pccHHA(H@8~x&|"@HHA(cKP|=@ApbX| @@b`8bh8K8 uacHA(a,#A@8$acHA(a,#@, AP, @@a8K; 8x8pccHGA(H@8}x&|"HGA(cKP|<@AX|<@@b`8h8 8x;p8ccHGEA(H@8~x&|"HGA(cK-P|=@AX|=@@b`8bh8pK; 8x8pccHFA(H@8~x&|"HF}A(cKP|=@AX|=@@K8$8`HA(,#aA8$8`HA(aK; 8x8pccHEA(H@8~x&|"@HEA(cKP|=@A K a8 cacHA(a,#A8$acHA(a,#@@, AP, @@ahK@; 8x8pccHE A(H@8}x&|"HDA(cKP| @AX| @@b`8h8 8x;p8ccHDuA(H@8~x&|"HDIA(cK]P| @AX| @@b`8bh8pK; 8x8pccHCA(H@8~x&|"HCA(cKP| @AX| @@b`88@8xh"H8p8bcx&|HCAA(8bKUP| @@KlKX8$8`HqA(aK; 8x8pccHBA(H@8~x&|"@HBA(cKP| @AX| @@Ka8 cacHA(a,#Ad8$|HA(a,#AL, @@a`K4; 8x8pccHAA(H@8~x&|"HAA(cKP| @AX| @@b`8h8 8x;p8ccHAiA(H@8~x&|"HA=A(cKQP| @AX| @@b`8bh8pK; 8x8pccH@A(H@8~x&|"H@A(cKP| @AX| @@Ka8 cacHA(a,#A8$|HA(a,#AL, @@aXK(; 8x8pccH?A(H@8~x&|"H?A(cKP| @AX| @@b`8h8 8x;p8ccH?]A(H@8~x&|"H?1A(cKEP| @AX| @@b`8bh8pK; 8x8pccH>A(H@8~x&|"H>A(cKP| @AX| @@K; 8x8pccH>MA(H@8~x&|"@H>!A(cK5P| @AX| @@Kp8 uacHIA(a,#A8$|H)A(a,#AL, @@aHK; 8x8pccH=qA(H@8~x&|"H==A(cK QP|=@AX|=@@b`8h8 8x;p8ccH,@K,@K, @$acHo}A(a@dK; 8x8pccH,A(H@8}x&|"H,yA(cKP| @AX| @@b`8h8 8x;p8ccH,A(H@8~x&|"H+A(cKP| @AX| @@b`8bh8pK; 8x8pccH+A(H@8~x&|"H+MA(cKaP| @AX| @@b`8bh8pK;d`}, AL````!HoA(,``A, @;Ĉ};,#@А~Hm)A(aTc>,@K(<`|@K, @$acHlA(a @dKL; 8x8pccH*A(H@8}x&|"H)A(cKP|<@AX|<@@b`8h8 8x;p8ccH)A(H@8~x&|"H)UA(cKiP|=@AX|=@@b`8bh8pK; 8x8pccH(A(H@8~x&|"H(A(cKP|=@AX|=@@b`8bh8pK;d`}, AD``!HmUA(,``A, @;Ĉ};,#@А~HjA(aT`>,@K<`8cB?|@K, @$acHjUA(a@dK; 8x8pccH'A(H@8}x&|"H'QA(cKeP|<@AX|<@@b`8h8 8x;p8ccH&A(H@8~x&|"H&A(cKP|=@AX|=@@b`8bh8pK; 8x8pccH&YA(H@8~x&|"H&%A(cK9P|=@AX|=@@b`8bh8pK;d`}, AD``!HjA(,``A, @;Ĉ};,#@А~Hh A(aT`>,@K<`8cB?|@K, @$acHgA(a@dK},; 8x8pccH$A(H@8}x&|"H$A(cKP|<@AX|<@@b`8h8 8x;p8ccH$aA(H@8~x&|"H$5A(cKIP|=@AX|=@@b`8bh8pK; 8x8pccH#A(H@8~x&|"H#A(cKP|=@AX|=@@b`8bh8pK;d`}, AD``!Hh5A(,``A, @;Ĉ};,#@А~HeyA(aT`>,@Kx,'@Kl, @$acHe=A(a@d Kz; 8x8pccH"mA(H@8}x&|"H"9A(cKMP|<@AX|<@@b`8h8 8x;p8ccH!A(H@8~x&|"H!A(cKP|=@AX|=@@b`8bh8pK; 8x8pccH!AA(H@8~x&|"H! A(cK!P|=@AX|=@@b`8bh8pKa;d`}, AH```!HeA(,``A, @;Ĉ};,#@А~HbA(aTc>,@K<`|@K, @$acHbA(a@dKx ; 8x8pccHA(H@8}x&|"HA(cKP|<@AX|<@@b`8h8 8x;p8ccHAA(H@8~x&|"HA(cK)P|=@AX|=@@b`8bh8pK; 8x8pccHA(H@8~x&|"HuA(cKP|=@AX|=@@b`8bh8pKa;d`}, AP`````!HcA(,``A, @;Ĉ};,#@А~H`IA(aTc>,@KH<`|@K4, @$acH`A(a @dKul; 8x8pccH5A(H@8}x&|"HA(cKP|<@AX|<@@b`8h8 8x;p8ccHA(H@8~x&|"HuA(cKP|=@AX|=@@b`8bh8pK; 8x8pccH A(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pKa;d`}, AP`````!H`eA(,``A, @;Ĉ};,#@А~H]A(aT`>,AK,'@K, @$acH]mA(a$@dKr; 8x8pccHA(H@8}x&|"HiA(cK}P|<@AX|<@@b`8h8 8x;p8ccH A(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pK; 8x8pccHqA(H@8~x&|"H=A(cKQP|=@AX|=@@b`8bh8pKa;d`}, AH```!H]A(,``A, @;Ĉ};,#@А~H[A(aT`>,AK<`|@K, @$acHZA(a(@dKp@; 8x8pccH A(H@8}x&|"HA(cKP|<@AX|<@@b`8h8 8x;p8ccHuA(H@8~x&|"HIA(cK]P|=@AX|=@@b`8bh8pK; 8x8pccHA(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pKa;}`|, AL;``````!HXA(||ٮ;{``;||خ,#@ܘta8PcHY`,a,@, @ta~HZA(a8,A cHX1A(@a,@K(,'@K,@; 8xp8ccH=A(H@8}c8x&|"H A(cKP|<@@Kt4K; 8x8pccHA(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pKaca, @@aKj0; 8x8pccHA(@8~Hx&|"HA(cKP|=@AX|=@@b`8h8 8x;p8ccHaA(H@8~x&|"H5A(cKIP|=@AX|=@@b`8bh8pKaca, @@aKh; 8x8pccHA(@8~Hx&|"HiA(cK}P| @AX| @@b`8h8 8x;p8ccH A(H@8~x&|"HA(cKP| @AX| @@b`8bh8pKaca, @@aKg; 8x8pccHIA(@8~Hx&|"HA(cK%P|=@AX|=@@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKޙP|=@AX|=@@b`8bh8pKa8vcacHSA(a,#AP, @@aKf; 8x8pccH A(H@8}x&|"H A(cKݱP|<@AX|<@@b`8h8 8x;p8ccH =A(H@8~x&|"H A(cK%P|=@AX|=@@b`8bh8pK; 8x8pccH A(H@8~x&|"H uA(cK܉P|=@AX|=@@b`8h8 8x;p8ccH A(H@8~8Px&|"H A(cKP|=@@KmKa8vcacHQA(a,#AP, @@aKc; 8x8pccH UA(H@8}x&|"H !A(cK5P| @AX| @@b`8h8 8x;p8ccH A(H@8~x&|"H A(cKکP| @AX| @@b`8bh8pK; 8x8pccH -A(H@8~x&|"H A(cK P| @AX| @@b`8h8 8x;p8ccH A(H@8~8Px&|"H iA(cK}P| @@KjKjaca, @@aKa0; 8x8pccHA(@8~Hx&|"HA(cKP|=@AX|=@@b`8h8 8x;p8ccHaA(H@8~x&|"H5A(cKIP|=@AX|=@@b`8bh8pKaca, @@aK_; 8x8pccHA(@8~Hx&|"HiA(cK}P|=@AX|=@@b`8h8 8x;p8ccH A(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pKa;}`|, A@;```!HHA(||ٮ;{``;||خ,#@ܘua89cHJ`,aD@P, @@aK^; 8x8pccHA(H@8}x&|"HA(cKթP|<@AX|<@@b`8h8 8x;p8ccH5A(H@8~x&|"H A(cKP|=@AX|=@@b`8bh8pKc89 HH`,aHAKTKa;}`|, AH;`````!HFA(||ٮ;{``;||خ,#@ܘva88cHH`,aL@P, @@aK\; 8x8pccHA(H@8}x&|"HA(cKөP|<@AX|<@@b`8h8 8x;p8ccH5A(H@8~x&|"H A(cKP|=@AX|=@@b`8bh8pKc88HF`,aPA88cHF}`,aTA88cHFa`,aXAKK\a;}`|, A@;```!HDA(||ٮ;{``;||خ,#@ܘwa8P$cHE`,a\@P, @@aKY; 8x8pccHA(H@8}x&|"HeA(cKyP|<@AX|<@@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pKc8PHDi`,a`A8PcHDM`,adA8PcHD1`,ahAd8(cHD`,alAH8,cHC`,apA,84cHC`,atA8PcHC`,axA8PcHC`,a|A8PcHC`,aA8PcHCm`,aAK}(Ka;}`|, AL;``````!HAA(||ٮ;{``;||خ,#@ܘxa8cHB`,a@P, @@aKV; 8x8pccHA(H@8}x&|"HeA(cKyP|<@AX|<@@b`8h8 8x;p8ccHA(H@8~x&|"HA(cKP|=@AX|=@@b`8bh8pKc8HAi`,aA8(cHAM`,aA8,cHA1`,aAd8cHA`,aAH84cH@`,aA,8PcH@`,aA8A(||ٮ;{``;||خ,#@ܘya8PcH?`,a@P, @@ahKS; 8x8pccHA(H@8}x&|"HA(cK˙P| @AX| @@b`8h8 8x;p8ccH%A(H@8~x&|"HA(cK P| @AX| @@b`8bh8pKc8H>`,aA8DcH>m`,aA8$cH>Q`,aAKK\a;}`|, A@;```!HbC88 HiA(,@K6,|xc$, ~]*@bqHUA(bD88cKI`sadsH)`!QA,2Atb``!rHA(88cx$| *Ks`scH`bR~@y@aA!QK5DQK5<8bqH}A(bD88cKqs`saK,aH$A(,A 88bK1tb8p,$AK1b,$A4pAP , @<8, @ bpAb , @8, @8`8K2 ; 8x80ccHeA(@8~8Hx&x$|"|@* H)A(cK=P| @AX| @@b`8p0bh| @@8K<K0KiK8KKUKKMKĐK; 8x8b0ccfH}A(@8|Hx$|0*x&|"HEA(cKYP|;@AX|;@@b`8bhp|;@@8K-K-KK,8K,KuK,KmK,8K,AKK3AKK3AKK3AKK3xAKK1AKK1AKK/AKK/AKK-AKK-AKK-AK(K+AK4K+AK@K)AKLK)"C BrInitSapRead|}&aA`;!;aA!!8xa`hb,'8|xc$|*A pA , @ Kb| @ , @  8;b08xccHA(@8{Hhx&x$|"|@*HױA(ccKPb0|#@AX|#@@ b`bhp0|$@@88b, A"8yܓH-A(8c8x$| *K`z`w::```!vH]A(|d::, @a`h8HI,AD,6Alb8BHy`,@,a`h8HI,A,6A,;8ybHY``v:b.<B``!z8DH `,a`LBA8h8HII,A{86,#AH`,A8yܒHA(88cx$| *K8w`wcH`,6bAD8JHa`,Apz8DHE`,8yAbHM``vK88^bpA , @, @`bcpat 8;08xcHA(@8~8pHx&x$|"|@*@HԑA(cKPb0|#@AX|#@@ b`bhp0|$@A`, A$bpA , @lK8`88!|Aa} !AaN KMK8ap8DHӍA(z, @z8XHI`,@pz8 cHA(,#AT8 8apHqA(, A88*```!8c,$@K8ap8LH`8apHu`zc, AH8ap8LHM`8apH1`zcc, A8ap8LH`8apH`zccc, A8ap8PH`KKKLA 8;p8xccHA(H@8~x&|"HѩA(cKP|<@AX|<@@ b`bhb, ApA , @Kb| @ , @ 8;08xcH A(@88Hx&x$|"|@* HA(cKPb0|#@AX|#@@ b`bhp0|$@A`8`8KhKK4KK | @KL@  8;p8xccHA(H@8~hx&|" HA(cKP|<@AXKH|7@A,<AKa`;@h8HB,A0,$Al"8yH`a`h8HB,A{,#@| 8;p8xccH9A(H@8~hx&|" HA(cK%P|<@AxX|<@@tKh86H`,A 8;p8xccHΩA(H@8~88x&|"HyA(cKP|<@AKKKHKK | @K( C BrParamGet`aA!`aA!xpb|c8,%8D|!x$|!*A 4p`A , @ Kb| @b , @  b8;08xcH A(H@8|x$x&|0*|"HA(cKPb0|#@AX|#@@b`8bhp0|$@@8;`8`8x$ax|| *KYxc8xH 9,A ,@bx,nA,#@bc,$@ 8N8H`, A , A, A, A, Al , A@(, A0, A8, A@, Ab0C ,:A`c::T`!:9:`:@zH A(88cx$| *KaH ``q8:HEA(8:8@8cH)A(898:8cH A(,#Ap8,$:8cA`t8:HA(,#A@8,$:8cA`s8:HA(,#A8:Cb#H`,@Ј',@_Z,:@b, AdpA , @HKeb| @b , @ 8;08xcHɁA(@88Hx$|0*x&|" HMA(cKaPb0|#@AX|#@@b`8p0bh|$@Axx8`808! }px!Aa!AaN K)KK!K| @KXP_Z,:@ K\z, A88`8x$| *KA`oy8.b8/XPoOHcH`o8Y8bcH`oca8H,A0a , @  {,nAo,#@ bco($@`8N8H`o, A, At, AH, A, A , A(, A0, Al8, A@@, AZ@y@Ko88X8Hy`o@KoX88W8HY`o8Ko8V8H9`o0K|o8U8H`o(KPo8T8H`o K$o8S8H`oKo8R8H`oKo8Q8H`oKo8P8Hy`oKt8O8H]`oKLb, ApA , @Kb| @b , @ 8;08xcHA(@88Hx$|0*x&|" HA(cKPb0|#@AX|#@@b`8p0bh|$@Axx8`8K|KK8KK | @Ka8-8H `aHA(8c8x$| *K`ocH`aK88X8H`@KXX88W8H`8K,8V8Ha`0K8U8HA`(K8T8H!` K8S8H`K|8R8H`KP8Q8H`K$8P8H`K8O8H`Kb, A0pA , @K b| @b , @ 8;08xcH%A(@88Hx$|0*x&|" HA(cKPb0|#@AX|#@@ b`cp0bh|$@Axx8`08! }a8N KKKK| @KKKKK|` @K A BrInstProcessT>|}&aA`;!;aA!xph`!"8\ab,$8|xc$|*A)pAb , @(K| @b , @( 8;08xcHA(@8|Hax&x$|"|@*HA(cKPb0|#@AX|#@@ b`bhp0|$@@88|`{aHA(,#@b|@, Ab, @,A, @, A, @Ј, A, @, Az, @Al, A`8b, A4pA , @K| @b , @ 8;08xcH A(@88Hx&x$|"|@* HA(cKPb0|#@AX|#@@ b`bhp0|$@A`8`8!}aЀ8N KKKK| @K8"cfBb9pc) y)$|H*K 8c;8xcHA(bHB@8}x&|HA(cK"P|<@AX|<@@ b`bhc,#A`pAb , @@K| @b , @88b08xHA(8}8x&| x$|@*HA(8bK0| @Ab0X|#@@ b`b0|#@A`8`8x8!|} `hp!xAa!AaN KKKK| @tKbc,#ApAb , @KQ| @b , @ 8;08xcHmA(@88Hx&x$|"|@* H1A(cKEPb0|#@AX|#@@ b`bhp0|$@A`8`8KhKeK4K]K| @Ka80b,@"8ax8lH}A(b0,@!8a8lHYA(PBXpbbH" @`~<@:h}@a8pK18.ap,b`A, ATSbCHMA(|qy:bAȈr9, *,.Ax@, .AhA0`!HA(9o9s:|cp(.@8~,?`|)AH9`,@0S8`````!:1|apS|8c, @bC8H`,@`,?AXs, @tSr,#A,: `!H A(|r:1S|r,#@ , A| @@_ b, @\KP8c8b8xHQA(;p8b8cx&| *H!A(8bK5LRpBA8c8b8xHA(p:[8b8cx&| *HA(8bKA |<@@;KbC8Hi`,@D,?A`t|`yA<c``!HeQ`,tA`tc|`yA cKb88bHI``dbHd`,@Ha,5Acb8K%,A W>K;W>K8c8b8xHA(8b8cx&| HA(8bKwP|<@A |<@@;aKT,#A8utctuu|apKMK b KX8c8b8xHA(p8b8cx&|HA(8bKvP~<@A |<@@8c8b8xHA(p8b8cx&|H}A(8bKvA |<@@;KhbC8dH%`,@b, AbcK!K8c8b8xHA(p8b8cx&|@HA(8bKuP|<@A |<@@;apbcKKH, @hK,8c8b8xHaA(p8b8cx&|H1A(8bKuEP~<@A |<@@8c8b8xHA(p8b8cx&|HA(8bKtA |<@@;hKD, @L|,#A4;````!HA(||ٮ;{||خ,#@`K8c8b8xH!A(p8b8cx&|HA(8bKtP~<@A |<@@8c8b8xHA(p8b8cx&|HA(8bKsA |<@@;K, @D|,#A,;``!HyA(||ٮ;{||خ,#@XK8c8b8xHA(p8b8cx&|HA(8bKrP~<@A |<@@8c8b8xH}A(p8b8cx&|HUA(8bKriA |<@@;K, @D|,#A,;``!HIA(||ٮ;{||خ,#@PK8c8b8xHA(p8b8cx&|HA(8bKqP~<@A |<@@8c8b8xHMA(p8b8cx&|H%A(8bKq9A |<@@;K, @HK8c8b8xHA(p8b8cx&|HA(8bKpP~<@A |<@@8c8b8xHQA(p8b8cx&|H)A(8bKp=A |<@@;HKssHA(, @, Al , @( , @9, @, A<, @, A0|A0h|A, A<8c8b8xH=A(p8b8cx&|H A(8bKo!LRpBA8c8b8xHA(p8b8cx&|HA(8bKnAK(8c8b8xH}A(, @, Ax0ʀdh|@`p|g8b8cx&|`HA(8bKn1P|<@A |<@@;K0dhKsXbcH3`8s,#AK\sXbcH3}`s,#AhK,sXbcH3M`s,#A8KsXbcH3`s,#AKsXbcH2`s,#AKsXbcH2`bcH)`s,#AKTSXcCH2u`zc,#AT;;``!HA(;{t:z;|cخ,#@8`8|)HA(,#A|`P8 ||خ, "Ap, 'Ah|bH``|8 HAA(,#A$8zcH۽`K`c8 H A(,#AK8 b||*Hہ``|z|خ, "@ c8"HA(,#AKc8'HA(,#ApKd8KSXcCH0`zc,#AX;;``!HaA(;{t:z;|cخ,#@8`8|)HUA(,#AP|`P8 ||خ, "At, 'Al|bHm``|8 HA(,#A(8zcH=`Kc8 H߅A(,#AK8 b||*H``|z|خ, "@ c8"H=A(,#AK|c8'H!A(,#AlK`8KaH]A(,@,=Aܨ, Aޜ, A,?A, A, A,?Ah, A8,?AT, @Hb0c|?@@cK(88b08xHA(8b8c8x&|HA(8bKh0P| @A | @@b0|#@@cKD88b08xHaA(8b8c8x&|H5A(8bKhI0P| @A | @@b0|#@@cK8"cBb9Ȑ x $|H*KKbcaK,bcxaKKcKHKcK| @K$"C) BrInitOraRead|}&aA`;!;aA!xp!8lab,&8|xc$|*A hpAb , @ HKb݀| @b , @  8;b08xccHA(@8{Hx&x$|"|@*HA(ccKePb0|#@AX|#@@ b`bhp0|$@@8a8HA(,#@8b|@b, @, A, @Ȉ, A, @, @, A`z, ATbc,#A4pAb , @KaI| @b , @ 8;08xcHiA(@88Hx&x$|"|@* H-A(cKdAPb0|#@AX|#@@ b`bhp0|$@A`8`08! }a8N K`AKK`9K| @K8"9Bbbpcc) y)$|H*K~e 8cf;8xcH!A(BH"@8}x&|HA(cKc P|;@AX|;@@ b`hbc,#AXpAb , @8K_5| @b , @88b08xH]A(8}8x&| x$|@*H)A(8bKb=0| @Ab0X|#@@ b`b0|#@A`8`80*8! |px} !Aa!AaN K^ KK^K| @xKbc,#ApAb , @K]| @b , @ 8;08xcHA(@88Hx&x$|"|@* HA(cK`Pb0|#@AX|#@@ b`bhp0|$@A`8`8KtK\K4K\K | @KPbpaXbHB@~;@" h}; @`;:a8pK8.ap,b`A, APSbCHA(|qy:9Är9, *,.A|@, .AlA4``!HѩA(9n9s:|cx(.@8~,?`|)AH`,@(S8`````!:1|apS|8c, @bC8dHҡ`,@<,?A4ssHЙA((#@XbcH$e`ps,#@$p, +@t8Kh8cf8b8xH1A(p8b8cx&| *HA(8bK^LRPBA8cf8b8xHA(p8b8cx&| *HA(8bK]AX|;@@;KbcKquKaH)A(,@,=AK8"ccBb9 x $|H*Kx)KKYKKYK| @K C  BrSpfileGet``|aA;@!|b}&~8c~|c8!1xc$x8|*cH!A(`w,AlHA(,@,,A ,@Lc```!HA(,`wA(HA(,c@,,A,A,AV>,9#A,9\@XcH߅A(,A0T`>, AHcHߍA(,A:\; \,9",'@;'@;"|8A.AbH-A(,@,9#A";\`!z C8, \AT>~cHA(`w,A@HA(,V>@,, (,)/ #/=.,N޳AL3OFBA.@4T>| AE,:@tA$8b8c|)Hu`8`88!|} !AaN @b, Ap`Ab , @KV| @b , @; 8x80cHA(@88H8 x$|0*x&|@*HyA(cKYPb0|#@AX|#@@b`8bhp0|$@@88`8KKUK@KUK|` @K9@8~"9xbpGyg$|8*KsKbcHܥA(,@9@~8"9xbpGyg$|8*KsqK4cH!A(T`>,A|c, A$H)A(,CA8T>K9@8~"9xbpGyg$|8*KrKD8\8,`wT>|!AKcHmA(,AX; :\``!x` |, \A, A\8EA|d)cHA(,@,:@b8;@Kl`T>$KcHA(,T`>Axd |,$ AcHA(,@9@~8"9xbpGyg$|8*KqKhcHUA(T`>,Ac, AH]A(,bDA8T>~!K9@8~"9xbpGyg$|8*KqKC8\8T>|K|8A4Kt;@K\9@~8"9xbpGyg$|8*KpKXb8\;@K,9=A,9,A,9(A ,9)@b;@Kc`!HA(,T`>Ahc, @AXK C  token_get|}&aA!`v8``gaA0PHbX!!} @pA8| @~ @`Ah*b@B ::bB``!v6,#T@,, Ad 88x8b0, @HA(b8s80x&| *HA(8bKS@p8bHA(6y@p8!|Aa} !AaN KKO88b8x0HA(b8w80x&| *HA(8bKR@KLNSAx@h8bHA(~y@h8!|} !AaN K8`y@KK:88x8b0HmA(8p8ubx&| *HmA(8bK=LNSAK(KO݀(p A$K CBrRpntFree@AF123_80|}&aA!`v8``gaA0PHbX!!} @pA8| @~ @`Ahh*b@B ::bB``!6 p A| 8b808x, AK988b8x0HlYA(b8t8px&|8*Hl9A(8bKA(b8w8q$x&| *H>A(8bK@KT:~ @} @b@B "`h::````!Xp A 8b8x80, AK 88x8b0H=A(8q$b8tx&| *H=A(8bK LNSAx@h8bHA(~y@`8!|} !AaN K8`y@KH=)A(8q$8ubx&| *H= A(8bK LNSAK@ CtBrExtFree@AF136_52|}&aA!`v8``gaA0PHbX!!} @pA8| @~ @`Ah*b@B ::bB``!v6,#T@,, Ad 88x8b0, @H;A(b8s8q(x&| *H;A(8bK @p8bHA(6y@p8!|Aa} !AaN KK88b8x0H:A(b8w8q(x&| *H:A(8bK @K89pcy'$|8*K`, ALH8`cH<9A(8|# @@T8>89pcy'$|8*K`, AH8`cH;A(8|# @@T8>89pcy'$|8*K!`, AtH88`cH;aA(8|# @@T8>89pcy'$|8*K`, AH8`cH:A(8|# @@T8>89pcy'$|8*KI`, AH`8` cH:A(8|# @@T8>89pcy'$|8*K`, A0H8`8H:A(8|# @@T8>89pcy'$|8*Kq`, AH8`8H9A(8|# @@8 >89 pcy'$|8*K`, AXH8 c8`H9eA(8|# @@\8 >89 pcy)$|H*x $|H*K`, AH8`cH8A(8|# @@\8 :89 pBy)$x$c|H*|8*K`, AhH,8`cH8}A(8|# @@\8 :89 pBy)$x$c|H*|8*K`, AH8`cH8 A(8|# @@\8 :89 pBy)$x$c|H*|8*K-`, AHD8`cH7A(8|# @@\8:89pBy)$x$c|H*|8*K`, A H8`cH7!A(8|# @@\8:89pBy)$x$c|H*|8*KE`, AH\8` cH6A(8|# @@\8:89pBy)$x$c|H*|8*K`, A$H8`8H69A(8|# @@\8:89pBy)$x$c|H*|8*K]`, AHt8`8H5A(8|# @@x8:89pBy)$x$c|H*|8*K`, A<pA} ,#A K=`K5`pAH| @H |` @ , A K`; 880cK5A(@8}8Hx$|0*x&}" KA(cK`Pb0|#@AX|#@@b`8bh0| @@88`8H {, |` A8p`A} ,#A K `K`| @H@Ĉ , A K`; 880cKA(@88Hx$|0*x&}" KA(cK`Pb0|#@AX|#@@b`8bhp0|$@@88`88!}!AaN A 4 BrSigEnableT~>b|}&,$8X!8|x$|*A@pAdb , A KI`KA`b| @4H | @(b , A K `NAH NBA,>Ab "c $patHb *c ,pat 8;08cKA(@88pHx&x$|J|@*KA(cK`Pb0|#@AX|#@@b`8bhp0|$@@8,>A88`8H0A(8|#@@t9`9b"89BPcdx $|H*K `bd, A0H8`8H0AA(8|#@@l9`9b"89BPcdx $|H*K}`b, AHL8`8H/A(8|#@ @l9`9b"89BPcdx $|H*K`b, A H8`8H/1A(8|#@(@l9`9b"89BPcdx $|H*Km`b, AH<8H,$A8`H.A(8|#(@@l8"B9b89P cx $|H*K`b, AH,$A8`H. A(8|#(@@l8"B9b89P cx $|H*KI`b, A`H ,$A8`H-}A(8|#(@@l8"B9b89P cx $|H*Kؽ`b, AH(,$A8`H,A(8|#(@@8"B9b89P cx $|H*K1`b, AHbpA$b , A Ky`Kq`bpAH b| @H |` @b , A K)` 8;08cKaA(@88Hx&x$|J|@* K%A(cK9`0| @Ab0X|#@@b`8bhp0|$@@88`8HL8bd, A@p`Ab , A K`K`b| @H |` @b , A K` 8;08cKA(@88Hx&x$|J|@* KA(cK`Pb0|#@AX|#@@b`8bhp0|$@@88`88!|} N C BrSigIgnore`aAb|!"}| !Q8c},%|d8dx$|*@ @HhA$8`8!8}Ḧ , @K`| A$HK`K`| @l8 8 ;B0, cC@dKA(8zH@x$x&|0*}"KA(cCK`0bP| @AH|Ka`8 80cCKA(8z@Hx$|0*x&}"KmA(cCK`0bP| @A,X0pbh|$@A|$(@@@H(8p0`bh|&(@@8| H| H8`88!}!AaN  , @K1`| @H(K`K`| @H@8 8 ;0, c@dK-A(8H8@x$x&|0*}" KA(cK `0bP| @AH|Kq`8 80cKA(88@Hx$|0*x&}" K}A(cK`0bP| @A,X0pbh|$@A|$(@@8H(8p0`bh|&(@@8K,8!8`8}K$, A|A48`8K Ah BrThrRegister;b|}&aA!aA!xp8t~!a8c~|cxc$,$|*A lpAb , @ XKi`| @b , @ 8 8;bB08cccFKA(H@8{x$8 x&|0*|"KIA(ccK]`P|:@AX|:@@b`8bhp|:@@ 8;`b8c1drH#A(|zyAbL, A `,:A \b8c1H#A(,#@ HpAb , @ 0b81KyA(" 8:0b8yKIA(H@8wx$x&|(*|"K A(bK!`Pb0|#@AX|#@@ b`cp0bh|$@@l8"bH,$Ax@:@:`:@*: 9cH"u``xb81H$A(,#A4 , A(8c ```!C8c, @b81H#A(|py@pAb8cHA((#@Nbb8c]HA((#@Dbvb8c> vHmA((#@Db $b8c> $HEA((#@Dlbhb8c>hHA((#@D$ HA(,#ACtbcb8c>,HA((#@CLb "b8c>4 "HA(,#@Cb8c>DiHmA((#@Bb :b8c>L :HEA((#@Bbtb8c>TtHA((#@B`bb8c>\HA((#@B0b Mb8c>d MHA((#@Bbpb8c>lpHA((#@Ab b8c>t H}A((#@Ab 1b8c>| 1HUA((#@Apb ;b8c> ;H-A((#@A@b b8c> HA((#@Abjb8c>jHA((#@@b b8c> HA((#@@b b8c> HA((#@@b&b8c>&HeA((#@@Pbxb8c>xH=A((#@@ b b8c> HA((#@?b'b8c>Ę'HA(,#A?8b8c>Ԙ &HA((#@?xbCb8c>ܘCHA((#@?Hbkb8c>kHyA((#@?bb8c>HQA((#@>bb8c>H)A((#@>b b8c> HA((#@>b b8c? HA((#@>Xbb8c? HA((#@>(b b8c? HA((#@=bMb8c?MHaA((#@=blb8c?$lH9A((#@=bob8c?,oHA((#@=hbb8c?4HA((#@=8bb8c?<HA((#@=bxb8c?DxHA((#@b8cA, Ab , A8b, ApAb , @K^9`| @b , @;80c8KYA(@88Hx$|0*x&|" K%A(cKa9`Pb0|#@AXb0|#@@ b`cp0bh|$@Acc8`8KK]Y`K, Ad04|@AT8x HYA(,@<8>bp89y)$ |H*Ku`K8x H)A(,@t8~>9@#bp89~Dy)$|H*Ku`K8x HΥA(,@8p>bp89py)$ |H*Ku5`K(8x HuA(,@8o>9@#bp89oDy)$|H*Kt`Kc#H͉`,@b, A4b, @b, @b, @b, @b8c`HA(,AbE(@Dc`bT>F(@bc` Klb b KXbKc#H̱`,@ c#8%|e؛f KH̅`.AKa;HʁA(8c8nx$| *Kg-`;H]`K8k"8%B89kbpx$ (|8*Ks9`K,`e8a8FKA(8u8aHA(8c8ux$| *Kf`a:8Hǽ`a:HA(,Ap8v9@&"8bpx$9vD0|8*Kr`Kx88a8EܘKEA(, A8a8qHA(8c8qx$| *Ke`a:8H`a:H A(,A8r9@&"8bpx$9rD0|8*Kq`K8xKd8nKbwKbcyKH88` 8x$| *Ke`EEHIA(,A89@&"8bpx$9D0|8*Kp`KHmA(KKHMA(dxK8KϜ8KlHUA(b#K88K8KH1A(b#KάHA(d pK΀8KXHA(d4K$8K8K8K͜8Kl8K<8K 8KHA(dK̨8K̀8KP8K 8KHUA(dK˼8K˔8Kd8K48K8K8Kʤ8Za:`HeA(8c8Zx$| *KV`0:`e(H=`K<8K8K8KɴHA(d XKɀ8KX8K(8K8K8KȘHuA(d TKd8KH5A((#@Lb &KD8K8K8K8K8KX8K(8K8K8K8Kh8K88K8K8K8Kx8KH8KHA(b# K8Kb, A8` 8y8yx$| *KR9`FFH}A(,AD8z9@&"8bpx$9zD0|8*K^1`K$8K8K8Kl8K<8K 8K8K8K|H]A(d @KHHIA(,@8`dKH)A(d KHA(<|A``b `KHA(,@8`dKpHA(d8KDHA(dlKHA(d|K8KHA(dKHyA(dKd8K<8K HUA(dKHAA(,@8`d KH!A(dKt8KL8K8KHA(,@8`dK8K8KTb8c=,HA((#@b #K8K8K8K|8KL8K8K8K8K8K\HYA(d HK(8K8K8K8Kp8K@HA(dK 8K8KHA(dK8KX8K(8K8KHA(d K8Kl8K<8K 8K8K8K|8KL8K8K8KHaA(d,K8K`8Ya:XHA(8c8Yx$| *KNE`:XeHq`K8K8K8Kp8K@8K8K8K8K8KP8K HA(ddK8K8K8Kd8K4HyA(d DK8K8K8Kxb , AH8` 88x$| *KMI`FFHA(,A89@&"8bpx$9D0|8*KYA`K48K8KX8K(8K8K8Kt8KD8KHmA(dXK8K8K8KX8K(8K8K8K8Kh8K88K8K8}a:PHUA(8c8}x$| *KL`:PeH-`KpHA(b#KD8K8KHA(d K8Xa:HHA(8c8Xx$| *KK`:HeXH`KX8K08K8K8KHA(,@8`d K`8K8HA(,@8`dK8K8K8Kp8K@8K8K8KHA(dK|8KT8K$8K8KHeA(,dd @,@8`8d KlH-A(,dd @<,@48`8d KHA(,dd <@,@8`8d a9xHYA(8c8>x$| *K@`h9xH5`K8K\8=a9pH A(8c8=x$| *K?``9pH``vHA(8| , /@8c8|K_P8ab8Xp8 Xx8 8 68 P`9 T`8 7K`mA(K$a9h8;HMA(8c8;x$| *K>`P9hH)`K`a9h8;H A(K8a9`HA(8c8x$| *K>`H9`H`Kb86H`@|`4bT~868|8`Ha`|`4TA:K8b8c6H)A(|vyAHK 8:a9XH1A(8c8:x$| *K=`9XH ``vHA(8| , /@8c8|K~bF8abGbh8%X8X8K^A(8a8HA(,T&(@+@8aOFBAHmA(8c89x$| *K=`8tHI`8&|@8s$KxbHA(8c88x$| *K<`buPH`PbHA(8(#:$8|,/LF A|K~bF8abGbh8%X8X8|K]A(8a8HeA(,T&(@+@ 8aOFBAHAA(8c87x$| *K;`8tH`8"|@8s KxbHA(8c86x$| *K;`bu5H`5bHA(8(#: 8|,/LF A|K85a9PHmA(8c85x$| *K;`@9PHI``vH5A(8| , /@ 8c8|K84a9HHA(8c84x$| *K:`89HH``vHA(8| , /@8c8|Kx83a9@HA(8c83x$| *K:A`09@Hq``vH]A(8| , /@8c8|K82bH)A(8c82x$| *K9`bH``vHA(8| , /@8c8|Kpb8c6|HA(|vy@KT81a90HA(8c81x$| *K9M`(90a98Hy``vHeA(8| , /@8c8|8apH=A(|a988cp86\KZ)A(K80a9 H A(8c80x$| *K8` 9 a9(H``vHA(8| , /@8c8|8apHA(|a9(8cp86@KYA(K8/a9HqA(8c8/x$| *K8`9a9HI``vH5A(8| , /@8c8|8apH A(|a98cp864KXA(K<8.a9HA(8c8.x$| *K7`9a9H``vHA(8| , /@8c8|8apHuA(|a98cp86 KXaA(K`vK8a8H9A(8c8x$| *K6`8H``vHA(8| , /@`8c8|KPaHA(,APa,#Ab!Q8xH8p|x$|*AP , A K `K `bpA w ,#A K `NHNB0Ax8apHH~`,@d8apHQA(,#AH8/HA(|vyA48pb8HIA(,A8*8vbH `y, A48ap8HA(,#A8*8cH `: 880bK=A(@8w8pHx&x$|J|@*K=A(bK `Pb0|#@AX|#@@b`8bhp0|$@@8H11,?XZA$8aXcH`8X8aXH`8aXHH`,>A$8L8aXH`8aXcH`8 P8aXH`,=AD88aXHi`8|=@@88aXHM`H8aXcH9`,;A`(;AH8 D8aXH`8|;@@88aXH`H(8aXcdH`H88aXH`,:A`(:AH8$ 8aXH`8|:@@88aXH`H(8aXcDH`H8 H8aXHq`,8A818aXHY`8ap8XH{`,@d8apH}1A(,#AH8/HA(|yA48pc8H})A(,A8*8cH `y, A48ap8H|A(,#A8*8cH `8`Hu,@b@,@8a, @$bHP88fdbpAb , A K%`; 8;b80ccK:UA(B@8{8#bHx&x$||0*K:A(8bK %`Pb0|#@AX|#@@ b`hpb0|#@@88b8px&|@K9A(8bK `H;8aXHQA(`~ba, @$bHP88fd8`H,@b@,@c,A{!@`W>x~ ,>A}X,@ HA(bpAЈ} ,#A Ke`K]`; 880cK8A(@8}cHx&x$|J|@* K8]A(cKq`Pb0|#@AX|#@@ b`bhp0|$@A`c} 88!|!AaN bhKA` 8b88 c&K7A(Hb@8pcF8b8cx&|!@K7QA(8bKe`BPph~9@}9@AdX|9@@`HTB88!h 888bc&K6A(b@8pH8b8cx&x$}|8*x $|H*K6A(8bK`BP~9@AX|9@@ b`hp}9@@c8b88c&K6%A(x&b|H}%A(`f8bbb8cK5A(8bK`AX|9@@ b`@c8b88 c&K5A(8b8p8cx&|! K5uA(8bK`AX|9@@ b`@cbpAb , A K`K`8b880K4A(88b8cx&| x$|@*K4A(8bK`0| @Ab0X|#@@ b`b0|#@A`8`} 88!|!AaN C  BrProgExecute`b|8,'!q|8x$|*@| @ , @; 880cK3UA(@8~Hc9x&x$| *|H*K3A(cK)`Pb0|#@AhXb0|#@AXp`dbh|$@@88x8~XHzA(8~HyA(cKA(|pK8p0`bh|&(@@KK`; 880cK2AA(@8~Hc9x&x$| *|H*K2A(cK`Pb0|#@ATKx8~XHyA(8~Hy A(cKA(|ppÄ~ ,#A4K5`K-`b| @ , AKK`b| @xK ABrExit|;aA!!Qa`b,$8Ѐ~8c~|cxc$|*A4pAb , @K9`| @b , @ 8;b08ccK0UA(@8{H`x$|0*x&|"K0!A(ccK5`Pb0|#@AX|#@@b`8bhp;`0|$@@88d18DHw%A(|yy@b|@`bc,#A@pAb , @K`| @b , @ 8;08cK/A(@88Hx$|0*x&|"HK.A(cK`Pb0|#@AX|#@@ b`cbhp0|$@A`c8`88!}!AaN K`KK`K| @KB8~9"pjxg$c81 |8*K`bc,#ApAb , @K]`pAb , @ 8;08cK-yA(H@8|x$8x&|0*|"@K-AA(cKU`Pb0|#@AX|#@@ b`cbh0| @A`c8`8K\Ky`K8Km`K| @K8ap8c%HtAA(,#@p,?A4^p Ap"89@ {G$pb9cI81`|8*K]`b, @P| @0Kpc#HsA(,{C$]*A\8"9cGpBc81dK`b, AK8cHmA(8ccD8K =`ahcHkm`apbc,#ApAb , @K`| @b , @ 8;08cK*A(@8Hhx$|0*x&|"@K*A(cK`Pb0|#@AX|#@@ b`cbhp0|$@A`cap8KK`K8K`K| @K8:8ap`!HoA(|zy8ap8A`Hm`,A,8ap8c%Hq}A(8:,#8apA8K;8z8:Ho!A(,#A8K KA`K$;`KK-`K| @K A ora_home_get```aA`;@!aA!xpb"|}&NB8,'|xc$8!Q|*ApA , @lK`b| @ , @<; 880cK(9A(@8x8Hx&x$|"|@*K'A(cK`Pb0|#@AX|#@@ b`Cbhp0|$@@88b: b:5:5 `!t:,#@D8ap~81pK'eA(8apHg)A(|uy@:(6A:::`:@0```!:, A<:(6A85b8b:;H:H: $`!v:,#@8ap~81|K&A(8apHfiA(|~y@,:(7dA;:B"::`0```!;, A;(>dA8Pb$},#| @A,pA} ,#@\K`b| @Ĉ , @,; 880cK%A(@88Hx&x$|"|@* K%uA(cK`0bP| @Ab0X|#@@ b`Cbhp0|$@A`C8`88!|px} !Aa!AaN KE`KK9`KA,pA , @K`b| @Ĉ , @; 880cK$5A(@88Hx&x$|"|@* K#A(cK `0bP| @Ab0X|#@@ b`Cbhp0|$@A`C8`8KK%`K,K`K8a88%X8X8bK#QA(88a8Hh-A(,T&(@ATu|A88"9BbbPx$k|8*K`NK(8a8LFBAHdA(88cx$| *KY`88Hb`8bDr&|@8td$K$cHdMA(88cx$| *K`cvHb%`cHd A(8:(#|$,/@l8@d|K\K`8K~8a88%X8X8|b(K!A(88a8HfA(,T&(@AXu|Al88"9BbbPKx$|8*K U`NK(A (@8a8dHcA(88cx$| *K`88wH``8ao"|@8qd KbDHbA(88cx$| *KI`btH`y`bHbaA(8:| , /@(#@8|KKQ`8KK`KK`K| @\K C H BrSapDataGet|aAb8Ѐ,$!8c|dx$|*A,#AD, @aHO,A$, Af, A$b//px/Hb/c/paxb88apHRaA(8c8x$| *K `a8pHP=`aHRQA(,AP8 "89 pxg$c |8*x $|H*K`H4bc,#A;"|}&aA!`}``;@aA!xpb!8p| c8,#|xc$|*A0pA90b , @9,K`b| @9b , @88, %A78(\AXbxH8|*| N ,L@$,<@,$@b,$A8aHK`8a8XHQM`8a8PHQ9`8aHMA(. @ , A ,<A, /A , +@ ,@$8||a, \@ 88a8XHP`,JA,KA|,LA@b , A, /A , +@c8/HPA((#8@c8aHPM`,HAT,IA , A8a8HLqA(8c8x$| *K`8HJM``},@ 8|bc,#| A0pAb , @\K֙`| @b , @( 8;08cK A(H@8~cx$x&|0*|"@K yA(cKٍ`Pb0|#@AX|#@@b`8bhp0|$@@8c Z8 `8! P} |px!Aa!AaN KM`KKA`Kb 88cpHH``}K<8a8HHN `8a8lHM`K8a8HHM`8a8dHM`Kc8\HMUA((#KP8a8\HM`,=A@8acHM`8a8HHMq`8a8hHM]`K8aHMI`8a8HHM5`K8a8\HM`,LA|8aHM`8a8HHL`8a8dHL`K,@$8||a, /@ 88a8ZHL`K8aHF`KL8aHF`K<8acHF`K(8Kb, @ , A, /A , +@4c8/HKA((#8@c8aHFU`Kc8\HK}A((#K,<A8acHF!`8aHH A(,@$8||a, /@ 8b, @ , A, /A , +@t8a8XHKI`c8/HJA((#8@c8aHK`,@8aHK`K8aHJ`K8a8ZHJ`K 8aHE!`Kx,<AP8acHE`8aHFA(,@$8||a, /@ 8b, @ , A, /A , +@8a8XHJ-`c8/HIA((#8@c8aHJ`.8aHFIA(`}@<{HF5A(|P8}HH`,@ 8Kx{HEA(|P8}HG`,@K8a8ZHIm`K@ 8aHC`K(8acHC`8aHEA(,@$8||a, /@ 88a8XHH`c8/HHA((#8@c8a`HH`c8_HH}A(,#@Kt8a8_HH9A(88H8aHH`8a8pHHm`c8_HGA(88aHHM`K8acHB`b, @ , A, /A , +@`8a8/HGA(,#A$8, @ 8/K, +AbxczaK8a8\HG9A(,#AK8acHA`8a8LHGm`cHCA(8c|, A(|8aHGA`cHCA(`~K8a8LHG`K8acHAe`8a8/HFA(||yA ;@; ,@Lb 8c5;,$@ ;Z|@(;,$A8aHD`,@;{$,@Lb 8cH:,$@ ;|@(:,$A8aHD`,@|Al<`sa8pd|*xhat|;xha|;yA@|A88pthem|*xhp|;x|3yA8cpr|xhaw|yAKc8/HEYA(||yAb8/c HE=A(|dyADcHC`,@08a8XHEq`8a8\HE]`K 8c8/HDA(|}y@8/K8a8XHE`8<`sa8cpr|xhaw|y@ 88aHD`8/K8aHD`8/K8acH?`8a8/HD=A(|}yA;@ .@Lb 8c5;#,$@ ;Z|@(;9,$A8aHB`,@; {$-@Lb 8cH;,$@ ;9|@(;,$A8aHB1`,@|AP|AHA(,#AK8aH95`8a8XH>`c8/H>MA(`|b , @<8aH>`(<8@c8d, +@`dK8a8H>Q`K8acH8`a,#AH;8;,#.``!AxH:A(};;},,#.@8a8HH=`,0@8a8H=`K8a8 H=`Kh|a8K8acH7`8aH9A(,@$8||a, /@ 88a8XH=9`c8/HK[ K8acH19`8a8XH6`8a8,H6`8acH6`8a8HH6`8a8H6y`K<8aH0`8a8XH6Q`8a84H6=`8a8XH6)`8acH6`Kc888H2-A(,|`4T~@;@;`|Tz=|},#A;````!H2A(;{};y;9`,#@|88acH/`8aH1A(,@$8||a, /@ 88a8/H4A(,#A88/8aH4A(|}yA8c88H1!A(,@@8a8XH4`88aH4`8a8PH4`Kt88a8/H41A(,#A-KYA(88apH9A(8c8x$| *K`|88pH `b, @@, @4, @(, @, @, A0|8cK,#AK؀, @|8-8ap8 cF8 cH9>-KqA(88apHQA(8c8x$| *K`|@8pH%`b, @@, @4, @(, @, @, A@|@cK,#AJ, @ |@---8ap8 cF8 cH9> KyA(88apHYA(8c8x$| *K`|H8pH-`b, @@, @4, @(, @, @, A8|HcK,#AI, @|H$"8ap8 cF8 cH9> KA(88apHiA(8c8x$| *K `|p8pH=`8ap8 cF8 cH9>%KA(8 8apHA(8c8 x$| *K`|P8pH`8ap8 cF8 cH9>%KA(8 8apHA(8c8 x$| *K-`|X8pH]`8ap8 cF8 cH9>-K9A(8 8apHA(8c8 x$| *K`|`8pH`8ap8 cF8 cH9>- KA(8 8apHA(8c8 x$| *KM`|h8pH}`8ap8 pcF84KaA(8r8apHAA(8c8rx$| *K`|x8pH`,7@l8ap8 pcF8%KA(8apcK,#AG, @$8ap8 pcF84KA(H\b#HP8ap8 pcF84KA(b8pHU`,Ab8apH]`b#8 8apH5A(8c8 x$| *K`|8pH `x8ap8cF8:H9>H9^KA(88apHA(8c8x$| *Ka`|8pH`8ap8cF8b9^KiA(88apHIA(8c8x$| *K`|8pH`x8ap8cF8&b9^KA(bc|x(@ cHP8apK,#AD, @x8ap8 cF8&b9>KA(bc|x(@ cHP8apK݁,#AD`v, @0x8ap8cF8&b9^K%A(Hb#H`v88apHA(8c8x$| *K`|8pH`,A ,@ b#b, AЈֈc, ,@4@E8ap8cF8&b9^KYA(HT@(8ap8 cF8&b9>K-A(H(8ap8cF8&b9^KA(bc|x(@ cHP8apK,#@HB8apH`H`v88apHA(8c8x$| *K9`|8pHi`b, @, A,A ,@#zp,#A8HA(8c8x$| *Kz``vcpH` bHC, /@$8ap`H`bK`H8ap8 pcFK}A(bKq`H8ap8cF8b9^ TKEA(8apcKU,#AA\, @t8ap8cF8b9^ TKA(8apcK ,#AA, @,8ap8cF8b9^ TKA(88apHA(8c8x$| *K9`|8pHi`8ap8cF8b9^ pKAA(88apH!A(8c8x$| *K`|8pH`,$@$8ap8 pcF8KA(H8apH`88apHA(8c8x$| *KA`|8pHq` ,$@$8ap8 pcF8KIA(H8apH9`88apHA(8c8x$| *K`|8pH`0,$@$8ap8 pcF8KA(H8apH`88apHA(8c8x$| *K9`|8pHi`(,$@$8ap8 pcF8PKAA(H8apH1`88apHA(8c8x$| *K`|8pH`8,$@$8ap8 pcF8KA(H8apH`88apHA(8c8x$| *K1`|8pHa`,$AD8apHI`8ap8/HuA(,#A 88&8apH`H48ap8 dcF8 tcH9> cJ8&pKA(8w8apHA(8c8wx$| *Ki`|8pH`8|HIA(,@`P|KՑ,#AL, A,Ab ;bB@H, P:~=@@cc88qcKA(bx&|. KA(ccKx `AX|=@@Hc,#A;bPb HB@:~=@cc88cKA(<bx&|" KmA(ccKw`AX|=@@ b`#bh#H;hb,@8,$@$8ap8 pcF8-(KA(H8apH`8y8apHA(8c8yx$| *Kq`|8pH`b, A8P|Kӡ,#A$,@8`@,$@$8ap8 pcF8-4K5A(H8apH%`88apHA(8c8x$| *K`|8pH`b, AD, A8c|K,#A9,@8`,$@$8ap8 pcF8KaA(H8apHQ`88apH1A(8c8x$| *K`|8pH` ,$@$8ap8 pcF8KA(H8apH`88apHA(8c8x$| *KQ`|8pH`8ap8cF8b:9^KUA(88apH5A(8c8x$| *K`|8pH `8ap8cF8 bbKA(88apHA(8c8x$| *Ke`|8pH`8ap8cFb9-@b9^-HKmA(88apHMA(8c8x$| *K`|8pH!`8ap8cFb9-@b9^-LKA(8 8apHA(8c8 x$| *K}`|8pH`b, A08ap8cFb9b9^-PKuA(H,8ap8cFb9b9^-PKIA(8!8apH)A(8c8!x$| *K`|8pH`p|+yAX, /@(8ap8cF8\b9^hKA(HL8ap88Z8\b9^hKA(H(8ap8cF8\b9^hKuA(8"8apHUA(8c8"x$| *K`| 8pH)`x|+yAX, /@(8ap8cF8\b9^hKA(HL8ap88Z8\b9^hKA(H(8ap8cF8\b9^hKA(8#8apHA(8c8#x$| *K%`|(8pHU`8ap8cFb9-Xb9^-`K-A(8$8apH A(8c8$x$| *K~`|x8pH`b, Ax88apcFb9-Xb9^-`KA(8x8apHA(8c8xx$| *K~-`|8pH]`X8ap8 pcF8,xKAA(8apcKQ,#A3X, @~,ax,xp8%8apHA(8c8%x$| *K}`|@8pH`X8ap8 pcF8-hKA(8apcK˹,#A2, @~-pax-hp8&8apHYA(8c8&x$| *K|`|H8pH-`X8ap8 pcF8-xKA(8apcK!,#A2(, @~-ax-xp8'8apHA(8c8'x$| *K|e`|P8pHݕ`X8ap8 pcF8-KyA(8apcKʉ,#A1, @~-ax-p8(8apH)A(8c8(x$| *K{`|X8pH`X8ap8 pcF8(KA(8apcK,#A0, @~(ax(p8)8apHޑA(8c8)x$| *K{5`|`8pHe`X8ap8 pcF8-KIA(8apcKY,#A0`, @ -p8*8apHA(8c8*x$| *Kz`|h8pH`X8ap8 pcF8KA(8apcK,#A/Ѐ, @ -p8+8apHqA(8c8+x$| *Kz`|p8pHE`X, @ 8ap8 pcF8-KA(H8ap8 pcF8KA(8apcK,#A/c, ,@@0x-pHA8-8apHU`8,8apHܕA(8c8,x$| *Ky9`|x8pHi`X, @ 8ap8 pcF8-KAA(H8ap8 pcF8K%A(8apcK5,#A.<c, ,@@/-̈~-paxHA8-8apHq`8-8apH۱A(8c8-x$| *KxU`|8pHم`|cKƕ,#A-`u8apH9A(,#@h,@8H7`h8ap8-bcFbb9^-KA(H(H7q`f8ap8-bb9-KA(8.8apHA(8c8.x$| *Kwy`|8pHة` ,$@$8ap8 pcF8KA(H8apHq`8/8apHQA(8c8/x$| *Kv`|8pH%`8ap8cF8.bbKA(808apHA(8c80x$| *Kv`|8pHױ`8ap8cFb9.b9^.KA(818apHiA(8c81x$| *Kv `|8pH=`8ap8cFb9.b9^.KA(828apHA(8c82x$| *Ku`|8pH` ,$@$8ap8 pcF8KA(H8apH֑`838apHqA(8c83x$| *Ku`|8pHE`8ap8cF8.$bbKA(848apHA(8c84x$| *Kt`|8pH`8ap8cFb9-@b9^.,KA(858apH׉A(8c85x$| *Kt-`|8pH]`8ap8cFb9.0b9^.,K5A(868apHA(8c86x$| *Ks`|8pH`bxЀ,nAL;8ap8.8cF8cHp!9>cJAxA8KA(H8ap8 pcF8.PKuA(878apHUA(8c87x$| *Kr`|@8pH)`bxЀ,nAL8apAx8.8cFpA8cH9>cJ8KA(H8ap8 pcF8.\KA(888apHՕA(8c88x$| *Kr9`|H8pHi`bxЀ,nAL8apAx8.8cFpA8cH9>cJ8KA(H8ap8 pcF8.PKA(898apHA(8c89x$| *Kqy`|H8pHҩ`bx,nA(8.8Ax8apcFAp8cH9>cJ8KQA(8:8apH1A(8c8:x$| *Kp`|P8pH`bx,nA8.8Ax8apcFAp8cH9>cJ8KA(8;8apHӍA(8c8;x$| *Kp1`|X8pHa`bx,nA8ap[8.8cF8cH9>pAcJAx80AK A(8<8apHA(8c8<x$| *Ko`|`8pHн`bx,nA<8.8Ax8apcFAp8cH9>cJ8KeA(8=8apHEA(8c8=x$| *Kn`|h8pH`bx,nA8.8Ax8apcFAp8cH9>cJ8 KA(8>8apHѡA(8c8>x$| *KnE`|p8pHu`8ap8 cF8cH9> KQA(8?8apH1A(8c8?x$| *Km`|P8pH`bxЀc,nA`Ax8 8apcFA8cHA9>cJp9~a:,KA(H48ap8%pxcF8.PcH:,9>,` KaA(8apPKq,#A, @tbxc,nA\Ax8 8apcFA8cHA9>cJ9~apKA(HD8ap8 AxcF8 cH` cJ8.hpKA(8apPK|tyA, @bxЀc,nA\Ax8 8apcFA8cHA9>cJ9~apKA(H88ap8%pxcF8.PcHb` KA(H`t8@8apHέA(8c8@x$| *KkQ`|X8pH́``,%A08ap8cFb9.pb:.x9^.xKMA(Ht K, A48ap8cFb9.pb:.x9^.xKA(H88ap8%pcF8cHb9^.p:.xxKA(8A8apH͹A(8c8Ax$| *Kj]`|`8pHˍ``,%A,8ap8cFb9.pb9^.|K]A(Hp K, A08ap8cFb9.pb9^.|K%A(H88ap8%pcF8cHb9^.p8.|xKA(8B8apHA(8c8Bx$| *Kiq`|h8pHʡ``,%A,8ap8cFb9.pbbKqA(Hl K, A08ap8cFb9.pbbK9A(H48ap8%pxcF8cHb9^.pKA(8C8apHA(8c8Cx$| *Kh`|p8pHɹ``,%A,8ap8cFb9+bbKA(H,8ap8cFb9+bbK]A(8t8apH=A(8c8tx$| *Kg`|8pH`,%A(8ap8 cFb9> KA(H(8ap8 cFb9> KA(8D8apHʝA(8c8Dx$| *KgA`|x8pHq`, /A@X8ap8 pcFKIA(8apcKY,#A`, @ H 88apH `8E8apHA(8c8Ex$| *Kf`|8pH`X8ap8 pcF8.KA(8apcK,#A, @~.ax.p8v8apHUA(8c8vx$| *Ke`|8pH)`(,$@$8ap8 pcF8PKA(H8apH`8F8apHA(8c8Fx$| *Keu`|@8pHƥ`8ap8cF8.bb@K}A(8G8apH]A(8c8Gx$| *Ke`|P8pH1`@8ap8cF8.bbK A(8H8apHA(8c8Hx$| *Kd`|X8pHŽ`@8ap8cF8.bbKA(8I8apHuA(8c8Ix$| *Kd`|`8pHI`0,$@$8ap8 pcF8K!A(H8apH`8J8apHA(8c8Jx$| *Kc`|8pH`8ap8cF8.bbKA(8K8apH}A(8c8Kx$| *Kc!`|8pHQ`bЈ, A,8ap8cF8\b9^hKA(H(8ap8cF8\b9^hKA(8L8apHA(8c8Lx$| *Kbu`|8pHå`,(A(8ap8cF8 Tb9^KuA(H$8ap8 cF8 Tb9>KQA(8M8apH1A(8c8Mx$| *Ka`|8pH`P{h,#AL8NHA(8c8Nx$| *Kay`|hH©`8ap8 cF8 cH9>.KA(8apPK,#A, AP8O8apHEA(8c8Ox$| *K``|8pH`8ap8 cF8cH9> KA(8P8apHA(8c8Px$| *K`y`|8pH`8ap8 cF8cHbKA(8apPK,#A, AP8Q8apHEA(8c8Qx$| *K_`|8pH`;8ap8 dcF8 cHcJ8 pKA(8apPK,#A, AP8R8apH©A(8c8Rx$| *K_M`|x8pH}`8ap8 cF8-cH9> KYA(8S8apH9A(8c8Sx$| *K^`|8pH `8ap8 dcF8-cH9> cJ8.pKA(8T8apHA(8c8Tx$| *K^a`|8pH`8ap8 cF8.cH9>.KmA(8apPK},#A, @.ʠ~.̐pat.Θv8U8apHA(8c8Ux$| *K]`|8pH`8ap8 pcF8!K~A(8V8apHA(8c8Vx$| *K]Q`|p8pH`b, @,x8ap8 cF8&8b9>.K~MA(H(8ap8 cF8&8b9>.K~%A(8W8apHA(8c8Wx$| *K\`|8pH`P|K,#A ,A ,@ b#{b, @,x8ap8 cF8&8b9> K}uA(H(8ap8 cF8&8b9> K}MA(8X8apH-A(8c8Xx$| *K[`|8pH`b, @,x8ap8 cF8.b9>.K|A(H(8ap8 cF8.b9>.K|A(8Y8apHA(8c8Yx$| *K[)`|8pHY`P|Ki,#A ,A ,@ b#|b, @,x8ap8 cF8.b9>dK{A(H(8ap8 cF8.b9>dK{A(8Z8apHA(8c8Zx$| *KZQ`|8pH`8ap8 cF8&8b9>.K{]A(8s8apH=A(8c8sx$| *KY`|(8pH`P|(K!,#A ,A ,@ b#}8ap8 cF8 cH9>.KzA(8apPK,#A, @.~.pat.v8[8apHeA(8c8[x$| *KY `|08pH9`8ap8 cF8 cH9>KzA(8apPK%,#A, @Ҡ~Ԑpat֘v8\8apHA(8c8\x$| *KXa`|8pH`8ap8cFb9Db9^-HKyiA(8]8apHIA(8c8]x$| *KW`|8pH`8ap8cFb9Db9^-LKxA(8^8apHA(8c8^x$| *KWy`|8pH`8ap8cFb9.b9^.KxA(8_8apHaA(8c8_x$| *KW`|8pH5`8ap8cFb9.b9^.Kx A(8`8apHA(8c8`x$| *KV`|8pH`8ap8cFb9.b9^-HKwA(8a8apHyA(8c8ax$| *KV`|8pHM`8ap8cFb9.b9^-LKw%A(8b8apHA(8c8bx$| *KU`|8pH`8ap8cFb9/b9^.KvA(8c8apHA(8c8cx$| *KU5`|8pHe`8ap8cFb9/b9^.Kv=A(8db8apHA(8c8dx$| *KT`|8pH`8ap8cFb9/b9^-LKuA(8u8apHA(8c8ux$| *KTM`|8pH}`( @8H8,$@,8ap8 cF8cHbKu1A(H8apH!`8z8apHA(8c8zx$| *KS`|8pH`|bc,,#@b舃c,#A |HL(@@@,b舃c,#@bc,#A |H(A`8ap8cecFbb9^/Kt%A(8e8apHA(8c8ex$| *KR``8puH`8ap8cecFbb9^&KsA(8f8apHA(8c8fx$| *KR1`u8pHa`8ap8cecFbb9^/Ks9A(8g8apHA(8c8gx$| *KQ`u8pH`8ap8cecFbb9^'KrA(8h8apHA(8c8hx$| *KQI`u8pHy`8ap8cecFbb9^/ KrQA(8i8apH1A(8c8ix$| *KP`u 8pH`b, A08ap8bcFbb9^/$KqA(H,8ap8cecFbb9^/$KqA(8j8apHA(8c8jx$| *KP%`u(8pHU`8ap8cecFbb9^/(Kq-A(8k8apH A(8c8kx$| *KO`u08pH`8ap8cecFbb9^/,KpA(8l8apHA(8c8lx$| *KO=`u88pHm`b, A08ap8bcFbb9^/0Kp5A(H,8ap8cecFbb9^/0Kp A(8m8apHA(8c8mx$| *KN`u@8pH`b, A08ap8bcFbb9^KoA(H,8ap8cecFbb9^KoYA(8n8apH9A(8c8nx$| *KM`uH8pH `b, A08ap8bcFbb9^/4KnA(H,8ap8cecFbb9^/4KnA(8o8apHA(8c8ox$| *KM-`uP8pH]`8ap8cecFbb9^/8Kn5A(8p8apHA(8c8px$| *KL`uX8pH`ce8cFbb8ap9^/, @0, A0,, @b8, @b8؀H, @ 8@HP, @ pP@, @/, A-`x:bHY`,@,, A+H, A*P, A)X, A(8`, @X`, A&h. A$8, A$@, A#408 H`,A#, @"tb# A", A!`, A, @ , @ ,A ,@X|`yAL|#yA@|+yA4, A, A, @, A b8H`,@\yA~y@08 H`,A, A, A, A0pcHq`,Ac$cHY`,A,A|, @, @,A, @, @, @x(,#. @@@A0 , A, AA, @l@, @ , A Z ,:A P};@A X~;@A "@bH:  `:/9=hb:C#@:#. `; ``!, =@, +,=A/ -@Ȉ/+@AOAT@ 8z8cHA(8 8cx$| *K*`s8H`Z@y@h`@, @ h0,#@ ah0pHa`,A, @b8, @ h@bc,#AtpAb , @PK`| @b , @ 8;08cKJA(@88Hx$|0*x&|" KJA(cK`Pb0|#@AX|#@@ b`bh0| @A`8`8 8!|px} !Aa!AaN Kq`KKe`K| @tKbc,#ApAb , @K`| @b , @ 8;08cKI5A(@88Hx$|0*x&|" KIA(cK`Pb0|#@AX|#@@ b`bh0| @A`8`8KlK9`K}A(H@8y8,8px&|"K>MA(c#Ka`P|;@AX|;@@ b`bhMiK@ 8cf;"8c#K=A(H@8y8,8\x&|"K=A(c#K `P|;@AX|;@@ b`bhMi. AK 8cf;"8c#K=IA(H@8y8,8Xx&|"K=A(c#K -`P|;@AX|;@@ b`bhMi. @K 8cf;"8c#K`.c8(H>`@,AKc8(H>`.c8(H>`@,AKTc8H>u`.c8(H>]`@,A`Kc8(H>9`.c8(H>!`@,A$Kc8(H=`.c8(H=`@,AKc8(H=`.c8(H=`@.AKdc8(H=`.Ac8)H=i`,Ac80H=M`,Alc8)H=1`,APc8)$H=`,A4b`d80c8(H<`,AK 8;08cKA(H@8x08)49x&|" KA(cKȱ`Pb0|#@AX|#@@ b`bh0| @@8K$ 8;08cK%A(H@8x8)@8,x;9x&|" KA(8bK`Pb0|#@AX|#@@ b`bh0| @@8K 8;08cKmA(H@8x8)@8,x;9x&|" K1A(8bKE`Pb0|#@AX|#@@ b`bh0| @@8K 8cf;8cKA(H@8x08'8'x&|"KA(cKƕ`P|;@AX|;@@ b`bhMiK`K`K$bpKK`K| @K"Cf BraParCheck`;;aA!`yaA!xpb|}&8,'|xc$8!|*HpA , H|K`b| @b , H\;b 880ccKA(@8{8Hx&x$|"|@*KA(ccKĵ`Pb0|#@AX|#@@ b`bhp0|$@@80, @ 80, H, H, @ 8, Hx80;cccH7`,HX8'cc. H7`@d.A~x8'ccH7`,A~`8'ccH7i`,A~H@~, A, @}, @}A|@8'ccH7%`,A|(8'ccH7 `,A|b, @x08(H6`,Avb. @t0;|cdbH6`,AscbH6`,As;\bcDH6`.@q. @ob, A, @n, @m, @lb. AH0, @lA80, A, @kP, @kDA0, @j, @i܈, @ib. A`, @, A, @h, @hA,, @h , @hA, @f`, A, @e, @dl ,#@dL88`8x$| *K` b, @a(,#@a (8, A`@, A_H,#@_ H,7:ApPbHX@ ~ (@b`Bh:##@:. } @9``!wpK,#A 8888b,, AXp@_ K5A(8b8cx&| *KA(8bK)`LRPBA:~y@t,6A^$p.6@]8(bH3`,A]8)bH3`,A\@[0x, @Zp, AZx, @Y, @ 8 , @ 8, @ 8(, @ 8 cbH2`,@Y , AXt8*$bH2`,AWt8*:8H0`,@<, A;H, A:P, A9X, A8`, @X`, A7h. A5|8, A4@, A308 H0e`,A, @, A3"t< A3h, A2, A0,6@ 8cH/`,@/yA~yA,6A````!xH/`,A/Dbc.#-6-A/LRS@ 8b88pKuA(H@8+8b8cx&|`KIA(8bK]`Pp|5@AX|5@@ b`hA. A-A- ;08 H.`,A, @, A,̈, A,x, A+Dc8)hH.`,A(c8+H.m`,A&tb. A 0, @%|A0, @$0cdbH.%`,A#$,A# , @ b, A, A!,A!p, @ p, @p, @p, @h, @0(.8@8(bH-`,Al8(8bH-m`,AT8(HbH-U`,A<8((bH-=`,A$8(hbH-%`,A 8'bH- `,A8'bH,`,A8(xbH,`,A8(bH,`,A8(bH,`,A@0, AH, A`, @_`b, A0, A), AT;,7AXPX@bpHb Bh"`~#@}#@9```!, =A~y@,8A(yH,#@ yX,#@ b, A; ,8AtPbHXp@ :c#@:C. "`h~ @}@````!8,x8 H0A(,cA,8@,9A , @_0,#@ _0cC, @4, @ 8, @_, @ 8@, @ 8,=Ab, A|pA , @\K9`b| @b , @(; 880cKUA(@88Hx&x$|"|@* KA(cK-`Pb0|#@AX|#@@ b`bhp0|$@A`8`88!|px} !Aa!AaN K`KK`K| @pKb, A pA , @K`b| @b , @; 880cKA(@88Hx&x$|"|@* K}A(cK`Pb0|#@AX|#@@ b`bhp0|$@A`8`8KdK`K0K`K| @KcdH'`,@8(ccH'`,A48(ccH'`,A8)ccH'y`,@t8 ccH']`-A8(ccH'E`,@@8,, ADK8apH`8ap8oHA(,#@\888apHA(8c8x$| *K%`8pHU`KD`8K}K>y`K|K>m`K|| AK}pK|AK|x@K|@K|AK}lA`P|:@AX|:@@HA8/, AHH, A88apB88X8%|``9JKnA(b8pcH`,A 8;bBp8cccFKmA(@8{8p"H8 xx&|=舾KmA(ccK=`P|:@AX|:@@ b`hbc,#A @KOA(H(8ap8 8X9H9> @KOmA(88apHMA(8c8x$| *K-`x8pH!`,%A(8ap8 8X9H9>&KNA(H(8ap8 8X9H9>&KNA(88apHA(8c8x$| *K-Q`x8pH`88ap88X8\9>H9^lKNYA(88apH9A(8c8x$| *K,`x88pH `88ap8 8X8%9H9>%KMA(88apHA(8c8x$| *K,m`x8pH`88ap8 8X8%9H9>%KMyA(88apHYA(8c8x$| *K+`x8pH-`88ap8 8X8%9H9>KM A(88apHA(8c8x$| *K+`x8pH`88ap8 8X8&9H9>&KLA(8 8apHyA(8c8 x$| *K+`x8pHM`{,#A8 H%A(8c8 x$| *K ``|cH` cK, /@`8apH`H8ap8 p8XKKA(cK/`8 8apH}A(8c8 x$| *K*!`{8pHQ`{,#A8 H)A(8c8 x$| *K ``|cH` cK, /@8ap`H`H8ap8 p8XKJA(cK.`8 8apHA(8c8 x$| *K)%`{8pHU`{,#A8H-A(8c8x$| *K``|cH` cK, /@8ap`H`H8ap8 p8XKIA(cK-`88apHA(8c8x$| *K()`{8pHY`p|;yA@, /@8ap`H1`H08ap8 p8XKIA(H8apH`88apHA(8c8x$| *K'`x8pH`bnc, ,@4@x8ap88X8&9>H9^KHqA(HT@(8ap8 8X8&9H9>KHEA(H(8ap88X8&9>H9^KHA(88apHA(8c8x$| *K&`x8pH`|;yA@, /@8ap`H`HH8ap8 p8XKGA(H,8ap88X89>H9^&KGaA(88apHAA(8c8x$| *K%`x8pH` |+yA8ap8!HKFA(H8ap8!HKFA(88apHA(8c8x$| *K%a`x8pH`X,%A8ap8!HKFuA(H8ap8!HKF]A(88apH=A(8c8x$| *K$`x8pH`(|+yA8ap8!HKEA(H8ap8!HKEA(88apHA(8c8x$| *K$]`x8pH``,%A8ap8!HKEqA(H8ap8!HKEYA(88apH9A(8c8x$| *K#`x8pH `|+yA8ap8!HKDA(H8ap8!H8&KDA(88apHA(8c8x$| *K#Y`x8pH`|+yA8ap8!HKDiA(H8ap8!H8&KDQA(88apH1A(8c8x$| *K"`x8pH`|+yA8ap8!HKCA(H$|+y@8ap8!H8&KCA(88apHA(8c8x$| *K"E`x8pHu`|+yA8ap8!HKCUA(H$|+y@8ap8!H8&KC1A(88apHA(8c8x$| *K!`x8pH`X,%A8ap8!HKBA(H8ap8!H8&KBA(88apHA(8c8x$| *K!5`x8pHe`h,%A8ap8!HKBIA(H8ap8!H8'KB1A(88apHA(8c8x$| *K `x8pH`,%A8ap8!HKAA(H8ap8!H8KAA(88apHA(8c8x$| *K 5`x8pHe`,%A8ap8!HKAIA(H8ap8!HKA1A(88apHA(8c8x$| *K`x8pH`,%A8ap8!HK@A(H8ap8!HK@A(88apHA(8c8x$| *K5`x 8pHe`H,%A8ap8!HK@IA(H8ap8!H8'K@1A(8 8apHA(8c8 x$| *K`x(8pH`,%A8ap8!HK?A(H8ap8!H8(K?A(8!8apHA(8c8!x$| *K5`x08pHe`,%A8ap8!HK?IA(H8ap8!H8 K?1A(8"8apHA(8c8"x$| *K`x88pH~`|+yA8ap8!HK>A(H8ap8!H8'0K>A(8$8apHA(8c8$x$| *K1`x8pH~a`|+yA8ap8!HK>AA(H8ap8!H8')A(8%8apH A(8c8%x$| *K`x8pH}`X,%A8ap8!HK=A(H8ap8!H8'HK=A(8&8apHA(8c8&x$| *K-`x8pH}]`h,%A8ap8!HK=AA(H8ap8!H8'\K=)A(8'8apH A(8c8'x$| *K`x8pH|`,%A8ap8!HK'xK<%A(8-8apH~A(8c8-x$| *K`xP8pH{`88ap8 8X8'9H9>K;A(8.8apH}A(8c8.x$| *K9`xX8pH{i`88ap8 8X8'9H9>%K;EA(8/8apH}%A(8c8/x$| *K`x`8pHz`88ap8 8X8'9H9>&K:A(808apH|A(8c80x$| *KY`x@8pHz`b, A%!pK+A(88aHmA(8c8x$| *K a`xh8Hk`@8a8 d"8X8H!p9%9^HK+eA(88aHmIA(8c8x$| *K `xp8Hk`@8a8 d"8X8H!p9%9^HK*A(88aHlA(8c8x$| *K y`xx8Hj`@8a8 d8X"!p8H9%9^HK*}A(88aHlaA(8c8x$| *K `x8Hj5`@8a8 d"8X8H!p9%9^HK* A(88aHkA(8c8x$| *K`x8Hi`@8a8 p8XK)A(88aHkA(8c8x$| *K-`x8Hi]`8a8 8X8%9H:%9>%K)5A(88aHkA(8c8x$| *K`x8Hh`8a8 8X8%9H9>%K(A(8 8aHjA(8c8 x$| *KQ`x8Hh`8a8 8X8%9H9>%K(]A(8 8aHjAA(8c8 x$| *K`x8Hh`;,9AX8c#Hk`,A,c%8a8 8X9H9>tK'A(H<%҈~%ԐaH(8a8 8X9H9>tK'A(8 8aHiuA(8c8 x$| *K`x8HgI`;8c#Hk`,A,8 8a8X8x9H9>K' A(H8ac$Hf`8 8aHhA(8c8 x$| *K}`x8Hf`8a8 8X8%9HbK&A(8 8aHhmA(8c8 x$| *K`x8HfA`,%A 8a8 p8XK&A(H 8a8 p8XK%A(88aHgA(8c8x$| *K`x88He`8a88X8\9>H9^d8K%A(88aHgqA(8c8x$| *K`x08HeE`88a88X8\9>H9^lK%A(88aHgA(8c8x$| *K`x88Hd` .$Al8aHd`8a8.HiA(,#A8 . A4@8a8 dp8X89X9>%9^HK$eA(H(8a8 8X8%9HbK$=A(88aHf!A(8c8x$| *K`x8Hc` , @,8a8 8X8%9HbK#A(H0@88ap8 d8X9X9>%9^HK#A(88aHeyA(8c8x$| *K`x 8HcM` , @08a8 8X8%9H;>%9>%K#A(H4@88a8 d8X9X9>%9^H;>%!pK"A(88aHdA(8c8x$| *Km`x8Hb` , @,8a8 8X8%9Hc)K"mA(H0@88a!p8 d8X9X9>%9^HK"=A(88aHd!A(8c8x$| *K`x8Ha` , @088a8 8X8%9H:9>K!A(Hl8,%A08a8 d8X9X9>%9^H:pK!A(H08a8 d8X9X9>%9^H:pK!UA(88aHc9A(8c8x$| *K`x8Ha ` , @,8a8 8X8&9Hc)K A(H0@88a!p8 d8X9X9>&9^HK A(88aHbA(8c8x$| *K5`x(8H`e` , @,8a8 8X8& 9Hc)K 5A(H0@88a!p8 d8X9X9>& 9^HK A(88aHaA(8c8x$| *K`x08H_` , @,88a8 8X8&9HbKA(Hd8,%A,8ap8 d8X9X9>&9^HKUA(H,8a8 dp8X9X9>&9^HK)A(88aHa A(8c8x$| *K`x88H^`88a8 8X8&9H9>hKA(88aH`A(8c8x$| *KE`x@8H^u`88a8 8X8&$9H9>hKQA(88aH`5A(8c8x$| *K`xH8H^ ` , @,b8a8 8X8&,9HKA(H0@88ap8 d8X9X9>&,9^HKA(88aH_A(8c8x$| *K1`xh8H]a`8a8 p8XKEA(88aH_)A(8c8x$| *K`x8H\`8a8 8X8&89H9>dKA(88aH^A(8c8x$| *Ka`x8H\`8a8 8X8&89H9>lKmA(88aH^QA(8c8x$| *K`x8H\%`8a8 8X8&89H9> KA(88aH]A(8c8x$| *K`x 8H[`8a88X89>H9^&@KA(8 8aH]uA(8c8 x$| *K`x8H[I`b, A!Bab8,%Tz8|x$|*A8,%AX , A K`K `| @0H | @$ , A K`NAH NBA8ap8 0KA(8 8;b0ccKA(8p8{@Hx$x&|B|0*KA(ccK`8P0Xb`p|% @A |%0@@bh|%@@@88 p 8H8hp;hpKAA(,=AL8ccHUA(88cx$| *K`cdHR``{~, T`zA8, A ,#A Ka`KY`| @H |` @Ĉ , A K-`8;8 0cKiA(cg8@Hx$x&|B|0*@K1A(cKE`8P0Xbhp|% @`A |%0@@|%@@@8cc*} 808! |AaN Cl BrRunIdBuild`T>aAb|B8,'!a|Tzy$8|*A<,'A , A K}`Ku`b| @H | @Ȉ , A KE`8;8 0cKA(c@8|Hx&x$|J|0*KEA(cKY`8P0Xbh`|&(@pA |&8@@|&(@@8c 8|8;|8HO`8|88X, @ , A, /@HUE`H8ZccHU1`ccHU!`,>AP8ccHQYA(88cx$| *K`cdHO1``{b, A`|b|aA}&B8Ȉ~!a,$8c~|dx$|*AaA!T>bb|8,'!1|8xc$| |*A,pA , @LKι`b| @܈ , @8ap8#KA(;B 880cCKA(@8z8pHx&x$|"|@*KA(cCKљ`Pb0|#@AX|#@@b`8bhp0|$@@8b, @x,9B ;:@@@c#HA``wb, @d@, +AX;(@P@, +A,<@lb, | A,pA , @4K)`b| @Ĉ , @; 880cKIA(@8bHx&x$|"|@*@K A(cK!`Pb0|#@AX|#@@b`8bhp0|$@@8b8!}!A8aN K`KK`K8c#HA5A(8c8x$| *K`c$H? ``wKLc#c78/HDUA(|y@D;c?;`!HA=A(;p`@,>A8/Kb8/HCA(|~yA8Kc7c#H@mA({H8|0*| N |cKIA(Kx|cK5A(Kd|c KA(KH|cKA(K0|c KA(K|cKA(K|c KA(K|c KA(K|c KiA(K|c( (KEA(Kt|c8 8K!A(KP|cH HKA(K,|cX XKA(K|ch hKA(K|c KA(Kc7c#H>uA(8?|, /@|@, +@c#8/HAA(,#Al, @`c#HA`c#8XHA`8$c#HA`c#8XHA`K8XbHA`@, +@Kxc#H;``wb, @(K_8$cCH?y`,At, +@l|`yA, +@8bK@PK(q,#A,@8`8bKPcCK(-,#A,@8`KdK}`KKq`K"A ` BrArchNameGet`;;aA;`!; ;aAb|!B8,'!|Tzxc$8|*A,'A , @KƉ`b| @ , @8:8 0bKA(8w@Hx&x$|"|@*KmA(bKɁ`P0Xbh`|%@pA |%0@@|%@@8%%:%Z%z% $$ $z$``!8p%|*:Y|c(,#%@T,|:,/&t/Al/&T@H|a:;tpbY/@ ;` @;`@;`@c;:Y$bY| ,$@h,<Ab, A`pA , @@Kĵ`b| @ , @8;8 0cKA(8}@Hy&x$}B|0*@KA(cKǭ`P0Xbh`|%@pA |%0@@|%@A`c08! }!Aa8!AaN KÅ`KKy`K| @K8apH8A(88cx$| *KQ`8pH6`K<@K@K;`@K,&sA,&S@l|a:;ctpbY,,//@8;` @(;` @;`@;`K@;`K@K;`@K,&rAx,&R@d|a:;pbY,,/@8;` @(;`@;`@8;`K0@,;`K$@K;` @K;|d9K |a:;tpK|a:;crCpK;p%rKK`K`K`K0| @K< A BrArchFormGet;|aA`z;!aA!xbb!8 ~,$8c~|cxc$|*ApAb , @\K`| @b , @, 8;"08c#KA(@8yHx$|0*x&|"KA(c#K`Pb0|#@AX|#@@ b`bhp0|$@@8 cC<:8rU88K}ax8$H4A(,#@bc,#AdpAb , @@K`| @b , @ 8;08cKA(@8}8Hx$|0*x&|" KyA(cK`Pb0|#@AX|#@@ b`bhp0|$@A`8`808! }!xAa!AaN Ka`KKU`K| @K8`zax8)8Kiaax8/H6A(,#AP`x8z H3YA(`yaH9A(",#@|~82"9Bpxg$c|8* K!`bc,#ApAb , @Ki`pAb , @ 8;b08ccKA(@8{8Hx$|0*x&|" KQA(ccKe`Pb0|#@AX|#@@ b`bh0| @A`8`8KK`K!`U>W>`U8>!ba8,b8|,'y$cTgz|)*A<,'AX , A Ki`Ka`b| @,H |` @  , A K1`NHNB~Ab8ap8$pbK]A(8 8:0bK9A(8p@8vHx&x$|J|0*KA(bK`8P0bhp|% @AX|% @@ `|%0@@8,:@,@$<`ffW8fg|| |cp||A(,9@Lbn, A@8,@08$|b 8Xbb;D8cDK-A(HX8$b 8Xbb;D8cDKA(H,8$b 8Xbb;D8cDKA(,8AP8cH+A(88cx$| *KQ`cH)``b, A;;@|!}&::aA;!: xp9"~!1b8c~|c,%xc$ Aa$$P!8<|*A#,pA , @# K}`| @b , @" 8;"08c#KA(@8yHx$|0*x&|"KaA(c#Ku`Pb0|#@AX|#@@ b`bhp0|$@@8b#,9A" c#H'A(`wac$bH'A(,A!b 8c55 ,@L::,$@ :|@,:,$AaH)a`,@;5$,@T:b 8cH:,$@ :|@,:,$AaH)`,@;a8/H*mA(,#A ,?AHbX; P.8p0@:7 `} (@hb}@@, @ \H(`|`4T@ A_,@, A,@, A4xy@,:A, Abc,#AxpAb , @TK`| @b , @  8;08cKA(@88Hx$|0*x&|" KA(cK`Pb0|#@AX|#@@ b`bhp0|$@A`8`88!|px} !Aa!AaN Ki`KK]`K| @tKbc,#ApAb , @K`| @b , @ 8;08cK-A(@88Hx$|0*x&|" KA(cK `Pb0|#@AX|#@@ b`bhp0|$@A`8`8KhK-`K8K!`K| @Kbc,#ApAb , @K`| @b , @ 8;08cKA(@88Hx$|0*x&|" KA(cK`Pb0|#@AX|#@@ b`bhp0|$@A`8`8K,K`K8K`K| @Ka8:H%A(|ryA 8H#`,2,@ Y8A:28r8:H%5A(8|ryAp~y@,0A ,2A 2KK088bp8KqA(b%8b8cx&| *KMA(8bKa`;@LJpBAKb$p``!H"`,b$AT~yAlpKA8:KH"`,@TY8_K<_@aH A(,2`e@$H UA(|`4TA, AP, @B, @', A_,2@@, Abq, @, AHP, @', @B, Ab8, ),ABP"p@x8b8PbF8KݩA(8bx&8c| K݅A(8bK`|2@@c_8K8b8PbF8K5A(8b8cx&| KA(8bK%`|2@@K@x8b8ZP8KA(8b8cx&| @KܭA(8bK`Pbp| @@c_K 8b8Z08K]A(8b8cx&| HK9A(8bKM`BP"X|.@|@LB0BA0bp| @@|KtXP,#Al@k_Kt8, AY@_KPa8DI_K8, @< , @0KH$A(|`4T@KH$A(|`4T@AKa#.9-Ac#H -A(,A,90Aa;#A`y,8Ac7c```!HA(,Ad;9:,8c@.8-@ y-#-AHA(,AL@yHA(,A4a`nHA(Tw>a8$XH)`|`4T~A<` 84T~| A|@ ,?|&| A\c.1!bH::`/,A} >@~@4`BhT~8|&,&}`&,a|`&,%a |&,1(|&0a|h ,LFL3BLLBsBAAy |A<0(T>| |d LFAPy |A@|A4a,#AyP,#@ЈxB,#@Ĉx',#@,@| LALBsBA a|Ad| Aa|h LAA|h | LA1A  |A|@, @`, A0a8P,#,@DB,@8',@,8, A8,@aȀ |@@Ѐ a|Ax@,#AԀy4, A,AyP,#@px',#@dxB,#A8 b,), A 4bpP} @@ 8b8P`8K5A("H8bx&|8c K A(8bK!`@c 8`a| LBqAX,@xx!,#Ax,#Ax,#A؈x,,#@bc,#@bc,#@x,#@x@,#@xA,#@,@Ј%, @4, A, @, AY, A,, @b, @x, @l@, @`A, @T, A(B, @4P, @(', @8, A8, A , Aa8,#@ t,$@@Ԉ@, AȀ4,AP, @ $', @ B, Ab 8,), AbpP} @@|8b8P`8KA("H8bx&|8c KԩA(8bK`@c88`a, Ä, Ab, Ab0#~ yA, A```!8/yH}A(:8|oyA-.@XyH9A(,A,.@,/Ao,0Ap1~ yA, @9x y@8, @a,#@,=Aa,#@a|h Axcb0c``!,=,@Y@,=,c8$`L3BAH`,8@9x y@, Aa|@b PpH,%B@~$@A(b), @8b8Pp8K}A(8bx&8c| KYA(8bKm`AXbp|#@@ b`bh;@a|Ad|ebHP; Xp|: |(P@ :# :b`Bh:6~$@-}$@|cc|| A```! |@ ,$,LBqL2AxAtcx|fy@@L8ap8$lKMA(, A8P8bp8), @t8K A(8p8b8cx&| *KA(8bK`Ap| @@;@;9|9@A,:@KKy8/HA(|qyA8:yH IA(88cx$| *K`yH %`9,=КqAc8$`H`KP,=@bKc8 :H`,@$b8cyЛ_,=@K8b8P`8KuA("H8b8cx&| KMA(8bKa`@HK@@|8b8ZP8KA("H8b8cx&| @KA(8bK`Pbp| @@c K8b8Z08KəA("H8b8cx&| HKqA(8bK`0PX|0x@|p@LB0BA0bp| @@tKlXyP,#Alk K$,=A a|@ Y,=@  Kc8$XH `,A@,=Ac8$\H `,@Y8` cyK񜛙Yy8/H A(|qyA8yH EA(88cx$| *K`yH!`КqKXy@c,#Abcq,#@0a,#A\yP,#@$x',#@xB,#A8 b,), AbPp}#@@x8b8PP8KuA("H8bx&|8c KMA(8bKa`@c8`aK\8b8PP8KA("H8b8cx&| KA(8bK`@K@|8b8ZP8KƝA("H8b8cx&| @KuA(8bK`Ppr|$@@crK8b8Z08K%A("H8b8cx&| HKA(8bK`0PX|0x@|p@LB0BA0pr|$@@tKlXyP,#Aly@kKh8, AYy@KDa8`DIaK쌈y8,#@4x ,#AtK$:8yHA(Tu>Њ,60AT,6-;9Aby.#A``!H A(,Ay;9.#AK@KꄈyH A(|`4T~Ka`nH)A(Ty>!a8$XHU`|`4T~K0,8.8-A @K@K!yH QA(|`4T~K,xH 5A(,AKaHA(|#@@0;K(b#c#KK`K$Ku`K| @ݼK C$$ BrDbfSelect```;aA`!`aA!xpbb|}&MbB8,'MjB|xc$8H!|*ApA , @KQ`b| @db , @H,:@,{pat8ap8LH `.>A8apcH`8ap8LH`,9A8apc$H`8ap8LH`,=Ax8apcH`;B 880cCKA(@8z8pHx&x$|"|@*KA(cCK`Pb0|#@AX|#@@ b`bhp0|$@@8Ab, A, AcHA(`xcH A(,?AB0P~:@A X|:@A H|dp":bP8>:e#Bh~:@;@/~!":\}#@X, A, ADY, A, A,a, A, Ab, Ä@, A, A, @P8aXHA(8c8x$| *K`8XH`, A, @ , A, /A@, Ad@L,/A@, A xy@Mi@ b, @H, @b, AxpA , @XK`b| @b , @$; 880cKA(@88 Hx&x$|"|@*@KA(cK`Pb0|#@AX|#@@ b`bhp0|$@A`d} 8 8!|px!Aa!AaN K`KKu`K| @tK; 88 0cKA(H@88$$x&|"$KyA(cK`Pb0|#@AX|#@@ b`bhp0|$@@8K; 88 PccKA(H@88$$x&|"$KA(cK`bhp`|>@@8b, @9D#b`B@" }:\AHP} 0@X, A, ADY, A, A,a, A, Ab, AЈ@, Ab, A, @\8aXHAA(8c8x$| *K`8XH`, A, @ , A, /A@, At@\,/A@, AxyA0Kacc%HeA(,@|zP8oXHy`,A\,@9b8aXHAA(8c8x$| *K`8XH`b, @ , AD, /A88/HAA(,#A 8/``!H!A(8/,#@K8aX8/HA(,#A8X, @(8/XK8aXcHi`K8/HA(,#A8/`!HA(8/,#@@K\, A KK8aXH`8aX8/HIA(|oy@A, Ax8b88PKA(8b8cx&|`KA(8bK`@cMiK8/8oHA(|ny@A, A8b8P8KA(8b8X8cx&|`KA(8bK`@cMiKl8oHA(,AA, @ K<8b8P8KuA(8b8X8cx&|`KIA(8bK]`@cMiK8oH`8/HYA(8/8cHIA(`d8aXHu`b, Al, @`@, @T8aX8/HA(,#A<K48aXcH}`cc%aH5A(,A,Ah,A@, @b, @, @8b880KA(cH8bx&8c| *KA(8bK`X|:p@LRBAbp|:@@cMabc|yA,a88)8KQ`d8aXHe`K8aXaHQ`K8b88PK1A(cH8b8cx&| *K A(8bK`@LKD8aXH`K||P8oXH`b, @X,AL\,A@8aX8/HA(,#A(X, @8/XK BH"@8bx&| *HE``x8bK~U` 8b880KA(8xccx&|5`KA(8bK~`Pb0|#@AX|#@@ b`bhp0|$@@8Kp88apH-`K88apH`KP88apH`K8apcDHQ`KKy`K,>AKKy`Kt| @K Cl BrHomeReplace`|abb8X~!,$8c~|dx$|*Ab8`,$!8c|dx$|*A8pA@~ ,#A Kl`Kl`| @H | @  , A Klq`,;bFA8ap8#KA(H8ap8#KA( 8;B08cCKmA(@8z8pHx$|0*x&}"K9A(cCKoM`Pb0|#@AX|#@@b`8bhp;@0|$@@8H;@b , @,, @ , @,;DA8DH ||p|2,DA؈],@A\8`8HA(8|#(@@`8B89bp"xg$ccD|8*K!`|, AlH X( A`dX, @,8`dHcdH5A(8|#@@`9`8B8bp"xg$9ccd|8*K}`, AH`( A``cde`8`HܡA(8|#@@`9@8"8bp9ccGyg$|8*K`, A(Hh( A`dh8`8HA(8|#@@`9@8"8bp9ccGyg$|8*KY`, AH\p( A`dpHlbX,$A8`HqA(8|#@@`9`8B8bp"xg$9ccd|8*K`, AH8bXb, @ `,$A8`HA(8|#@@`9`8B8bp"xg$9ccd|8*K`, A\H 8b`bh,$A8`HEA(8|#@@`9`8B8bp"xg$9ccd|8*K`, AH8bhbp,$A8`HٵA(8|#@@|9@8"8bp9ccGyg$|8*K`, A<pA~ ,#A KfQ`KfI`pAH| @H |` @ , A Kf ` 8;08cKEA(@8~8Hx$|0*x&}" KA(cKi%`Pb0|#@AX|#@@ b`Cbh0| @A`C8`8H08bpHg=|, A8p`A~ ,#A Ke`Ke `| @H |` @Ĉ , A Kd` 8;08cKA(@8~8Hx$|0*x&}" KA(cKg`Pb0|#@AX|#@@ b`Cbhp0|$@A`C8`8 8!}AaN A , BrOraSigPatch|}&aA!`|```aa4b!A88cH|ex$p|*AP , A Kc`Kc`pA$x ,#A Kb`NAH NBA8apHH-`b0,@h8apHױA(,#AL8/HYA(|wyA88b8pHץA(,A8w8*cH `y, A88ap8H=A(,#A8*8cH ` 8;08cKMA(@8x8pHx$|0*x&}"KA(cKe-`Pb0|#@AX|#@@b`8bhp0|$@@8Hb,<$ $"XZA(8aXcH1`8aX8XH`8aXHH `,;A(8aX8LH`8aXcdH`8aX8 PH`,:AL8aX8Hٱ`8|:@@8aX8Hّ`H8aXcDH}`,9Al(9AP8aX8 DHY`8|9@@8aX8H9`H,8aXc$H%`H8aX8H `,6Al(6AP8aX8$ H`8|6@@8aX8H`H,8aXbHص`H8aX8 HH؝`8ap8XH`b0,@h8apHqA(,#AL8/HA(|{yA88cc8pHeA(,A8{8*cH `y, A88ap8HA(,#A8*8cH `pAb , A K^`b;B 8;"0c#8KA(@8yHx$8#| *x&|KA(c#Ka`Pb0|#@AX|#@@ b`hpb0|#@@8c#8px&|@K1A(c#KaE`H;HA(,@9`8'Bb"x$8p9d8|8*K{`b 8 b;B8cCKA("H@8z8px&|!`KuA(cCK``P|4@AX|4@@ b`hp|4@@cpAb , A K\`K\`8cC08KA(8z8x&x$||0* KA(cCK_`0| @Ab0X|#@@ b`b0|#@A`8`88!} |!AaN ,aP@ b8X88HcP`dHA(9`8)Bb8p"x$9dH|8*Ky` 8 b;b8ccKuA(H@8{8px&|"!`KMA(ccK^a`P|4@AX|4@@ b`bhp|4@@c@88`KJ`bPp8Ab , A KZY`KZQ` 8;08cKA(H@8~Px$x&|0*}" KUA(cK]i`Pb0|#@AX|#@@ b`bhp0|$@A`aP`88!} |!AaN C  x BrProgStart|}&aA`}`!`!QbP88p|x$|*A |b , @ tKX`bpA T , @ x 8A@`8`8!|!A} aN `8!|} !AaN T>x KA(cKW`A$KKT]`KtbhKTI`;bB 88 cccKA("H@8{8trx&|!@KYA(ccKWm`P}?@AX|?@@ b`hp~?@@b8b88 cKA(8{8tx&|! KA(8bKV`AX|?@@ b`@bbpAb , @KS`8b880K]A(8{8x&| x$|@*K)A(8bKV=`0| @Ab0X|#@@ b`b0|#@A`8`} 88!|!AaN KR%`Kxd9|!";@8,{;`cB8t9 k!.L`eyi$|H*Kp9`Pp;bB "H@}?@h~?@Kxdd8!`z%!.K HqA(,pbBAb8H88\cP`dHεA(89@)"Hbc8t9\ x$|8*Koy`; 88 ccK5A(H@8|8tx&|"!`K A(cKT!`P|?@AX|?@@ b`bh|?@@b@88`K@`K89`("8Bc@9| x$|8*Kn`K8"9'Bbc8t9 8x $|H*Kn5`Pp;bB "H@}?@h~?@KKO`K:K8at8HqA(,#A8*8cH `Kl8/HA(|}yAL8pc8HMA(,A08*8}cH `K8L8a\H`8a\cH`K8a\cH`8X8a\Hǹ`Kp8atPH`y,@ 8atHÍA(,#@By, @;b 880ccKA(@8{8tHx&x$|"|@*KmA(ccKQ`Pb0|#@AX|#@@b`8bhp0|$@@8KX8at8H­A(,#A48*8cH `K8/H9A(|zyA8pcC8H‰A(,A8*8zceH `KKM1`KNBKKM`K C   BrProgDetach|}&aA!`|```aaTb!A88cH!P|ex$p|*AP , A KL5`KL-`pA$x ,#A KL `NAH NBA8apHHI`b0,@h8apHA(,#AL8/HuA(|wyA88b8pHA(,A8w8*cH `y, A88ap8HYA(,#A8*8cH ` 8;08cK~iA(@8x8pHx$|0*x&}"K~5A(cKNI`Pb0|#@AX|#@@b`8bhp0|$@@8Hb,<$$ XZA(8aXcHM`8aX8XH9`8aXHH)`,;A(8aX8LH `8aXcdH`8aX8 PH`,:AL8aX8H`8|:@@8aX8H­`H8aXcDH™`,6Al(6AP8aX8$ Hu`8|6@@8aX8HU`H,8aXbHA`H8aX8 HH)`,9Al(9AP8aX8 DH`8|9@@8aX8H`H,8aXc$H`H8aX8H`8ap8XH `b0,@h8apHA(,#AL8/H5A(|{yA88cc8pHA(,A8{8*cH `y, A88ap8HA(,#A8*8cH `8`K,@b@,@8pAb , A KG`b;B 8;"0c#8KzA(@8yHx$8#| *x&|KzA(c#KJ`Pb0|#@AX|#@@ b`hpb0|#@@8c#8px&|@Kz%A(c#KJ9`H;8aXPHiA(,#@@8`dKe,@b@,@c"89*h 8b8b8vKyA(B@8pbH8bx$8c| *x&|x $|H*Ky9A(8bKIM`"P~4@AX|4@@ b`hp}4@@c 8b8b8KxA(x&b|HA(`f8bbb8cKxA(8bKH`AX|4@@ b`@c 8b8b8Kx9A(8b8p8cx&|"KxA(8bKH)`AX|4@@ b`@cpAb , A KD]`KDU` 88b08KwA(8b8c8x&x$||0*@Kw]A(8bKGq`0| @Ab0X|#@@ b`b0|#@A`8`88!} |!AaN PaXbHp88fdA , A KC`KC ` 8;08cKvEA(H@8~Xx$x&|0*}"HKvA(cKF%`Pb0|#@AX|#@@ b`bhp0|$@A`aX`88!} |!AaN C  BrPipeOpen|}&aA`|`!b!Q8`8p|x$|*A$b , A KAU`KAM`8ap`H`b0c,@d8apH!A(,#AH8/HA(|}yA48pc8HA(,A8*8}ceH `by, A48ap8HA(,#A8*8cH `bpAb , A K@e`; 880cKsA(@8}8pHx&x$|J|@*KseA(cKCy`Pb0|#@AX|#@@b`8bhp;0|$@@8H;4bp A"h 8b88cKrA(@H8p8b8cx&|"!KrA(8bKB`bP~?@AX|?@@ b`Bhp}?@@c8b88cKr9A(b@H9c#x&|"H1A(`f8bc%c8cKqA(8bKB `A`HPcHeA(`|HP8`88K!,@b@,@c,@\B8+ b"h888bcKqAA(@8pH8b8cx&y$}J|8*x $|H*KpA(8bKA`bP~?@AX|?@@ b`Bhp}?@@c8b88cKpA(b@H9c#x&|"HA(`f8bc%c8cKpEA(8bK@Y`AX|?@@H{!APbhK<` 8b88 cKoA(@H8pcf8b8cx&|"!@KoA(8bK?`bPpBh~?@}?@AX|?@@ b`@c8b88cKoUA(@H8p8b8cx&|""Ko)A(8bK?=`AX|?@@ b`@cbpAb , A K;m`K;e`8b880KnA(@8H8b8cy &x$}J|0* KniA(8bK>}`0| @Ab0X|#@@ b`b0|#@A`8`} 88!|!AaN X,@ HA(bpAԈ ,#A K:5`K:-`; 880cKmiA(@W>8Hy x&x$|J|@* Km)A(cK==`Pb0|#@AX|#@@ b`bhp0|$@A`W>x p8!}a8N C  BrPipeClose`|}&aA!`a`a;`z!!p pA xA" , @K8}`pA , @8, ZA ,>A 8a`cH`8a`8XH)`8a` pH`,7@ P {Cd%, @ !, @ 8apHA(,A d8`Kʭ,A 8pA $b , @ 8 8:0b8KjA(BH"@8v8#8#x&|KjA(bK:`Pb0|#@AX|#@@b`8hp:b0|#@@8b8`x&|@Kj-A(bK:A`B:HA(:`z,A ,@,=@ ,<A (<@ D.;AP(;AHxcc88$HA(,#@$8b8h8  P8b;w8cKiYA("@8`;#BH8#8bx$8c|(*x&|Ki A(8bK9!`P~8@AX|8@@b`8hp:}8@@8 8bcd8cKhA(x&b|HA(`f8bbb8cKhaA(8bK8u`AX|8@@ b`@8 8bcd8cKh A(8b8`8cx&|"KgA(8bK7`AX|8@@ b`@b8pc%!-1Ab , @K4` 8bcd80Kg]A(8b8c88cx&| Kg1A(8bK7E`0bP| @Ab0X|#@@ b`b0|#@A`8` 8! |} !AaN K31`K a x8DHY`,@|!vx,<x;A (<ALA$(;@8`8H9A(,A #H!A(,AarH5A(,AavH!A(,Ax8 8`8 `;#8#ؐKD}`RTVHA(,A 8b8&K8a`8LHA(,#A(;``|aH;!H8`8L`!HA(;{y,#;9A8`8L(;cAԈ, /@c8HHmA(h88b ! P8bc&8KdA(@8`cH8b8cHx&|KdiA(8bK4}`P~9@AX|9@@ b`hp}9@@b8c&8b8KdA(x&c|HA(`f8bcb8cKcA(8bK3`AX|9@@ b`@b8 c&8b8KcqA(8b8`8cx&|!`KcMA(8bK3a`AX|9@@ b`@b@88`K/!HP88`^!-188KI,Ada x8DH`,@pav%|cHA(,ApAb , @K/`; 880cKbAA(H@888#8x&|" KbA(cK2%`Pb0|#@AX|#@@ b`bhp0|$@A`8`KK.Q`KD8b8=Ka x88Ha`,AԀt%ar|cKb@,@bKc8HHA(KL8 8d"p8ba$c;i8K`A("@cBH8b8c8#x&| K`A(8bK0`P|<@AX|<@@ b`h PP}8@~8@KL8 b8=K8 b8=K8 b8AK8 b8AKt8`8HA(,@88AbK@a x88H`,AH;!r,<A\KPxc8X8$HeA(,#@8b8Kxc8DH)A(,#@T8b8Kb88'KxK+`K:Kb@,@8K8b8@K,: 8dp8bc;w8K^A(BH"@8#;#8b8#8cx&| K^MA(8bK.a`P|<@AX|<@@K8a`8LH`8a`bH`K8a` pH`Kt8ax"cE p8#K]A(; 880cK]A(H@8x88#8xx&|"K]yA(cK-`Pb0|#@AX|#@@b`8bhp0|$@@8KpK)`KT8, KPK)`K C l BrPipeCreate```}|aA}&!`f!, APp`A , @0K(`b| @b , @ {d~-|,dA<`bT8cM|e|c6p|xUdx.|dPx$||(P,A{d^%, A,@; b;%b`!,@|xڪ&|@8@HIA(,A(9|P|AAD8 8d;bBpc8cFK[A(H@8|8#8#x&|" KZA(cK+`P|:@AX|:@@b`8bh8bpAb , @t{d8a8|88"\-KZmA(; 880cKZIA(H@8|88#88x&|"@KZA(cK*-`Pb0|#@AX|#@@b`8bhp0|$@@8{d8b|8-1, A,bpAb , @TK&`8` 8!|} !AaN K%`KK%`Kz-8cz-pA` , @|f,d@<b88MT8c| |6p|*xUdx.|Px$|"|P,Ab, A,bpAb , @HK%`8`8!}!AaN K$`K8a88"\KXA(; 880cKWA(H@8~88#8x&|"@KWA(cK'`Pb0|#@AX|#@@b`8bhp0|$@@8KK#`z-|fKd8b8?Bh8c" :8bKVA(H@8w8#x&|`x$|@*KVA(bK&`P}?@AX|?@@b`8hp;`~?@@88b88cKVMA(Zx&cC|$HMA(`f8wc$cEKVA(8bK&)`AX|?@@ b`cA`|K0|HA(,AKX8|@`K8 8d;bBpc8cFKUuA(H@8|8#8#x&|" KUEA(cK%Y`P|:@AhX|:@@hKX8apBc8"\KUA(;" 880c#KTA(H@8y88#8px&|"KTA(c#K$`Pb0|#@AX|#@@b`8bhp0|$@@8-,AKK `K  {d|~-,AxKXK `K|` @K C  BrPipeWrite``|aA}&!`z`|!, A p`A  , @ K`| @ ` , @ HT zd@1|,dAX<`bT8cM|e|c6p|xUdx.|dPx$||(P,A zd  %, Ax,@`;b c`:%````!,@|vҪ|@8@HaA(T`>,A, A||PAA<8 8d;bBpc8cFKRA(H@8~8#8#x&|" KQA(cK!`P|:@AX|:@@b`8bh8pA , @tzd 8a8|8"\1KQYA(; 880cKQ5A(H@8~88#8x&|"@KQA(cK!`Pb0|#@AX|#@@b`8bhp0|$@@8zdb 88|c,%-1A$pA , @XK `8`pj8!`|} !AaN K`KK`Ky18cy1pA\ , @|f,d@<b88MT8c| |6p|*xUdx.|Px$|"|P,A, A$pA , @PK `8`p8!`}!AaN K`K8a88"\KOA(; 880cKNA(H@8~88#8x&|"@KNA(cK`Pb0|#@AX|#@@b`8bhp0|$@@8KK`y1|fKhpAԈ , @D18a888"\KN A(; 880cKMA(H@8~88#88x&|"@KMA(cK`Pb0|#@AX|#@@b`8bhp0|$@@8, A$pA , @PK`8`p8!`}!AaN K`KK`K8b8>Bh8c" :8bKLA(H@8w8#x&|`x$|@*KLQA(bKe`P}>@AX|>@@b`8hp;`~>@@88b88cKKA(Zx&cC|$HA(`f8wc$cEKKA(8bK`AX|>@@ b`cA`K|HaA(T`>,AK8|@KD8 8d;bBpc8cFKK A(H@8~8#8#x&|" KJA(cK`P|:@AX|:@@K8ap"b8"\KJA(; 880cKJyA(H@8x88#8px&|"KJIA(cK]`Pb0|#@AX|#@@b`8bhp0|$@@81,ATKK}`KT zd|`1,A(KKQ`Kh|` @Kp C  ( BrPipeRead|}&aA``}!0pA , A K`K`bpA~ ,#A K}`8a<0c8#KHA(; 880cKHA(H@8|88#x8<x&}"KHiA(cK}`Pb0|#@AX|#@@b`8bhp0|$@@8H {d@%|, A!, AHA(,@ 88`=}H`z!8p8HA(HP,e88@x8b8,h8c 8b8KG!A(@H8by$8c8#xx&|@*|J`KFA(8bK`P~?@AX|?@@b`8hp}?@@8 8c8b8KFmA(@Hcx&|"eHeA(`f8bccd8cKF)A(8bK=`AX|?@@HbppAbhK}` 8 c8b8KEA(@H08br8cx&|"!@KEA(8bK`Pph~?@}?@AX|?@@b`8;@8H8b%!cTcz,A ,AK`ppb PH0@-1~% @cAx8a88#8ax 8#zx 8!p|Aa} N ; 8dp8bc8KCA(@H8b8c8#8#xx&|" KBA(8bK`P|=@AX|=@@ b`hP}?@~?@8 88bc8%!KB]A(@H08b8cx&|""KB1A(8bKE`AX|?@@ b`@cbpA , A Ku`8at81-8#8K>A(H@8#l:#`8b8#`8cx&| K>}A(8bK`P|:@AX|:@@ b`BhHa8 LH `,@$a8H1A(T`?})@H a8HA(})T`?@B89<h;<8b 8b8cK=A(H@:#`8#`8b8cx&|x $|H*K=MA(8bK a`P}>@AX|>@@b`8BhBp;~>@@88bc$8cK@@ b`@88pc)-1Ab , A K`K`8bc$80K<A(8b8b88cx&| K;A(8bK `0| @Ab0X|#@@ b`b0|#@A`8`pj8!`|Aa} !AaN 8pc-1Ab , A K`K`; 880cK:A(H@888#`8x&}" K:A(cK `Pb0|#@AX|#@@b`8bhp0|$@@88`pj 8!`|} aN CT BrTapeOpen```}|aA}&!`f!, Ap`A , @K%`b| @`b , @D {d~-|,dAT<`bT8cM|e|c6p|xUdx.|dPx$||(P,A{d^), Ax,@`; b;)<@b````!| |xڪ&|@<@HyA(T`>,A,9@(<@||PAAD8 8d;bBpc8cFK8=A(H@8|8#8#Tx&|" K8 A(cK!`P|:@AX|:@@b`8bh8bpAb , @t{d8a8|88"\-K7A(; 880cK7iA(H@8|88#T88x&|"@K79A(cKM`Pb0|#@AX|#@@b`8bhp0|$@@8{d8b|8-1, A,bpAb , @TK5`8` 8!|} !AaN K`KK`Kz-8cz-pA` , @|f,d@<b88MT8c| |6p|*xUdx.|Px$|"|P,Ab, A,bpAb , @HK%`8`8!}!AaN K`K8a88"\K5%A(; 880cK5A(H@8~88#T8x&|"@K4A(cK`Pb0|#@AX|#@@b`8bhp0|$@@8KK`z-|fKd8`b8?, |Ab,@PBh8" 8c:8bK4A(@8w8#THx$|(*x&|`K3A(bK`P}?@AX|?@@b`8hp;`~?@@88b88cK3YA(Zx&cC|$HzYA(`f8wc$cEK3!A(8bK5`AX|?@@ b`cA`|KBhK8b8?bK|H~}A(T`>,AK8|@KT8 8d;bBpc8cFK2MA(H@8|8#8#Tx&|" K2A(cK1`P|:@A X|:@@ K8apBc8"\K1A(;" 880c#K1A(H@8y88#T8px&|"K1A(c#K`Pb0|#@AX|#@@b`8bhp0|$@@8-,A\KK`K {d|~-,A0KK`Kd|` @Kp C  ( BrTapeWrite``|aA}&!`z`|!, A p`A  , @ K`| @ d , @ LT zd@1|,dA\<`bT8cM|e|c6p|xUdx.|dPx$||(P,A$zd  ), A|,@d; <`@c`:)```!||vҪ|@<@H{AA(T`>,A<`@, A||PAA<8 8d;bBpc8cFK.A(H@8~8#8#Hx&|" K.A(cK`P|:@AX|:@@b`8bh8pA , @tzd 8a8|8"\1K.5A(; 880cK.A(H@8~88#H8x&|"@K-A(cK`Pb0|#@AX|#@@b`8bhp0|$@@8zdb 88|c,%-1A$pA , @XK`8`pj8!`|} !AaN K`KK`Ky18cy1pA\ , @|f,d@<b88MT8c| |6p|*xUdx.|Px$|"|P,A, A$pA , @PK`8`p8!`}!AaN K`K8a88"\K+A(; 880cK+A(H@8~88#H8x&|"@K+A(cK`Pb0|#@AX|#@@b`8bhp0|$@@8KK`y1|fKhpAԈ , @D18a888"\K*A(; 880cK*A(H@8~88#H88x&|"@K*A(cK`Pb0|#@AX|#@@b`8bhp0|$@@8, A$pA , @PK`8`p8!`}!AaN Ki`KK]`K8b8>Bh8c" :8bK)iA(H@8w8#Hx&|`x$|@*K)-A(bKA`P}>@AX|>@@b`8hp;`~>@@88b88cK(A(Zx&cC|$HoA(`f8wc$cEK(A(8bK`AX|>@@ b`cA`K|Ht=A(T`>,AK8|@KD8 8d;bBpc8cFK'A(H@8~8#8#Hx&|" K'A(cK`P|:@AX|:@@K8ap"b8"\K'yA(; 880cK'UA(H@8x88#H8px&|"K'%A(cK9`Pb0|#@AX|#@@b`8bhp0|$@@81,ATKKY`KT zd|`1,A(KK-`Kd|` @Kl C  , BrTapeRead|}&aA``}!!pAP , A K`Ky`bpA ~ ,#A KU`NHNBAc8ap8#K%A(; 880cK%aA(H@8|88#$8px&}"K%1A(cKE`Pb0|#@AX|#@@b`8bhp0|$@@8 {d), |@ p;8d8bc8K$A(@H8b`8c8#08#$x&|" K$QA(8bKe`bP|<@AX|<@@ b`hHdHo9A(,@8=9@8Bh c8b"d\8K#A(@H8b8c8#$x&|:`x$|@*K#iA(8bK}`bP}?@AX|?@@b`8hp;~?@@8 8c8b8K"A(b@HZcCx&|"%HiA(`f8bcEc$8cK"A(8bK`AX|?@@ b`@88b)pA  , A K`8a81-8#8 cx$| *K``}a8 HL`,@ 4-AXH?@|a<`:|9& !|(8;^> ;rUW7>aB8 HL`,A da8 HLi`,A Lx!:@::` {HJUA(,::@8.1T8A:@:9@T8},1T>@ |q8|@Ac8bcHT]A(Tq>|@@4p @\|@|P@|c|8c|88}*U>````!HTA(||p@@4pc @T>|@@,|P|c|8c|88}*U>K: P,/P @*@a8 HJ`-@\@p 8a bg8"pKA(@8 8bx&| *KA(8bK`{,;@cHNQA(,AX8"B9a x $|H*KY`Ka8 HJ`,@PApbP~ @A(bX| @AH8h`` b@;B$; , @ yA, A8 HIu`,A8 8bx&| *KqA(8bKՅ`8Cp8b8KEA(8zx&| *K%A(8bK9`:KH, A`aK`cK`KdbHX8`` @b`Bh#*; } @````!, @y@Kt8 HHE`,A8 8bx&| *KAA(8bKU`8C8bp8KA(8b8cx&| *KA(8bK`:LRPBAPKHa8 HG`,Aa8"HG}`,Aa8"HGa`,Ada8 HGE`,@hAXKDbHK A(,@@@ K8 8a bg`8"`K A(K08"bB9a x $|H*K`Ka8 HF}`,@X@@K88d p8bc8KYA(@bH8b8cx&8#|:x$ |@*KA(8bK%`P|?@AX|?@@b`bhK889` "B9a dPx $|H*K`K89` "B9a dPx $|H*KM`K|P|}| PT>H`K 8}b$H`8}=]  H@`K88T>b|P|}*|||8}*U>HMAA(Tp>|x@b@4p @}P,|p@A|q8@8bT>|P|}*|||8}*U>````!HLA(|x@To>@4p @<|,/8T>A<|p@b@0|q8T>|P|}*|||8}*U>Ka8 HC`-@A@|,0AKp,0A @dKp8B 8bc8KaA(@H8b<8cx&|"@K-A(8bKA`P|?@A,X|?@@,Ka8"HB`,@@K48 9` "Bb9 a dPx $|H*K`K8 9` "Bb9 a dPx $|H*K]`K8pbH@A(,@T>| A$@Ab :: >K{B88HEIA(|vyA!>KX8 ";Bb9 a x $|H*K`K 88bp8KMA(@H8b8cx&|"`K!A(8bK5`Pbp~#@AX|#@@b`ch8qp88bKA(8b8cx&|. KA(8bK̭`AXbp|#@@ b`b"Bax $x$|P*|X*KE`K8 9`/"Bb9 a dxx $|H*K`K4a8 H?`,Aa8"H?}`,A<@|@@ ?@@c8cEcHHA(Ty>|@@4p @,A |@A|@@ Hb<@|<:B |;~9F A|8->:rU W8> Ȁ}| @@ ,#@  , A , @ T:,6A |@A ,5A ,7A (|P|@A 8}H8|@@ 8a8H:a`:aA 8s`!HCA(,8As, +Asb`. A sKa8 H=`,@@Z: -7a8 H=`,@|8vLRSATf>8||}2|(8b~V>HEA(To>|@@4p @|@|P@||||8T>|c(88~|}bV>````!HEA(|z|@@t4pc @@T>|@@8|P||||8T>|c(88~b|}V>Kc8ccHEIA(Tp>|@@4p @|:@0,a 0@*ADLA|P<@|`(8|)c|c(8~V>@c```!HDA(||@@4p @T>,@Ax|P<@@(c|08|1c|88~*V>K@8},#AT>|@@|@,LFBAp8K8bc8KqA(@Hbb&8b8<8cx&|"`K5A(8bKI`P|?@A4K$p8J8bc8KA(@Hb&88b<8cx&|"@KA(8bK`P|?@AKa8 H:i`,@HA,7@A,78AT>  8a 88" K9A(@8 8bx&| *KA(8bK)`b8 H9`,A 8 ,.A@K T>8a @88"@KA(KpbH=YA(,A 8"bFB9a x $|H*Ka`Ka8"H9 `,@A@K8p8d8bc8KA(@H8b8c8#x&}x$ |8*KA(8bKĵ`P|?@AK@lK89` "B9a dPx $|H*KM`K9K89` "B9a dPx $|H*K`K489` "BbF9a dPx $|H*Kޝ`K89` "BbF9a dPx $|H*KI`Ka8"H6`,ALa8 H6`,@(K,8a8H?!A(,Ab|A89`8"B89a dx $|H*Kݑ`Ka8"H6=`,@l@lKd.3A<,7A4a8 H6 `,Aa8 H5`,Axa8"H5`,A\a8"H5`,A@a8 H5`,@bx:P;@:XKZ;@Ka8"H5]`,AZ?K:A8a8 LH8A(|ty@8";B89a x $|H*K`K\p8G;8bc8KA(@bHb88b<8cx&|"KA(8bK`P|?@AKp8I;8bc8KIA(@bH8b8b<8cx&|" KA(8bK%`P|?@AKp8F;8bc8KA(@bHV>88b<8cx&|"KA(8bK`P|?@AKp8E;8bc8KIA(@bH888b <8cx&|"ȠK A(8bK!`P|?@A KK,p8H;8bc8KA(@bH888b<8cx&|"KA(8bK`P|?@AKp8b8D;p8K=A(@H8b<8cx&|"ȀK A(8bK!`Pp| @AbpX|#@@b`h88b08x&|KA(8bK`0| @Ab0X|#@@ b`0bp| @@cK8 8d;pc8cKA(@8~H8#x&x$|"|0* KA(cK`P|?@AK|P<@|(c|)8c|(8@*WE>`!H9A(||@@4p @D,|@T>|PAc@ <@8|(c|)|(8@:WE>K89` "B9a dPx $|H*K`K<8"9` B9a dPx $|H*K֥`KcKa8 H/E`,A,a8 H/)`,Aa8"H/ `,Aa8 H.`,A8a H7A(,#A8;;@".&8a ;x$e *```!H,A(cd8@̓8cK``x`v8 vH*}`8a H71A(.8,#8a Ax$e *Kbx4p A"89`9aB f8x $|H*K`KD8cY8K`v`vK48a 8 LH1A(|y@TKݴb8c"|H)]A(|dyA8KK`K4K `K| @K "C& BrTapeCopy`b|aAT>Bc8!Q,#8|x$x|*Ax KA(cK`AXb0|#@@b`8bhp0|$@@8~p8cp~T>x A<8`8!|} !AaN 8!|!A} aN C | BrProgWait``}aA!b|}&8p|80!1x$|*Ab , A K`K`; 880cK A(@8|8Hx&x$|J|@*KA(cK`Pb0|#@AX|#@@b`8bhp:0|$@@8H:H8ap8H=A(,HP89%@$;`-BbHc89* }hy)$|H*K`H@88 ;bcccx&|!`KͩA(ccK`BP|?@AX|?@@ b`"hp|?@@bbpAb , A K`K` cc808KA(8{8x&| x$|@*KA(ccK`0| @Ab0X|#@@ b`b0|#@A`8`8!}!Aa8N a$bHppA 88 ;ccK A(bHB@8|rx&|!KA(cK`P}?@AX|?@@ b`hp~?@@b8b88 cx&|!`KuA(8bK`AX|?@@ b`@b8HT>x }X,@ H A(bpAЈ ,#A K`K`; 880cKA(@8Hx&x$|J|@* KʅA(cK`Pb0|#@AX|#@@ b`bhp0|$@A`a} 88!|AaN C BrWaitT>|}&aA!`z;b!1b88~8c~|ex$p|*Ab , A K`K` 8;"08c#KA(H@G8yx$x&|0*}"KA(c#K`Pb0|#@AX|#@@b`8bhp;@0|$@@8H;@"e. @p8`8HA(;|#@@\8~B89p"xg$cD|8*K`pA(H`w8`HbHEA(|#@@`9`~8B8p"9dxg$c|8*K`pAH`t8`bHA(|#@@t9@~8"8p9cGyg$|8*K`pA0H::;H`x, @ VcH A(e. @ 8`bHA(;|#@@`9@~8"8p9cGyg$|8*K]`pAtH8`bHA(|#@@`9@~8"8p9cGyg$|8*K`pAHt8`cH)A(|#@@9@~8"8p9cGyg$|8*Ku`pAb , A K`K` 8;08cKA(H@8}x$8 x&|0*}"@KA(cK`Pb0|#@AX|#@@HpAb , A K`K` 8;08cKIA(H@8x$8 x&|0*}"@KA(cK%`Pb0p|#@AX|#@@ b`Cbh0| @A`C~88!} |!AaN C \BrSleep`}b|}&a؀8,'8L|!x$|*Aab88!8a(0b|c,#x$|*A|AH8cHA(8c8x$| *K`cH``|bc,#AT(xxc@*Tc|dA`T>xx*T|@ 8a8Xy8y HH``wT&(A X"( @;bT>xx*T,%|"@, @|, Aq, @\, @P, @D, @8, A8@, A,), @ b, Ax, A8 bpA , @8ap8"<ہ0 ۡ@ @`0 @KA(; 880cK}A(@8}8pHx&x$|"|@*@KAA(cKlU`Pb0|#@AX|#@@b`8bhp0|$@@8, A(bpA , @|Kh]`8y8|ˡˁ8!} ax!AaN Kg`KKg`˙˹KHaX88HA(|wy@"B89bc9X x $|H*K`;b 88ccKA(BH"@8|Xx&|"KqA(cKj`P|=@AX|=@@b`8hp:|=@@8b,$ApÄ , @Kf`b| @ , @8b880KA(8|8x&|@x$|@*KA(8bKi`0| @Ab0X|#@@ b`b0|#@A`8`8KKe`KHKe`K| @K$:88V>8"b 8|aHqA((#A"(~"0~֪```!bc8HUA(,A$8{tNBc|`t||<@a>"8b*HA(,A88"Bbc9X  x $|H*K`;b 88ccKA(BH"@8|Xx&|"KA(cKg`P|=@A8K(b88bHA((#A8zcA(|<{@ ;K|<b|@Kx@t|t||<AKX8"9 Bbc9X Px $|H*K`;b 88ccKA(BH"@8|Xx&|"KqA(cKf`P|=@AK8aXHA(,@a^"T"Xx"xg"ax"x"Đ" >"$ ̐AaB0*c0*ȁȡ0*0*&P*P*P*P*I*f*(* *r2r۹@KpۙKh8"96Bbc9X x $|H*K1`;b 88ccKA(BH"@8|Xx&|"KA(cKd`P|=@AdKT8y H: H8/HA(,#A8T&KyKD8"9/Bbc9X xx $|H*KA`;b 88ccKA(BH"@8|Xx&|"KA(cKc`P|=@AtKd;" 880c#KA(@8yHXx&x$|"|@*KYA(c#Kcm`Pb0|#@AX|#@@b`8bhp0|$@@8KlK_`@@K\N1B@4KPK_}`K| @K("C  BrDiskStatGet|}&aAT>!aA!!ab8,$8c|cxc$|*ApAb , @K^`| @b , @N@,<AaHA(,#@ b|@bc,#AlpAb , @HK^`| @b , @ 8;08cK!A(@8}8Hx$|0*x&|" KA(cKa`Pb0|#@AX|#@@b`8bhp0|$@@88`8z8!p|!A} a!AaN K\`KK\`K| @K9`82"B9Pdxg$c |8*Kz`b, A pAb , @K\9`pAb , @ 8;08cKUA(@8}8Hx$|0*x&|" K!A(cK_5`0| @Ab0X|#@@b`8bhp0|$@@88`8K4K[Q`K4K[E`K| @K;`a|HA(,#AdB";o::bB"``!:8c8HH`,@a|H}A(,#@Ѐ, A;`|84;@8apeH`cchPc|*x$|8*Kx`bc,#@| @KaHA(,A8;`83;@8apeHI`KlaH5A(,Atb|A8_9`9"9PyJ$cg|P*Kw`b, A$Kbc,#ApAb , @KY)`| @b , @ 8;08cKEA(@8}8Hx$|0*x&|" KA(cK\%`Pb0|#@AX|#@@b`8bhp0|$@@88`8K$KXA`K4KX5`K| @K b80HU`,AD8apH]`8apHIA(|, /@\8apbH`8apHQA(,A8pbP9 x$|8*Kv`K8ap8XH}`K 8;b08ccKA(@8{Hx$|0*x&|"K}A(ccKZ`Pb0|#@AX|#@@b`8bhp0|$@@8K\KV`KHNB@K08apHM`8X8apH`cd8apH`88apHeA(,A|A898"Bb8p9pc x $|H*Kk`, AK8ap8XH5`KKM)`KlKM`K<| @KH A \ BrDirCopy|`aAT>!`aA!aa  b8Ā8c,#|xc$|*ApAb , @KL1`| @pb , @T 8;B08cCKMA(@8zH x$|0*x&|"KA(cCKO-`Pb0|#@AX|#@@b`8bhp;@0|$@@88a H`8a HA(",#@9@2"8 9pcDx $G|X*Kiu`bc,#AXpAb , @4KJ`| @b , @ 8;08cK}A(@8|8Hx$|0*x&|" K}A(cKM`Pb0|#@AX|#@@ b`Cbh0| @A`C8`8 8! }Aa!AaN KI`KKI`K| @K8a (H-A(,#A(;`t~:^:8t8HH}`,Ab80Ha`,A8a Hi`8a HUA(|, /@8a bH`8a 8pHA(,@T&(@@Lb:C,4Abb`!HA(,,^A ,4 @A:s,4b@,AhA ,;@8al H`l8al, A8, m@``!8c, , A@K8abHM`9!8a, A@,  @````!8c, , A@Kc8lbbG8! !  HA(,A8a (H A(|ty@, AP9@|84"p8 9cGyg$|8*Kem`K8a H9`a (HµA(,@8bc,#ApAb , @KF`| @b , @ 8;08cKyA(@8~8Hx$|0*x&|" KyyA(cKI`Pb0|#@AX|#@@ b`Cbhp0|$@A`C8`8KKE`K8KE`K| @K8_9`3"8 9pcyJ$g|P*Kc`KT9`8"8 9pdxj$cx |P*Kc}`KA ,;@bHƹA(,@8_9`"8 9pcyJ$g|P*Kc`K,4,AA0,;@K$(@b:CK(@b:CK(@b:CKb:CK|89`0_"8 9pcyJ$g|P*Kba`K8a 8XH`KKC`K;@KTKC`Kp| @Kx"A P BrDirList|}&aANB`;!N1BaA!xp!Qab8,'8|xc$|*A pA , @ KB`b| @b , @ ; 880cKuA(@8|cHx&x$|"|@*Ku}A(cKE`Pb0|#@AX|#@@ b`bhp0|$@@8cH`-8a cH`8a H1A(,#@82"Bb8 9p) cy)$|H*K_`b, A|pA , @\KA `b| @b , @(; 880cKt)A(@88Hx&x$|"|@* KsA(cKD`Pb0|#@AX|#@@ b`bh0p| @A`8`88!|px} !Aa!AaN K?`KK?`K| @pK8aMJPBHIA(,#ApH`Pb0|#@AX|#@@ b`bhp0|$@A`8`8KK; `K0K;`K| @K acK}Kb, A pA , @K:`b| @b , @; 880cKmA(@88Hx&x$|"|@* KmA(cK=`Pb0|#@AX|#@@ b`bhp0|$@A`8`8KK9`K0K9`K| @K8"93Bb8 9p cx $|H*KW`KcKN`K@89`0"B8 9bpd x $|H*KWi`K8`98x$| *K9`{N`{KH,.N1Ab , @ @(K8 8b8~PKkA(8 @8b8cx&| *KkA(8bK;`b`@cK8a 8XH`K0K7`K|K7`KH| @KT C BrDirScan`b|aA!8~!q8c~|cxc$,$|*ApAb , @K7`| @b , @ 8;b08ccKj1A(H@8{x$8x&|0*|"KiA(ccK: `Pb0|#@AX|#@@b`8bhbp0| @@88a@_``:Xp8 Xx8!8XHP8 Pb9 Tb8 !KiMA(; 8a@$H-A(8c8x$| *KG``x8@H `c8ceK,#A8|#@A |#@A8a0HA(8c8x$| *KGa``x0H`8/HA(,#A 8ccK,A8,?A(````!, A `KB8a@bbb``88 P9 TJPKgA(88a@HA(8c8x$| *KF`a88@H`c8K,A|,?A`!, A `Kb ,$@|8a@bbb``88 P9 T9J!KgAA(88a@H!A(8c8x$| *KE`a@8@H`8a@HA(,Abd|@,?A$```!, A `K_bc,#ADpAb , @ K3 `| @b , @ 8;08cKf)A(@88Hx$|0*x&|" KeA(cK6 `Pb0|#@AX|#@@ b`#bh0| @A`#8`88!}!AaN K1`K K1`K| @Kc@Kq,@dbc,#ApAb , @K1`| @b , @ 8;08cKdA(@88Hx$|0*x&|" KdA(cK4`Pb0|#@AX|#@@ b`#bh0| @A`#8`8KK0`K;;aA!aA!b|xp}&b8,'|!qxc$8D|*A8pA , @K%`b| @Ȉ , @;B" 880cCcKXA(@:8zHcx&x$||0*KXyA(cCK(`P~8@AX|8@@b`8hbpa}8@@8:@X>5b`9|$@}@|&````!,@ ;, @ , A c8!H`A,2A ,@ 8b88cKWA(bbEx&| KWaA(8bK'u`LRpBA@a, A b 8c8HA(|nyA X8aHA(`e,Al|A@, AX, @L8apaH`K#Y`c8!H`,.A,@@8b88cKVyA(bbEx&| KVYA(8bK&m`LRpBA@a, Ahb 8c8HA(|nyA8a8pH`,Ad;,@K"u`8b88x&|<@KUA(8bK%`} @aaK1`cCx&| *Ha``z8bK%q`KhK!`8b88x&|<@KUA(8bK%1`|?@AX|?@@b, AHpA , @(K!]`b| @ , @8b88cKTA(b8x&|@x$|@*KTQA(8bK$e`AX|8@@A`8`88!|px} !Aa!AaN K E`KK 9`K| @pK, @, @ b, ApA , @K`b| @ , @8b88cKS A(bcx&|@x$|@*KRA(8bK"`AX|8@@A`a8KK%`K`K`K0| @K<8b88x&|<`KR=A(8bK"Q`|?@A0X|?@@(K 89"B89bax $|H*K<`KyHQA(|ny@8 9:"B89 bax $|H*KW<, W8}G0PAW80}jZWH,}@Z,(;T (4W>A\T8cJ}PPT<W:}?c},+W>AWp"WP*TH,T80U8U(4})}JT:PU<|J| }B|2| |:<}2`,,|2T>A9 x.xH}H8Px|y( },:,&| BT>Axx.x Hx}IP,'| |`2|BT>A,x.xH|e Px||:|BT>HaN caN @ BrTimeDecode``b|8|!q},%8c}|ex$|*A(bpA , @DK`,?,AAcc, +A, +AH`,b@x, A,bpA , @8K`8`8!8}N K`K`K@b, A,bpA , @,K`8`8!8}KKm`Ke`8`8!8}KTb, A,bpA , @,K `8`8!8}KK `K `8`8!8}KHeA(,@b, AKdccH9A(,AKf8, |x$|` |1*A0p`Ab , @K a`b| @b , @N~%@b, A@b8chCp#hpb, Abz, @bH`LBA b Ab# @@` 88qX(@,A88(A8,@,, @$, +A;, +@; ,@8tX8PH`8tX8LH`8tX8H`8tX8LH`8tX8LH`8tXcH`8tX8LH`8tX8H}`8tXpcHe`8tX8LHQ`8tX88H=`8tX8LH)`8tX8H`8tX8LH`8tX8HH`8tX8LH`b0]/f`|#x|yA|c8tXH`8tX8LH`8tX88Hq`8tX8LH]`8tX8HI`8tX8LH5`8tX8PH!`8tX8LH `8tXbdH~`8tX8LH~`8tXcH~`8tX8LH~`8tX8H~`8tX8LH~`8tXcH~`8tX8LH~y`8tX8H~e`,8@;Xb, A bchCp#bd, |` A0p`Ab , @tK`b| @b , @( 8;08cK8 A(H@8}cx$x&|@*|"@K7A(cK`Pb0|#@AX|#@@b`8bhp0|$@@8c88!} |@HP!XA`ahpx!AaHhK`KH H H H H HK`K88tXHxA(8c8x$| *Ke`8XHv``K8tX8PH|`8tX8LH| `8tXbdH{`8tX8LH{`8tXcH{`8tX8LH{`8tX8LH{`8tXcH{`8tX8LH{`K$c8PHy`,bc@ ,,3@ , A4, A`8tX8PH{)`8tX8LH{`b6, A8tXHz`bX,?AH8tX8L```!Hz`8tXHz`8tX8L,?@bz, @pb{, @}, Ab , A8tX8LHzM`0,?@8tXHz-`8tX8Hz`, /@<8tXcHy`, /@K8tX8LHy`Kt8tX8LHy`K8tXcHy`c8 HyaA(,#@8tX8Hy`KD8tX8 Hy A(888tXHyQ`K8tX8LHy9`8tX(Hy%`K8tX8LHy `8tXHx`Kl8tXHx`K8tXHx`8tX8LHx`8tX8Hx`8tX8LHx`8tX8Hx}`8tX8LHxi`8tX8PHxU`8tX8LHxA`08tXHx-`8tX8LHx`8tX8Hx`8tX8LHw`8tXHw`8tX8LHw`8tX8XHw`, @DbX,?A8tXb8LB". ``!Hwa`8tX8HHwQ`8tX8LHwA`8tX8Hw1`8tX8LHw!`8tXHw`8tX8LHw`88'Ad8K$%`d8tXHv`8tX8L,?A. KTbz. @`{, @}, Ab , A@hb{, @}, Ab , A KH8tX8LHv5`8tX8HHv!`8tX8LHv `8tX8Hu`8tX8LHu`8tX(cHu`8tX8LHu`, @p, /@Lcc88K"`d8tXHu}`, /A$8tX8LHu]`K8tX8LHuE`Kc88'8K"i`d8tXHu`K8tX8LHu`8tX8HHt`8tX8LHt`8tX8Ht`8tX8LHt`8tXcHt`8tX8LHt`, @p, /@Lcc88K!`d8tXHtM`, /A8tX8LHt-`K8tX8LHt`Kc88'8K!9`d8tXHs`Kp8tX8LHs`8tX8HHs`8tX8LHs`8tX8 Hs`@Kc88K `d8tXHsq`K8tX8LHsY`8tX8HHsE`8tX8LHs1`8tX8Hs`8tX8LHs `, /@88tXcHr`, /A88tX8LHr`K 8tX8LHr`K8tX8PHr`8tX8LHr`8tX8Hru`8tX8LHra`8tXHrM`8tX8Hr9`8tX8PHr%`8tX8LHr`8tXhHq`Xb,<A\8Lb8tX`!Hq`8/cHqYA(8,#Ah8tXHq`8tX8L,<@bz, @b{, @}, Ab , A,8tX8LHqA`8tXcHq1`K8tX8LHq`8/(cHpA(,#A,88tXHp`8tX8LHp`K8tXcHp`8tX8LHp`Kl8tX8LHp`8/cHpA(,#A88tXHpe`K8tXcHpQ`K8tXcHp=`Kc8\Hne`,@\,3@b , A 0b4, A\8tX8PHo`8tX8LHo`b6, A8tXHo`8tX8LHo`8tXPHo`bo, @bp, @`b, AY, @8tX8LHo1`0,?@8tXHo`8tX8Hn`, /@<8tXcHn`, /@Kp8tX8LHn`KX8tX8LHn`K8tXcHn`c8 HnEA(,#@8tX8Hne`KD8tX8 HmA(888tXHn5`K8tX8LHn`8tX(Hn `K8tX8LHm`8tX`Hm`K|8tX8LHm`8tXXHm`K@8tXHm`K8tXHm`8tX8LHmq`8tX8Hm]`8tX8LHmI`8tX8Hm5`8tX8LHm!`8tX8PHm `8tX8LHl`08tXHl`8tX8LHl`8tX8Hl`8tX8LHl`8tXHl`8tX8LHl`8tX8XHlq`, A8tX8LHlQ`8tX8HHl=`8tX8LHl)`8tX8Hl`8tX8LHl`, /@ 8tXcHk`, /@8tX8LHk`8tX8HHk`8tX8LHk`8tX8Hk`8tX8LHku`8tXPHka`8tX8LHkM`b88'8cPKq`d8tXHk%`bo, @bp, @b, AY, @K8tX8LHj`8tX8HHj`8tX8LHj`8tX8 Hj`8tX8LHj`8tX8HHjm`8tX8LHjY`8tX8HjE`8tX8LHj1`8tX(cHj`8tX8LHj`, @p, /@Lcc88K`d8tXHi`, /A8tX8LHi`KD8tX8LHi`Kc88'8K`d8tXHii`K8tX8LHiQ`8tX8HHi=`8tX8LHi)`8tX8Hi`8tX8LHi`8tX`cHh`8tX8LHh`, @p, /@Lcc88K`d8tXHh`, /A8tX8LHhy`Kt8tX8LHha`Kc88'8K`d8tXHh9`K48tX8LHh!`8tX8HHh `8tX8LHg`8tX8Hg`8tX8LHg`8tXXcHg`8tX8LHg`, @p, /@Lcc88K`d8tXHgi`, /AL8tX8LHgI`K48tX8LHg1`Kc88'8KU`d8tXHg `K8tX8LHf`K8tX8LHf`K8tX8LHf`8tX8HHf`8tX8LHf`8tX8Hf`8tX8LHfq`8tXPcHfY`8tX8LHfE`, /@Lcc88Ka`d8tXHf`, /A8tX8LHe`K8tX8LHe`K8tX8PHe`8tX8LHe`8tX8He`8tX8LHe`8tX@Heu`8tX8Hea`bbh. A(Y, Asx|`yA, /A8tX8PHe`8tX8LHd`8tXcHd`8tX8LHd`b8/PcHd]A(,#AD88tXHd`8tX8LHd`bo, @bp, @0AbY. A8/(cHcA(||yA8tX8Hd1`8tX8LHd`8tXcHd `A$,<Asx|`yA, /AK8tX8Hc`8tX8PHc`8tX8LHc`x8tXHc`8tX8LHc`88tXHcu`K8tXcHca`K08tXcHcM`K8/`cHbA(,#A088tXHc`8tX8LHc`AK8tXcHb`K8/XcHbmA(,#A,88tXHb`8tX8LHb`K 8tXcHb`8tX8LHb}`K8tXcHbi`K8tX8PHbQ`8tX8LHb=`8tXcHb-`8tX8LHb`8tX(Hb`8tX8LHa`8tX8HHa`8tX8Ha`Kc8hH_`,@,3@b , A(b4, A8tX8PHai`8tX8LHaU`b6, A8tXHa5`b0,?AH8tX8L```!Ha`8tXH``8tX8L,?@8tX8LH``0,?@8tXH``8tX8H``, /@<8tXcH`y`, /@K8tX8LH`U`K8tX8LH`=`K8tXcH`)`c8 H_A(,#@8tX8H_`KD8tX8 H_A(888tXH_`K8tXH_`K8tXH_`8tX8LH_`8tX8H_y`8tX8LH_e`8tX8H_Q`8tX8LH_=`8tX8PH_)`8tX8LH_`08tXH_`8tX8LH^`8tX8H^`8tX8LH^`8tXH^`8tX8LH^`8tX8XH^`, @\b0,<AbB"````!8tX. 8LH^-`8tX8HH^`8tX8LH^ `8tX8H]`8tX8LH]`8tXH]`8tX8LH]`@x, /@Xc|88K `d8tXH]`, /@,<@8K8tX8LH]i`K8tX8LH]U`K8|8'8K y`d8tXH]-`K8tX8LH]`8tX8HH]`8tX8LH\`8tX8H\`8tX8LH\`, /@88tXcH\`, /A 8tX8LH\`K8tX8LH\q`K8tX8PH\Y`8tX8LH\E`8tX8H\1`8tX8LH\`8tXH\ `8tX8H[`8tX8PH[`8tX8LH[`8tXhH[`8tX8LH[`b0yAl8/bc```!H[ A(8,#AP8tXH[Y`8tX8LH[I`8/yAcK8tXcH[`Kܸ8tXcH[ `K,3@b , A - b0A 8b.4, A@(, AB, AC, @8tX8PHZ`8tX8LHZ}`b6, AD8tXHZY`bB, A8tX8LHZ5`@H8tXHZ`8tX8XHZ `c8/HYA(,#A88tXHY`,A 8tX8LHY`,<@|8tXHY`8tX8HY`, /@48tXcHYy`, /@AK8tX8HYQ`8tXpHY=`8tX8LHY)`8tX88HY`8tX8LHY`8tX8HX`8tX8LHX`H8tXHX`8tX8XHX`c8/HX=A(,#A88tXHX`K$8tXcHXu`K8tX8LHX]`K8tX8LHXE`K8tXcHX1`c8 HWA(,#@8tX8HX`KL8tX8 HWA(888tXHW`Kc8/HW]A(,#A8/8tXHWEA(88H8tXHW`c8/HWA(88tXHWm`K8tXcHWY`Kx8tX8LHWA`8tX8HW-`K8tXHW`K8tXHW`8tX8LHV`8tX8HV`8tX8LHV`8tX8HV`8tX8LHV`8tX8PHV`8tX8LHVu`8tXHVe`8tX8LHVQ`8tX8HV=`8tX8LHV)`8tXHV`8tX8LHV`AbA`d8tX8 HU`b. @X8tX8LHU`8tX8HHU`8tX8LHU`8tX8HU}`8tX8LHUi`@H8tXHUQ`8tX8XHU=`c8/HTA(,#A88tXHU`,A8tX8LHT`@, /@pbA88tXcHT`, /@AKT8tX8HT`8tXpHT`8tX8LHTy`8tX88HTe`8tX8LHTQ`8tX8HT=`8tX8LHT)`H8tXHT`8tX8XHT`c8/HSA(,#A88tXHS`Kt8tXcHS`K`8tX8LHS`@Kcc88K`d8tXHS`K8tX8LHSi`K, /LNBAHc8/HRA(,#A88tXHS-`@tKt8tXcHS`KXc8\HRA(,#AKc8/HRA(,#A8/8tXHRiA(88H8tXHR`c8/HR=A(88tXHR`K8tXcHR}`Kh8tX8LHRe`8tX8HHRQ`8tX8LHR=`8tX8HR)`8tX8LHR`, /@8tXcHQ`b- /A0@H8tX8/HQiA(,#A8- /A8tX8LHQ`K8tX8\HQ%A(,#AK8tX8LHQi`K``d8tX8XHQQ`Kt8tX8HQ9`8tX8LHQ%`8tXHMqA(|th 8cX8hK UA(8tX8LHP`8tXHM-A(|tx 8cX8xK A(K8tX8XHP`8tXHP`8tX8LHPu`8tX8dHPa`8tXHPQ`8tX8LHP=`ba, A8tXpHP`8tX8LHP`8tX88HO`8tX8LHO`8tX8HO`8tX8LHO`8tX8HO`8tX8LHO`8tX8HOy`8tX8LHOe`8tX8HOQ`8tX8LHO=`8tXcHO-`8tX8LHO`H8tXHO`8tX8XHN`c8/HN}A(,#A,88tXHN`8tX8HN`K8tXcHN`8tX8HN`K8tXHNu`K.A(,A 1, AbAp8tX8PHN1`8tX8LHN`8tXpHN `b0,<@8tX8LHM`8tX8 HM`8tXcHM`AH,A@8tX8LHM`8tX8 0HM`8tXcHM}`K8tX8LHMe`8tX8 HMQ`8tXHIA(|ta ؐ8cX8KA(b4AAh,@T8tX8LHL`8tXHI=A(<$|t8cX8 $!K!A(8tX8LHL`K 8tX8LHL`8tXHHA(>$|t8cX8 !KA(KX8tX8LHLM`8tX8 HL9`8tXHHA(?$|t8cX8!KiA(A`K8tX8LHK`8tXcHK`K, @8tX8XHK`08tXHK`8tX8LHK`8tX8dHK`8tXHKq`8tX8LHK]`ba, A,8tXpHK9`8tX8LHK%`8tX88HK`8tX8LHJ`8tX8HJ`8tX8LHJ`8tX8HJ`8tX8LHJ`8tX8HJ`8tX8LHJ`8tX8HJq`8tX8LHJ]`8tXcHJM`8tX8LHJ9`8tXcHJ)`K8tXHJ`8tX8LHI`K(8tX8PHI`8tX8LHI`8tXhHI`8tX8LHI`b, A$bAbB, A8tXcHIi`,A,8tX8LHIM`8tXcHI=`Kc8/HHA(,#A8/8tXHHA(88H8tXHH`c8/HHA(88tXHH`8tX8LHH`Kt8tX8HH`8tX8LHH`KK,8q8((@AxH8|*| N ,A. A0bp8tXcHH5`8tX8LHH!`8tX88HH `8tX8LHG`b, A8tX8 THG`8tX8LHG`@`8tX8 jHG`8tX8LHG`8tXHCA(|tX 8cX8XKA(K8tXcHGQ`8tX8LHG=`K8tX8 `HG%`KP8tX8 $|t8cX8 !KAA(8tX8HE`8tXpcHE`8tX8LHE`8tX88HE`8tX8LHEy`8tX8 4HEe`8tX8LHEQ`8tX8 @HE=`8tX8 DHE)`8tX8HE`8tX8 HHE`8tX8 PHD`8tX8LHD`K8tX8LHD`8tX8 HD`8tXH@A(?$|t8cX8!KA(8tX8LHDi`KX8tX8LHDQ`8tXcHDA`K|8tXpHD)`8tX8LHD`8tX88HD`8tX8LHC`8tX8 4HC`8tX8LHC`8tX8 :HC`KL,A`,Apbcp8tXbdHC`8tX8LHCq`8tX88HC]`8tX8LHCI`.A,A,@8tX8 tHC`8tX8LHC `,@8tX8 jHB`8tX8LHB`8tXcHB`,AA,AKP8tX8LHB`8tXH>A(|t 8cX8KA(8tX8LHBY`8tXH>A(|tۡ 8cX8KA(8tX8LHB`8tXH>aA(|t 8cX8KEA(KÀc8/HAmA(,#A 8/8tXHAUA(88H8tXHA`c8/HA)A(88tXHA}`AK8tXcHAe`Kx8tX8 |HAM`K08tX8 lHA5`K8tX8 $|t8cX8 !KMA(8tX8H?`8tXepbdH?`8tX8LH?`8tX88H?`8tX8LH?`8tX8 4H?q`8tX8LH?]`8tX8 @H?I`8tX8 DH?5`8tX8H?!`8tX8 HH? `8tX8 PH>`8tX8LH>`KP8tX8LH>`8tX8 H>`8tXH;A(?$|t8cX8!xxKA(8tX8LH>u`KX8tX8LH>]`8tXbdH>M`K|8tXpH>5`8tX8LH>!`8tX88H> `8tX8LH=`8tX8 4H=`8tX8LH=`8tX8 :H=`KX, b8cB(@8 @`,A- A$|t8cX8 !KA(8tX8LH&`8tX8 0H&`8tXcH&`K8tX8LH&i`8tX8 H&U`8tXH"A(?$|t8cX8!KA(8tX8LH&`K(8tX8LH%`8tXcH%`K$, b8cB(@8 @`,@.A8tX8PH%`8tX8LH%`p8tXH%y`b0,<@(8tX8LH%U`8tX8 H%A`8tXcH%1`8tX8LH%`8tX8 H% `8tX8LH$`8tX8 H$`8tXH!-A(|taX ؐ8cX8XKA(,A@8tX8H$`8tXpH$}`8tX8LH$i`8tX88H$U`8tX8LH$A`8tX8 4H$-`8tX8LH$`8tX8 @H$`8tX8 DH#`8tX8H#`8tX8 HH#`8tX8 PH#`8tX8LH#`8tXpH#`8tX8LH#y`8tX88H#e`8tX8LH#Q`8tX8 TH#=`8tX8LH#)`8tX8 jH#`8tX8LH#`8tXHMA(|tx 8cX8xK1A(Kl8tX8LH"`8tX8 0H"`8tXcH"`K08tX8LH"}`8tXHA(>$|t8cX8 $!hhKܭA(@K8tX8LH"1`8tXcH"!`K8tX8 $|t8cX8 !KAA(K8tX8LH`8tX8 H`8tXHA(?$|t8cX8!KA(8tX8LHq`K`8tXHa`8tX8LHM`Kt8tXpH5`8tX8LH!`8tX88H `8tX8LH`8tX8H`8tX8LH`8tX8LH`Kh, b8cB(@8 @`b], @.A ,@b08tX8PH]`8tX8LHI`b8, A8tXH)`8tX8LH`8tXH`S,2@8tX8LH`P8tXH`8tX8LH`8tX8HH`8tX8LH`b], @8tX8LHu`8tX8Ha`8tX8PHM`8tX8LH9`H8tXH)`8tX8$HA(,#@8tX8|H`8tX8H`8tX8LH`8tX8H`8tX8LH`8tX8H`8tX8H`bh, A<, Ab@, @ b, A, @8tX8H)`b苣]-=@8tX8LH`8tX8LH`@,A8tX8PH`8tX8LH`p8tXH`,=@48tX8LH`8tX8 Hy`8tX8LHe`8tX8 HQ`8tXHA(|ta ؐ8cX8KA(,Ad,@ 8tX8H`8tXpH`8tX8LH`8tX88H`8tX8LH`8tX8 4H`8tX8LH`8tX8 @Hq`8tX8 DH]`8tX8HI`8tX8 HH5`8tX8 PH!`8tX8LH `8tXpH`8tX8LH`8tX88H`8tX8LH`8tX8 TH`8tX8LH`8tX8 jH`8tX8LHm`8tXHA(|tX 8cX8XKA(8tX8 PH)`8tX8 HH`@Kp8tX8LH`Kp8tX8LH`8tX8 0H`8tXcH`K8tX8LH`8tXHA(>$|t8cX8 $!KA(K\8tX8LH]`8tXcHM`K8tX8 HA(,#A, @D88tX8LH `8tXH`8tX8LH`8tX8H`8tX8LHڹ`8tX8Hڥ`8tX8LHڑ`8tX8PH}`8tX8LHi`8tXHY`8tX8LHE`8tX8H1`8tX8LH`8tXH `8tX8LH`8tX8 H`, A8tX8LH`8tX8HHٱ`8tX8LHٝ`8tX8Hى`8tX8LHu`, /@8tXcHY`. /@T8tX8/HA(,#A8. /@8tX8LH `8tX8HH`8tX8LH`8tX8H`8tX8LHؽ`8tX8 jHة`8tX8LHؕ`, /A , @Dc8/H A(,#A88tXHY`KY8tXcHE`KYc8\HA(,#A88tXH`K8tX8LH`K8tX8\H׉A(,#AK8tX8LH`Kd8tX8LH׵`8tX8HHס`8tX8LH׍`8tX8Hy`8tX8LHe`8tX8 jHQ`8tX8LH=`, /@88tXcH!`, /A8tX8LH`KX8tX8LH`K8K8KcH!`,@c8/HEA(,#A8tX8/H-A(88H8tXHu`c8/HA(88tXHU`K8tX8 $|t8cX8 !KuA(8tX8H`8tXpH`8tX8LH`8tX88H`8tX8LHԱ`8tX8 4Hԝ`8tX8LHԉ`8tX8 @Hu`8tX8 DHa`8tX8HM`8tX8 HH9`8tX8 PH%`8tX8LH`K8tX8LH`8tX8 H`8tXH1A(?$|t8cX8!KA(8tX8LHӡ`K\8tXHӑ`8tX8LH}`K.0AD8tX8PHY`8tX8LHE`88tXH5`8tX8$HA(,#Ah@t, @\, @P8}88$HҭA(88tXH`8tX8>HeA(,#A 8KTT8KcH`,@c8/H!A(,#A8tX8/H A(88H8tXHQ`c8/HA(88tXH1`K88tX8 $|t8cX8 !KQA(8tX8H`8tXpH`8tX8LHе`8tX88HС`8tX8LHЍ`8tX8 4Hy`8tX8LHe`8tX8 @HQ`8tX8 DH=`8tX8H)`8tX8 HH`8tX8 PH`8tX8LH`K8tX8LH`8tX8 H`8tXH A(?$|t8cX8!KA(8tX8LH}`K\8tXHm`8tX8LHY`K,A b.z, @0A- A\8tX8PH`8tX8LH`88tXH`8tX8$HΥA(,#At@$, @ , @8}88$HiA(88tXHΕ`8tX8>H!A(,#A, @88tX8LHU`8tXpcH=`8tX8LH)`8tX88H`8tX8LH`8tX8 H`8tX8LH`8tX8 jH`AKO\8tX8Hͩ`8tXcH͙`8tX8LHͅ`8tX88Hq`8tX8LH]`8tX8HI`8tX8LH5`H8tXH!`8tX8XH `c8/H̙A(,#A88tXH`KN8tXcH`KNl8K\8K@hHH`8tX8XH̍`c8/HA(,#A88tXHe`K8tXcHQ`KcHơ`,@c8/HA(,#Ap8tX8/H˭A(88H8tXH`c8/HˁA(88tXH`K 8tX8XH˽`8tXH˭`8tX8LH˙`8tX8dH˅`8tXHu`8tX8LHa`ba, A8tXpH=`8tX8LH)`8tX88H`8tX8LH`8tX8H`8tX8LH`8tX8H`8tX8LHʱ`8tX8Hʝ`8tX8LHʉ`8tX8Hu`8tX8LHa`8tXcHQ`8tX8LH=`H8tXH)`8tX8XH`c8/HɡA(,#A,88tXH`8tX8H`K8tXcH`8tX8Hɱ`K8tXHə`K8tX8 $|t8cX8 !KA(8tX8HE`8tXpH1`8tX8LH`8tX88H `8tX8LH`8tX8 4H`8tX8LH`8tX8 @Hǹ`8tX8 DHǥ`8tX8HǑ`8tX8 HH}`8tX8 PHi`8tX8LHU`K$8tX8LH=`8tX8 H)`8tXHuA(?$|t8cX8!KYA(8tX8LH`K\8tXH`8tX8LH`K8tXpHƩ`8tX8LHƕ`8tX88HƁ`8tX8LHm`8tX8 HY`8tX8LHE`@H8tX8 H)`8tX8LH`8tXcH`8tX8LH`8tXH=A(|t 8cX8K!A(8tX8LHŭ`8tXHA(|tc8cX8\KA(8tX8LHq`8tXHA(|tۡ 8cX8KA(8tX8LH-`8tXHyA(|tX 8cX8XK]A(KF8tX8H`8tX8LH`8tXcH`8tX8LHĭ`8tXHA(|th 8cX8hK~A(8tX8LHi`8tXHA(|tc8cX8\K~A(KE8tXpH)`8tX8LH`8tX88H`8tX8LH`8tX8 4H`8tX8LH`8tX8 :Hñ`KELb, @@b0 , @08tX8PHy`8tX8LHe`@8tXHU`8tX8$H A(,#A, @ , A, @8s@8$HA(88tXH`.A,A8tX8$HiA(,#A@,@<蠄s@8$H5A(88tXH‰`KD$, #@,c!! 8tXHU`KcH`K8tX8>HA(,#A, @88tX8LH`8tX8PH`8tX8LH`p8tXH`,=@A`8tX8LH`8tX8 0H`,@8tX8Hu`KC8tXcHa`KB8tX8LHI`8tX8 H5`8tXHA(|ta ؐ8cX8K{eA(8tX8LH`8tXH=A(>$|t8cX8 $!K{!A(K8tX8LH`8tXcH`AHA(,#A, @888tX8LH-`8tXpH`8tX8LH`8tX88H`8tX8LH`.@8tX8 lH`8tX8LH`8tX8 jH`8tX8LH`8tXcHu`,AAK<8tX8LHQ`8tXHA(|t 8cX8KtA(8tX8LH `8tXHYA(|tۡ 8cX8Kt=A(8tX8LH`8tXHA(|t 8cX8KsA(K;4c8/H!A(,#A8/8tXH A(88H8tXHQ`c8/HA(88tXH1`K8tX8 tH`KX8K8KtcHQ`Kd8tXH`8tX8LH`8tX8H`8tX8LH`8tX8H`8tX8LHu`8tX8PHa`8tX8LHM`b08tXH9`8tX8LH%`8tX8H`8tX8LH`8tXH`8tX8LH`8tX8 H`, A(8tX8LH`8tX8HH`8tX8LH}`8tX8Hi`8tX8LHU`8tXcHE`. /A$8tX8LH%`. /@l8tX8/HA(,#A8. /@(8tX8LH`8tX8HH`8tX8LH`8tX8!H`8tX8LH`, /A , @c8/HA(,#AT88tXHM`8tX8LH9`8tX8 jH%`8tX8LH`K8tXcH`8tX8LH`Kc8\HqA(,#AKp8tX8LH`K8tX8\H=A(,#AK8tX8LH`8tX8HHm`8tX8LHY`8tX8!HE`8tX8LH1`, /@L8tXcH`, /A8tX8LH`8tX8LH`K8tX8LH`K8tXpH`8tX8LH`8tX88H`8tX8LHu`8tX8 4Ha`8tX8LHM`8tX8 :H9`K5,A@b, @b0 , @8tX8PH`8tX8LH`@8tXH`8tX8$HA(,#A, @ , Ax, @`8s@8$HAA(88tXHm`8tX8>HA(,#A, @88tX8LH-`8tXpH`8tX8LH`8tX88H`8tX8LH`8tX8 TH`8tX8LH`8tX8 jH`8tX8LH`8tXHA(|tX 8cX8XKlA(K388L8tXH=`K8KcH`K8tXH `8tX8LH`8tX8H`8tX8LH`8tX8H`8tX8LH`8tX8PH`8tX8LH}`b08tXHi`8tX8LHU`8tX8HA`8tX8LH-`8tXH`8tX8LH `8tX8 H`, A,8tX8LH`8tX8HH`8tX8LH`8tX8H`8tX8LH`, /@8tXcHi`. /@l8tX8/HA(,#A8. /@(8tX8LH`8tX8HH `8tX8LH`8tX8!H`8tX8LH`, /A , @c8/HEA(,#AT88tXH`8tX8LH}`8tX8 jHi`8tX8LHU`KH8tXcHA`8tX8LH-`Kc8\HA(,#AKp8tX8LH`K8tX8\HA(,#AK8tX8LH`KL8tX8LH`8tX8HH`8tX8LH`8tX8!Hq`8tX8LH]`, /@L8tXcHA`, /A8tX8LH!`8tX8LH `K8tX8LH`K8tXpH`8tX8LH`8tX88H`8tX8LH`8tX8 4H`8tX8LHy`8tX8 :He`K/8tX8PHM`8tX8LH9`p8tXH)`8tX8LH`8tX8 H`8tXcH`8tX8LH`8tX8 H`8tXHA(|tah ؐ8cX8hKfA(b4AL8tX8LHu`8tXHA(>$|t8cX8 !KfA(K-8tX8LH-`8tX8 H`8tXHeA(?$|t8cX8!xxKfIA(8tX8LH`K`,Ab.A ,<A\8tXpH`8tX8LH`8tX8!Hu`,<A8tXcH]`8tX8LHI`8tX8!H5`8tXHA(|tۡ 8cX8KeeA(AK,8tX8LH`8tX8!(H`8tX8LH`8tX8!0H`8tXHA($|t8cX`8%!8 *!KdA(K, 8tXcH]`Kc8/HA(,#A8.8cHA(,#@|8tXpH`8tX8LH`8tX88H`8tX8LH`8tX8! H`8tX8LH`8tXcH`8tX8LH`8tXcH}`8tX8HHi`8tX8hHU`8tX8LHA`K8tXpH)`8tX8LH`8tX88H`8tX8LH`8tX8 4H`8tX8LH`8tX8 :H`K*L8tXpH`8tX8LH`8tX88Hq`8tX8LH]`8tX8!$|t8cX8 $!K1A(K8tX8LHwy`8tX8 Hwe`8tXHsA(?$|t8cX8!hhK1A(K8tX8LHw`8tX8 Hw `8tXHsUA(|ta ؐ8cX8K19A(K8tX8LHv`8tXbdHv`KT,@8tX8PHv`8tX8LHv}`8tX8Hvi`8tX8LHvU`8tX8LHvA`8tXcHv1`8tX8LHv`8tX8Hv `8tXEpbDHu`8tX8LHu`8tX88Hu`8tX8LHu`cHrA(, A$, @;|, @48tX8Hue`8tX8LHuQ`8tX8HHu=`8tX8LHu)`b苤]c/x~`yN@H8tX8PHt`8tX8LHt`8tX`Ht`8tX8LHt`0,@8tXHt`8tX8LHt`@p8tX8LHtm`8tXcHt]`8tX8LHtI`,=@,3@,<@K8tX8Ht`K8tX8Ht`K8tXHs`8tX8 DHs`8tX8Hs`K`8tXbDHs`8tX8LHs`8tX88Hs`8tX8LHsu`8tX8Hsa`8tX8LHsM`KH8tX8 Hs5`8tX8LHs!`|8tXHs`KKpX 8ap8XK-AA(,?A8apcHr`8ap8LHr`,=A8apcHr` 8:08bK,A(H@8t8px$x&|@*|"K,A(bK`Pb0|#@AX|#@@b`8bhp0|$@@8K8ap8Hq`K48ap8Hq`KK`KlNBKhK`K08tX8LHq`8tX8HHqm`8tX8LHqY`8tX8 HqE`K,"C?0( BrCopyBuild|}&HzI``a=`aA !xph`aXAP:@!H@: 80!1bB"a8!AA a(!0A8bH؁@H,%z V>@ؐ| 8|xc$|*A(pAȈ , @]K`| @ , @]:~ 8ap8K*A(,>A]P8apcHo`88apHoy`8apHkA( c|c|a|8cpHyM`8apHkA(8||p, @ 8^p8||p, @ 8^p8||ap, @ 8^p: 880bbK)A(@8v8pHx&x$|"|0*K(A(bK`P|5@AX|5@@b`8bhp|5@@8i, @[, Az, @bH @ L@A[XA[P@@ B, @h,>A`bh~yAPct````!Hk`,c@B, @Zx~yA tKc8tHiMA(,#@Zx cbHi1A(,#@Z\c8HiA(,#@ZD , At , 'Åt ,3Ac. 'Hi!A(`~A88|Hj`|`4T~8~`8 y, |` A(p`A , @HKi`| @ , @; 880cK&A(@88Hx&x$|"|0* K&UA(cKi`Pb0|#@AX|#@@b`8bhp0|$@@88`ڀ} 88!|!HAPaX`hpx!AaHtK1`KK%`KcHgmA(`~8|8Hi=`|`4T@:`Vs>K(:`<`#S8cUC|`xhC|yt t A<`#I8cNF|`xhO|yAl<`#W8cAR|`xhN|yA4<`#E8cRR|`xhO|y@y, |` A(p`A , @TK5`| @ , @(; 880cK$YA(@88Hx&x$|"|0* K$!A(cK5`Pb0|#@AX|#@@b`8bhp0|$@@88`88!|08} @!HAPaX`hpx!AaHrK`KK`Kc8HdA(,#@h8(%A\8xH|*| N -@ , A 5, @ ,A ,A @ , A\5, @P6, @ @b0y@,=A,y, |` A(p`A , @K`| @ , @; 880cK")A(@88Hx&x$|"|0* K!A(cK`Pb0|#@AX|#@@b`8bhp0|$@@88`8KK`K0K`Kc8/HfA(`}cHcEA((#@8(=@c8cHbA(,A,ATc8PHd`,A238w0 |yA$8w0-|yA,A8w0-|y@4c84HZA(,#@8@cHZA(,#@c8THYA(,#@8tcHYA(,#@>@208r0 |y.A$8r0-|yA8}7 |yA8}7-|y@c8HYuA(,#@4c8HY]A(,#@At8r0-|yAd<`2580 |"yA8c0-|yA<`1580 |"yA8c0-|y@c8HXA(,#@8cHXA(,#@c8HXA(,#@xc8HXA(,#@`c8$HXA(,#@Hc88HXqA(,#@0c8XHXYA(,#@c8|HXAA(,#@c8HX)A(,#@c8HXA(,#@Ā8}1 |y.A`8}1-|yAPA8}0-|yA8}0 `|yNBA81-|yAt8}1 |yAd8}6 |y.AP8}6-|y-A<8}6 |yA,,A$8w0-|yA8w0 |yAc8(HW-A(,#@c8HHWA(,#@c8`HVA(,#@c8pHVA(,#@c8HVA(,#@c8HVA(,#@tc8HVA(,#@\c8HVA(,#@Dc8HVmA(,#@,c8HX`,Ab0y@p,=@c8HV%A(,#@8cHV A(,#@MRPBALc8HUA(,#@c8HUA(,#@c8HUA(,#@c8HUA(,#@cHW`,A4cHW`,A84cHW`,@c8c8Ax|@```!,2~~D @/@(Ab`~O,@@8T>, @,2@ :@A `~K,2@Db, x$|*@88`8K`H@8bx&| *HH``|8bKؽ` 8b880K}A(8|cx&|K]A(8bKq`P0| @Ab0`X|#@@`8hp0| @@88b88Px&|KA(8bK`8|=@w@8`wy, |` A(p`A , @TK!`| @ , @(; 880cKEA(@88Hx&x$|"|0* K A(cK!`Pb0|#@AX|#@@b`8bhp0|$@@88`ڀ} 88!|08@!HAPaX`hpx!AaHUK`KK`K88`8K`~K@c8XHGA(,#@D8cHGA(,#@,, A ,@`ATc8lHGUA(,#@Hc8HG=A(`qc8HG)A(,#@0~@(1br@`c8HFA(,#ATc8HFA(c8HFA(c8HFA(c8 HFA(br, A ,@,2@̈], @cHH`,A H@8bx&| *HD``|8bKԽ` 8b880K}A(8|cx&|K]A(8bKq`P0| @Ab0X|#@A`K c8(HEA(,#@h<0+ , ApKdc8H@A(~@(#br@`K,2MBQA(Kc8H@A(,#AP8cH@A(,#A88 cH@A(,#@P8(cH@yA(,#@8Kc8H@]A(,#At , @Kdc8 HCA(,#AKc8/HCA(`pK,@P, @H, AA(,#@ڰ8cH>A(,#@ژ8cH>A(,#@ڀ8cH>A(,#A48cH>A(,#@P8cH>yA(,#@8c8 H>aA(,#@ 8cH>IA(,#@<, A(c8H>%A(,#A , @c8H>A(,#A8cH=A(,#@٨cHA=A(,@`<0+`,A8dbH>`,Ap8lbH>`,AX,@c8xHA(,A ;( |A ;K8cH=m`,AL8cH=U`,A48cH==`,A8cH=%`,@dcH=A(rbp,A,1, A,,@@؈A؄KcH;A($:*`f|ATKc8H:]A(,#A8cH:EA(,#Ax8 cH:-A(,#@8(cH:A(,#@KDc8H9A(,#A , A8Kՠc8 H=A(,#AפKc8/H=AA(`}KȈ, @ , A5, @, A238v0 |yAt8v0-|yAh,A8v0-|y@4c84H5A(,#@Ѭ8@cH5A(,#@єc8TH5A(,#@|8tcH5A(,#@d>208t0 |y.At8t0-|yAd8}7 |yA8}7-|y@c8H5EA(,#@c8H5-A(,#@AĀ8t0-|yA<`2580 |"yAT8c0-|yAD<`1580 |"yA8c0-|y@c8H4A(,#@x8cH4A(,#@`c8H4A(,#@Hc8H4qA(,#@0c8$H4YA(,#@c88H4AA(,#@c8XH4)A(,#@c8|H4A(,#@c8H3A(,#@ϸc8H3A(,#@8}1 |y.A8}1-|yAAx8}0-|yAh8}0 `|yNBAP81-|yAD8}1 |yA48}6 |y.A 8}6-|y-A 8}6 |yA,A8v0-|yA8v0 |yAc8(H2A(,#@μc8HH2A(,#@Τc8`H2A(,#@Όc8pH2A(,#@tc8H2A(,#@\c8H2A(,#@Dc8H2mA(,#@,c8H2UA(,#@c8H2=A(,#@c8H4]`,Ab0y@,=@c8H1A(,#@8cH1A(,#@pMRPBALc8H1A(,#@Ϙc8H1A(,#@πc8H1A(,#@hc8H1uA(,#@PKcH4yA(bp#Kc``!H19A(,#c@$yA Kc8H1 A(,#@8cH0A(,#@̰8cH0A(,#@̘A̔Kc8H0A(,#@xKc8|H0A(,#@\8cH0A(,#@D8cH0mA(,#@,Kxc8$H0QA(,#@8208v0 |y.A8v0-|yA8}7 |yA8}7-|y@c8H!iA(,#@(c8H!QA(,#@A8v0-|yA<`2580 |"yA8c0-|yA<`1580 |"yA8c0-|y@c8H A(,#@8cH A(,#@c8H A(,#@lc8H A(,#@Tc8$H }A(,#@+A8c``!H uA(,;A~;(+@;,# A4c``!H 5A(,;AT;( @8cH`,A8cH`,A8cH`,A8cH`,@Ktc8H9A(,#A8cH!A(,#A8 cH A(,#@8(cHA(,#@KcHA(p=@A @; 88pccKA(=@8@c!Hx&|"K٩A(cK`P|<@AX|<@@Kpc````!H A(,#c@yAKc8HA(,#@8cHA(,#@8cHA(,#@hAdKc8HA(,#@HKc8|HmA(,#@,8cHUA(,#@8cH=A(,#@K$c8$H!A(,#@8AKc````!HA(,#c@yAKb0y@,>AxKc`!HA(,#c@yAHKc8HA(,#@X?228~0 |y.A8~0-|yA<`3381 |"yA8c1-|yA?238}0 |yA8}0-|yA,A8}0-|y@4c84HA(,#@8@cHA(,#@c8THA(,#@8tcHA(,#@t8cHA(,#@8~1 |y-A8~1-|yA|A48~0-|yA$8~0 `|yMBSA 81-|yA8~1 |yA8~6 |yA8~6-|yA8~6 |yA,A8}0-|yA8}0 |yAc8(HA(,#@c8HHA(,#@hc8`HA(,#@Pc8pHyA(,#@8c8HaA(,#@ c8HIA(,#@c8H1A(,#@c8HA(,#@c8HA(,#@c8H!`,Ab0y@,>@?258~7 |yA8~7-|yAȀ8~0 |y.A8~0-|yAA8~0-|y@c84H]A(,#@88LcHEA(,#@ c8dH-A(,#@c8|HA(,#@c8HA(,#@c8HA(,#AtKc8tHA(,#@8cHA(,#@8cHA(,#@t8cHA(,#@8cHiA(,#A4c8HQA(,#@,8cH9A(,#@c8H!A(,#@8cH A(,#@8(cHA(,#@A|Khc8HA(,#@8cHA(,#@c8HA(,#@|c8HA(,#@dc8 HqA(,#@Lc8@HYA(,#@4c8hHAA(,#@Kc```!HA(,#c@@yA<Kc8HA(,#@8cHA(,#@8cHA(,#@xAtK@c8HA(,#@XKc8H}A(,#@<8cHeA(,#@$K8c8HIA(,#@8cH1A(,#@8cHA(,#@8cHA(,#@8cHA(,#@Kc8HA(,#@8cHA(,#@tc8HA(,#@\c8(HA(,#@Dc84HmA(,#@,c8@HUA(,#@c8LH=A(,#Ac8TH%A(,#@c8\H A(,#A8dcHA(,#@c8hHA(,#@Klc8tHA((#8d @`` KThK@@KH@c8bx&|" K̽A(8bK`K888apH=`KK1`KhK%`K<"C ^ BrCopyCheck`T>`|aA}&b8c!a8,#|x$|*A@pA`b , A KQ`KI`b| @0H | @$b , A K`NHNBA ;b808ccK9A(@8{cGHx$|@*x&}"KA(ccK`Pb0|#@AX|#@@b`8bhp0|$@@8bi, A 8;08cKuA(H@8cEx&|""KMA(cKa`Pb0|#@AX|#@@b`8bhp0|$@@8H,>b,A @l/ A8H8@8,A8H8,AH88@D, AT, AL,AD,A<,A4,A,,A$,A,@ ,AH,A@bd, A@p`A b , A K`K}`b| @H |` @b , A KI` 8;08cKȁA(@88Hx$|@*x&}" KIA(cK]`Pb0|#@AX|#@@b`8bhp0|$@@88`8H!`!Bab8,%8|x$|*A8pA ,#A K5`K-`| @H | @ , A K`8ap8c&KEA(: 880bK!A(@8w8pHx&x$|B|0*KA(bK`Pb0|#@AX|#@@b`8bhp0|$@@8Hb/ 2, LBBA,A,Ax , A , A9, A<, A08z4HA((,#@@8z@HA((H,8zHA((,#@8z(HA((,#@D8zLHA((,#@,8zXHA((,#@8zhHiA((8HA`d t:~:@b@HLH`8XbH`b, ADb|#yA4bH`b8.HEA(,#AHbH`8bHA(8c8x$| *Kq`abH`aHA(,AL89@&"8bP9D0x$|8*Ke`H  :@8b@pcH`b8LH`b88H`b8LH`,@b8Hm`b8LH]`bHM`8bH=`bcH-`b8LH`b88H `b8LH`8bH`b8LH`bH`b8LH`bH A(0|c8\JKA(b+, Adb8LHy`8bHi`H@,@lb, A(8bH=`b8LH-`H$8bH`b8LH `bH`H 8bH`b8LH`bH`b8LH`bHA(|c8\c%KA(H l,A4,A,,A,A0hH(0@H0,@ XH`b :@@ ,A,A.A,A:@8PbH`8LbH`bbH`b8$HA(,#A H`b8$HmA(8bH`b8$H%A(,#A \8\c%KA(b8$HA(8bHQ`H (:@8c@bH9`b8$HA(,#A Hq`b, @0, A , @8bH`H8bH`b8$HyA(8bH`b8$HUA(,#A dH`8$aH1A(8b`HY`b8$H A(,#A @DH`c8$HA(8b`H `b8$HA(,#A ,$A HA`c8$HA(Hc8$H}A(8bH`H :@8PbH`8LbH`bbHq`b8$H%A(,#A 4H`b8$HA(8bH-`H :@]. AxbpH`b8LH`88bH`b8LH`8bH`b8LH`8LbH`,A,A-A,Ab8PHq`b8LHa`b8, AbH=`HbH)`b8LH`bH `,8A|b8LH`8DbH`b8LH`bcH`c8 HqA(,#A$8 bH1A(]. b8LHu`PbHe`b8LHU`8HbHE`b8LH5`A8ZbH!`b8LH`b8H`b8PH`b8LH`bbH`b8$HA(,#AH `b8$HaA(8bH`b8$HA(,#AD8\c%KA(b8$HA(8bHE`b]. Hb]. 8|bH`8bH `b8LH`8bH`b8LH`8bH`8bH`b8H`ApHL8PbH`b8LH`b"8, AbH]`HbHI`b8LH9`bH)`,>A|b8LH `8DbH`b8LH`bcH`c8 HA(,#A$8 bHQA(]. b8LH`PbH`b8LHu`8HbHe`b8LHU`A8ZbHA`b8LH1`b8H!`bbH`b8$HA(,#AHI`b, @0, A , @8bH`H8bH`b8$HQA(8bHy`b8$H-A(,#AH`8$aH A(8b`H1`b8$HA(,#A@DHi`c8$HA(8b`H`b8$HA(,#A`,$A H`c8$HmA(Hc8$HUA(8bH`b]. Hb]. 8|bHU`8bHE`b8LH5`8bH%`b8LH`8bH`8bH`b8H`AHb8PH`b8LH`b8, AbH`HbH`b8LHu`bHe`8,9A|b8LHI`8DbH9`b8LH)`bc$H`c#8 HA(,#A$8 bHA(]. b8LH`PbH`b8LH`8HbH`b8LH`A8ZbH}`b8LHm`b8H]`b8PHM`b8LH=`bbH-`b8$HA(,#A<Hi`b8$HA(8bH`b]. 8|bH`8bH`b8LH`8bH`b8LH`8bH}`8bHm`b8H]`A$8ZbHI`b8LH9`b8LH)`,;AL8bHaA(8c8x$| *K `bH=``t|, A8p`A ,#A K~`K~`| @H |` @Ȉ , A K~y`; 880cKA(@8bHx&x$|B|0*@K}A(cK`Pb0|#@AX|#@@b`8bhp0|$@@8bz} 88!p|!AaN 08K$ C  BrRewindBuild|}&`!qaАb88|c,#x$|*A@pAdb , A K|`K|`b| @4H | @(b , A K|Q`NAH NBA 8;08cKuA(@8~cHx$|@*x&}"K=A(cKQ`Pb0|#@AX|#@@b`8bhp0|$@@8bi, A<@c8bHx&|" KA(8bK~`H4c8tH5A(,#@ ccHA(,#@c8HA(,#@b, A, '@ H,,>Ac. 'HA(`}@@cHA(`}8|8H`|`4T@;W>8|8H`|`4T~88dH8<`#S8UC|:xhC|f+yAT<`#I8NF|"xhO|yA؀<`#W8ARhN|*x|yA\<`#E8RRhO|*x|yAc8HA(,#@c8HA(,#@dc8HeA(,#@Hc8HIA(,#@,c8H-A(,#A``aAbb|}&8,%|x$8!|*A8pA$~ ,#A Kp`Kp`| @H | @ , A Kp`,?A H8&8ap8KA(: 880bKA(@8v8pHx&x$|B|0*KmA(bKs`Pb0|#@AX|#@@b`8bhp0|$@@8:b 8,((@(Ad( 88y(+@ @ Ah, A4,A,b 8c(pHQ`b 8L8c(H=`88b 8c(H)`b 8L8c(H`8b 8c(H`,4ATb 8L8c(H`8Hb 8c(H`b 8L8c(H`b b8c(H`,5ATb 8L8c(H`8b 8c(Hy`b 8L8c(He`b b8c(HQ`8Lb 8c(H=` . AB8, Ab 8c(H `Hb 8c(H`b 8L8c(H`-A,A,?A4,$Ab 8c(H`Hb0|?@@,X,$A b 8c(Hy`,?AH,?A(0,$@b 848c(HE`Hl84b 8c(H-`Hx`,$A b 8c(H `,?ATH,,?A48,$@8b 8<8c(H`, @PH8@AX|>@@H, @t 8;c8cKtmA(H@8}8tx&|"KtAA(cKDU`P|>@A\HLH, @t 8;c8cKsA(H@8}8 0x&|"KsA(cKC`P|>@AHЀ(,|@Ad8x HA(,@L"8#B89bPIyi$|H*K^Y`b04|@Ah8x HaA(,@P"9`8$B89bPiy$ |H*K]`bccK,#A`,A b, @PH~>@c@X88bc8KrYA(8bcex&8c|#@Kr5A(8bKBI`AXHH8b8qc8KrA(8bce8cx&|. KqA(8bKA`AHbccK,#Al,A b, @PH~>@c@X88bc8KqeA(8bcex&8c|#@KqAA(8bKAU`AdHT8b8qc8KqA(8bce8cx&|. KpA(8bKA`AX|>@@ b`Cbhp|>@@c@H`8ap8 PHKpA(88apHmA(8c8x$| *KO`a8pHE`aHYA(,AP89`&Bcx$"89d0|8*K[ `H8ap8 KoA(88apHA(8c8x$| *KNU`a8pH`aHA(,AP89`&Bcx$"89d0|8*KZI`H8ap8 Ko A(88apHA(8c8x$| *KM`a8pH`aHA(,AP89`&Bcx$"89d0|8*KY`H"a```88X8H99*H9JKn%A(b,'A( a8$88KmA(HaaH`ca``88X8 9*HH9J KmA(bd, A@p`Ab , A K: `K:`b| @H |` @b , A K9` 8;08cKmA(@8~8Hx$|@*x&}" KlA(cK<`Pb0|#@AX|#@@ b`Cbhp0|$@A`C8`A 8!}8N bd, A@p`Ab , A K8`K8`b| @H |` @b , A K8y` 8;08cKkA(@8~8Hx$|@*x&}" KkyA(cK;`Pb0|#@AX|#@@ b`Cbhp0|$@A`C8`8 8!} |AaN C BrSsAbPrepare|}&aAaT>!; aA!ABa ( 0b8 8 @,%8|xc$|*ApA܈ , @K6`| @ , @l; 880cKiA(@8x8Hx&x$|"|0*KiqA(cK9`Pb0|#@AX|#@@ b`#bhp0|$@@8H, A<:(,|@@䀘04|@A8x H)A(,Al8z @HA(,#A`d8aH`8acK,#A,Apb P, ~< @@8b88cKhaA(@H88b8cx&|"#@Kh5A(8bK8I`AX|<@@ b`#bhp|<@@8}, A`p`A܈ , @@K4i`| @ , @; 880cKgA(@88Hx&x$|"|0* KgUA(cK7i`Pb0|#@AX|#@@ b`#bhp0|$@A`#8`8 8! |Aa} !AaN K39`KK3-`K|` @K8b88qcKfeA(@H88b8cx&|". Kf9A(8bK6M`AK8a8 p8:X8X8 lKfA(8acK,#A,Ab @, bHP~<@@T8b88cKeA(8b8x&8c|#@KeA(8bK5`AdKT8b88qcKe]A(8b88cx&|. Ke9A(8bK5M`AK8a8 p8b8 xKe A(8acK,#Ap8 XH8 C8aDb8 Pb9 Tb: Xx: \:z ta8 KdA(8aDcK,#A,Ab @, bHP~<@@T8b88cKd5A(8b8Dx&8c|#@KdA(8bK4%`AK8b88qcKcA(8b8D8cx&|. KcA(8bK3`AK8ap8 pxb8 Pb9 Tab8pXHKcaA(8apcKq,#A\,Ab @, bHP~<@@T8b88cKc A(8b8px&8c|#@KbA(8bK2`AK8b88qcKbA(8b8p8cx&|. KbA(8bK2`ApK`8z HEA(,#@P@, Al~.7@,;@H8a8 8pb89H9:Kb)A(8a8 8pb89H9: KbA(8acK,#A8؀a 08pb8H9 .9:H9Z4KaA(a 88H`a @pH`a H8LH-`88a HH`a H8LH `8bbbH5A(,#@p4p AT89` "cB89g`x$|8*KE]`KHbHA(,A8"c8B9'x$|8*KD`K8XbHqA(,#AKXH8X8 Xx8ap8 \8 8 P`9 T`8 dKYqA(Kb98$8 c8"| *x$|8*KDA`K,8x HA(,@ 8#b98#cK;b 88cccKXA(H@8{8 0x&|"KXA(ccK(`P|<@A`X|<@@\KPK$`KK$`Kd| @(Kl Ch BrSsJvPrepare|}&aA`!ȑ8!8ab|c,#x$|*A@pAb , A K$`K$ `b| @H | @b , A K#` 8;08cKW A(@8}Hx$8|@*x&}"KVA(cK&`Pb0|#@AX|#@@b`8bhp; 0|$@@8H; 8a8 PKVUA(8a=H9A(8c8x$| *K4`a8H`aH%A(,AP89`&Bcx$"89d0|8*K@`H`H0b,%A8a8 KSA(H<`e8ab8 8X8 t`9+ `8 pKSEA(88aH)A(8c8x$| *K1`a8H`aHA(,AP89`&Bcx$"89d0|8*K=`H,b,%A0aB`88X8 9*H9J KReA(H\`eab8 8Xx8 t`9+ `8 pp9 ;H9k aKR A(acK,#A, A,Ab ;PH,$b@;]~?@@c8c8KQA(cCx&|"`KQyA(cK!`AH, Ax;b HPb@;]~?@c8c8KQA(cCx&|< KPA(cK! `APH@bd, A@p`Ab , A KM`KE`b| @H |` @b , A K` 8;08cKPIA(@88Hx$|@*x&}" KPA(cK %`Pb0|#@AX|#@@ b`#bhp0|$@A`#8`!@8!0}8N , @p 8;c8cKOaA(H@8}8x&|"#@KO9A(cKM`P|?@AHx, AH, @| 8;c8cKNA(H@8}8x&|"#@KNA(cK`P|?@AX|?@@H, At 8c;8cKNYA(H@8}8x&|"< KN-A(cKA`P|?@A|Hl 8qc;8cKMA(H@8}8x&|". KMA(cK`P|?@AX|?@@ b`#bhp|?@@c bd, A@p`Ab , A K`K`b| @H |` @b , A K` 8;08cKLA(@88Hx$|@*x&}" KLA(cK`Pb0|#@AX|#@@ b`#bhp0|$@A`#8`:8@8!0} |!AaN C BrSsBrPrepareۡہ`;;aA!`vbB"|b8,%8 |!xc$|*A pA , @ |K`| @Ȉ , @ P; 880cKJA(,'@@8xHx&x$|"|0*KJA(cK`Pb0|#@AX|#@@ b`bhp0|$@@8b, @, @, A), @', @, @,@b, A(), @', @, Ad, A, @Lp AHv@|`yA0ˣ0b', @, A@, Avh|`yAc|`yA8p| A$`!c|`yA| @, Alc;,8A\c88HeA(,#@89bX|?@@tz, AXp`A؈ , @8K=`| @ , @ ; 880cKHaA(@88Hx&x$|"|0* KH)A(cK=`Pb0|#@A |#@@ b`bhp0|$@A`8`8pXPˡH8!`}!AaN K`KK `K|` @Kcc"| *x$|8*K2I`K`\a,@A b', @, A@, Ah|#y@ H;V>"8LB A8|=2HUA(`e|w8H A(`uLA@(8|=2H A(|5@@$b98 8PKH`uaHA(,A 98bK8 LcHAA(|vy@ b98KV>8"b|wbHA(|#@@$98 b8XK{db|P|8<^HA(,A b98@K4=HA(`e|8|wbHAA(`|=HA(|<@@$b9 8 8XKbHMA(,A 9 8bKz, Ap`A܈ , @K`| @ , @; 880cKDA(@88Hx&x$|"|0* KCA(cK`Pb0|#@AX|#@@ b`bhp0|$@A`8`8KK`K4K`K|` @K;8K؀t8a|!HA(,A#H]A(`u|w8.bH `K,8AKhbˣKh@`Kv88K5vK8, A@\,A ,@,v,#A 88xK4vKv88xK4vKKa`KKU`K| @PK"A  DBrSparseCreate`~|b80c!a8,#|x$x|*A@pA b , A K `K `b| @H | @b , A K M` 8;08cK@A(@8}cHx$|@*x&}"K@MA(cKa`Pb0|#@AX|#@@b`8bhp0|$@@8b, Ab, @, +AcHA(,Ab|A;B8b9axx$"c |8*K*}`bd, A@p`Ab , A K `K `b| @H |` @b , A K ` 8;08cK>A(@8~8Hx$|@*x&}" K>A(cK`Pb0|#@AX|#@@ b`bhp0|$@A`8`8Hxbd, A@p`A b , A K `K `b| @H |` @b , A K Q` 8;08cK=A(@8~8Hx$|@*x&}" K=QA(cK e`Pb0|#@AX|#@@b`8bhp0|$@@88`8H|b8c!8,#|x$|*@| @b , @,>A  8;08c " $ptK&A(@8~8pHx$|@*x&}"K&}A(cK`Pb0|#@AhXb0|#@AXp;`dbh|$@@4bd, @|` @b , A(K` 8;08cK%A(@8~8Hx$|@*x&}" K%A(cK`Pb0|#@AXb0|#@App`dbh|$@@48`8!8}N 8!8`8}Kp0`bh|%@@K 8;08cK$A(@8~8Hx$|@*x&}" K$}A(cK`Pb0|#@AdKp`Ab , @ K`b| @KK`K`b| @KK8p0;`bh|&(@@K 8;08c * ,ptK#A(@8~8pHx$|@*x&}"K#aA(cKu`Pb0|#@ALKK`,>AdKD;KpAb , @ K`b| @KK`K`b| @K ABrOraSrvControlb|ab| !a8,&|8x$|*@ @HhA$8`}8HԈ , @K`| A$HKm`Ke`| @|8 8 ;0, c@hK!A(8 8|@Hx$x&|B|0*K!QA(cKe`0bP| @AHK`8 80cK! A(8 8|@Hx$x&|B|0*K A(cK`0bP| @A,X0pbh|$@A|$(@@@H(8p0`bh|&(@@8| H| H8`8}8!aN  , @K`| @H(K`Ky`| @H@8 8 ;0, c@hKA(88@Hx$x&|B|0* K]A(cKq`0bP| @AHK`8 80cKA(88@Hx$x&|B|0* KA(cK`0bP| @A,X0pbh|$@A|$(@@8H(8p0`bh|&(@@8K(8!8`}8K , ApA(8`8K Al BrNtFilterb|c8|` 8e~,&!|ex$|*@ @HlAb, AhAHb , @ K`b| A(HK`K`b| @b , @ 8;08cKA(@8Hx$8|@*x&}"KA(cK`Pb0|#@AHK%` 8;08cK]A(@8H8x$|0*x&}"K!A(cK5`Pb0|#@A0Xb0|#@A p`dbh|$@@DH(8p0`bh|&(@@8| H(b| H8`88!}N b , @ K`b| @H,K`K`b| @H@b , @ 8;08cKA(@88Hx$|@*x&}" KA(cK`Pb0|#@AHK` 8;08cKMA(@88Hx$|@*x&}" KA(cK)`Pb0|#@A0Xb0|#@A p`dbh|$@@8H(8p0`bh|&(@@8K8!8`8}Kb, A\A8`8K A BrBinOpenT>|}&aA;;!`;`;@; aA!xph`8!B"a p x8 a h8ch,$|cxc$| *AWb8 \HZ]`|`4TA:btb8 hHZ9`|`4TA:sta xH^qA(,#@89`2"9 xbp]gyJ$|P*K`, dAxp`A , @XKU`| @ , @(; 880cKuA(@88Hx$x&|"|0* K9A(cKM`Pb0|#@AX|#@@ b`cp0bh|$@Acc8`8 z h8! p|} `hp!xAa!AaN K `KK`K|` @lK8a H\A(,#A 0PmA(8 x"x"|8a8x"|}*!8lK A(, A, @, A,9bAb808KA(8t8X8x&|u`KA(bKŭ`b0P|#@AX|#@@rb0p|#@@c`;T&K Kbx&| *H5%``tbK5`; K88aXHC)A(,@Ĉ, @, A,9bApb808KA(8t8X8x&|vKA(bKĩ`b0P|#@A X|#@@Kbx&| *H4Q``tbKa`; Kh98b8X9" bPx$|8*K `T&K8wK5a8aH;A(8 x"x "|8a8x"|}*!8lKuA(8`T&(a@$8aX8K `,Ad,.A````!8bH5A(,Ad|@4}sy@a,#At8|#@AhK`K\88/"b9Bbp<xy'$|8*Kݝ`KܘT&(@@|8n8)8K5 xH6-`8,a @8|$(@@A(,@b,9,@LA9pb,@T808KUA(8arx&|v K-A(bKA`AKb088KA(8arx&|v(KA(bK`ApK\bx&| *H/``tbK�`; K:89b9"bPx$|8*Ki`KT8`KL8a\8XH/-`8\9:,.AKa H0A((# @x, s@l, dA, eA, fA , g@HwH@%A(,A4aH@ A(,AaH?A(,AwH?A(,AwH?A(,AwH?A(,ÄwH?A(,A޸, .@ެwhcehtb|yAߔKސ8wKea8aH6 A(8 x"x "|8a8x"|}*!8lKA(8`T&(a@8aX8K `,Aה,.A````!8bH0A(,Ab|@4}sy@a,#Ah8|#@A\K`KP88/"b9Bbp<xy'$|8*K`K̀T&(@@xn88)8Ke xH0]`,@8a| @@@8 8~ < 8pT&8p|4U~K@,AT>|H* `8!p}N A0 CsSetHead|!`f|9At9!x8p|8`8KQ,A8`8!}H|c8!}N Ad _CsInitCompr``(`||9(!Q( abA(8c(@ ,@8H` ,@h| HN!A(9At`9!x8p88K)` ,@,`db8ce| EN!A(,A8`8!}H8!}N A4_CsInitComprEx|!89!t9x8p88K},A8`8!}H|c8!}N AX_CsInitDecompr(|8(| `!a( aA(b@,@4H`,@f| FN!A(9!t9xa8p888K`,@0(`db8ce| EN!A(,A8`8!}H8!}N A_CsInitDecomprEx8b!|88.x$x$,8|P8dx@Đ (08@HPX`hp| `!|78C 8d88xfdx$8`8!pΐN 8H`8`8!p}N A( ResetCounter|`<!`hKA(,#A,<8x$8@H|d1*P\H8`8!}N At CsAllocHandle|88`;8!q84| ``!88,&A 8cC 8`8!N 8.xcd8|,8A|8{$8|x$|c *,#A|@ATKE{d,A$|c888!}N {d8c|c}8!8KcK!8,#Ax$|@AK\{d8`|8!}0Kx ACsSearchNewHandle,M Tc>H/N @ CsFreeHandleT`>88`|80xd|(.,M `H.tN @4 CsOpenHandle|`!K,,@|c8!}H8`8!}N AP CsRGetHandle|d8dK @ CsRCloseHandle|;8`!``!K;8|(?A8!}N ALCsRCloseAllHandles88`|x$8,,M L xd|(*80, M |0.|48TN @TCsTestValidHandle|}&aA|ka!``a\`T>aA!xp`lac!B A(!W>K,@db(|#yA$b08cd| DN!A(8`@8!0}!AaN }  8 N}8|@0b8y$ydU'<88c|!.|c(*T>TF>N @ CsWriteLen|}&aA`k`!``a;aZT>T>aA!xp|l! aA(?K,@hb(|#yA$b08cxd| DN!A(8`p8!`}!AaN } }N@ `,@tb(|+yA(b08ce| EN!A(8`pj8!`|!} AaN cH i888|z$8zd9|(*|h9.cA ,9@؀`,@a;8~|` M@, @̀, @t@$@d\s@| @APb(|+yA$b08ce| EN!A(8`pj8!`|} K`p@Ds@H]`sHHQ`sPKeA(8Pcpj|K @(08| f| FN!A(pAH8|H f| FN!A(KTpAt(b0c8ce| EN!A(cpj|KP(b0|8c`e| EN!A(@a H@t@KP(b0|8c8e| EN!A(Hc HKpA(b08cf| FN!A(@@(Ka| .T~, ,A@|t*bcicJHm``x,Ax,9@|t*|`|||(8~YVE>Hb`X8`|@|X[z@;8@| @LK0HsPHѐfaxsP8cHTe>8s\Xp@~ܺsH|@ | @0|t*HN @TshowBufT>N @ CsRGetAlgorithm|%@D| @0cTT@.|Tc|||N 8`N @\ CsRGetLencTT@.|Tc|||N @0 CsReadLenT>N @ CsRGetVersion,T>A@T>TF>8`N 8`N @P CsRSetHead|!q`9|`|c9Ap|88`9Kߥ,A8`8!}H|c8!}N ApCsRInitCompress|!|c9At9!x8p889KY,A8`8!}H|c8!}N A\CsRInitDecompress|`aA!aA!!088KA(a0,#A8aKuA(a,#A8a;;:;;`;@K5; ,A,<@,;@xaKqA(aKeA(aKyc#@8!0}!Aa!AaN ccKɽA(KcKɭA(Kha88HA(aKʕA(88`yaHA(,?,A\;AD(2`A:(2,A;AbKA(||y@ ; KcKA(|{yAa6cdb~K,|y@cc88K±A(:,a0A ; K\:cDcp```!,AD|`PZHA(`y8pabcE~hb9 9AK`tHA(|P,xUdx.|Px$|"~|`xqtA~`P,A$|,~Aa~KP|Pcc8|KA(||@<acp,c~@,?A< ?K,; ,?A ?K,?A ?Kc8bKAA(c`}K:#K:K8`@8!0}!AaN aK A(8`@8!0}N 8`@8!0}N AlCsFileCompress|`aA!aA!!088KA(,#aA8aKA(a,#A8ap;;;;`Kץ;@,?,@D; A?(2(2A;A; cK]A(||y@;@,<@,;@taKA(aKA(arKץcC08! }!Aa!AaN ccKA(KcKA(Klc#KĥA(|{yALc88KA(,A ;@K(c`warK::xc3cq,@`!,|A *~PHA(`zar~c~gb&99At9!xK`tHA(|Pat,xUdx.|Px$|*~|xtAx~cP,,|`A~1Ax~KX|Pcc8|KA(||@;C!;`; .: aT>0<|P`!(8~ @LA(|`Tv>Td6Tc|d|PT>z8}@|Tbg|B8K| GN!A(8pp(x~u@4~@````!,5A |T:T|`|P,A8}Xe| EN!A(:88{,%, A@ 3(T{>T>~@:s@A| 8x8}d8K8p'g|T|})GN!A( 8!|a} !AaN 9x8}d8K8pg|T|} GN!A(8:T>@dK$bc8`KhA(88{T{>T>:s(~@@|A`K8}Td| DN!A(K\ C TshowBuf@AF27_1389T(4|"x,N @HashInit`<9'C`9GG8g@|9`8.y&dyI$8!q,8@08gxc$B@8.@| P x   ( 0 8 @ H P X ` h p|````!|8cC .=8g.<8.8.>8xcdx$x&89@@~|(p|c#x~<_$0 88!N ;cH`8b8@x&䈾8!8c}|c |x~<$0 8N ALongestMatchInitT>88aAЁC0!a@|*(>|@H"8B| (;9}y&})RX'@ )x|H@=@ai9J.@}CR}*;H|<AH9,AxUd<|".|@Aa#!AaN }lX|9X@d(;9`9;| @d,````!~;L9|;@c;,A|0@ }kcA`'XH9,ALK4UK;98#B| (}X'Py)&}(J )x|HAK @ LongestMatch|<#`8898x 8!`4| P| P|0@T?A@x|J|BH),AH,8A$<8!}|T>||8||9`|88`2W>HCi` 8!}| N 8`p8!N AMemRead`aA!B8|b8}&8c|,&x&䑁!Q<(.@d(@\*cMBB````!KM2MHNJ@@c4, @<<(@8,$A, Ad<`8c.@8;8?x ;8,8T(48Tc |T>| |"xx hT,|@|.,$,xg|gî@*0(? A|@@|(P(>@<,|@L+A8c||"||HiT`>0<0,98U >8c|0P80|} |xTd,xe h|ec@T ||{#.,xe|e@08,@8`0$, @T88<, @T(@Lc4, @<```!Kc8, @4, @Ѐ<(A,$@Ā$, @8, AX, @Lc8Hq8!|} !AaN c8H)8!|} K88c88T>|(H-KX8!|} Kx|(HT`><8c<||2|(8|"((@ 8| P(A8(KcK-K CComprLZH<<|,aA!aA!xp.9.|.@@xy$d8D|".8|#...T<.p@48. .98. x|2...@,@p@P lT8 tC x p |aX` 8D 99'9J9e9 ;";;&;*;e.;G2;%6:::>:gB:%F9J8}AҠ <} IҠ @}@QҠ D}`YҠ H}aҠ LҠ PҠ TҠ XҠ \`Ҡ `@Ҡ d Ҡ h~~֙~~y~p)AX8}B|J}R|Z}b|}|}|}|}|}|}C N}(`Rc V9F.T~ ;Z ;^|@C # ;hb ;fdj: r:nv:sC # 8 98|)}Ja}k}u|9}A|!|*}%R|Z}%b|}%|}%||:|B|"@ cT|c(PTe~|(@A(?A8`.(@@8`px!Aa!AaN y)9|28H8,T:|J.8|K.@X}x|2|xd8 8|".8|#..8.x|n@..|#x.K |>p8|x|2|K @ct_tally`?`8|. x|.!qHEc8H9cH`l.8.T>c8 8 TT|8@8@lHc}888H!8 88DcH"IcH ,A cH%8!}N 8T>Hi8c8 ,H!cH ,@8!}K A, FlushBlock!E<8x .. |P|80@ .<} Sxf.}JCx9gyJ |8|XA=c}@T.08}E!.T>yE |Z8)."f. |. }#0f.N 8|ZE).T>x |Z8)K.08}a 8}GA..0T>x 9|}$f.". |*. c|0.N |:. }Sx.N @TSendBits|`aA!!QH;X<`88889 }:8|89@y(x }Z}L`0, }@,````!9C |b|8(%A8<P|8y%9}%29`89:8}B ;hygx })}[0,z@$I``!)9)C }k}l8(%A}e>pUh0B9}G@0|,@D|9cy,Z},} `!9)C |:|T80fF9}H@0} ,@8x8|:9`|:})`!g8C |*|T80fJ9}H@0} ,@8x8|:9`|:})`!g8C |*|T80fN9}H@0} ,@8x8|:9`|:})`!g8C |*|T80fR9}H@0} ,@8x8|:9`|:})`!g8C |*|T80fV9}H@0} ,@8x8|:9`|:})`!g8C |*|T80fZ9}H@0} ,@8x8|:9`|:})`!g8C |*|T80f^9}H@0} ,@8x8|:9`|:})`!g8C |*|T80fb9}H@0} ,@8x8|:9`|:})`!g8C |*|T80ff9}H@0} ,@8x8|:9`|:})`!g8C |*|T80fj9}H@0} ,@8x8|:9`|:})`!g8C |*|T80fn9}H@0} ,@8x8|:9`|:})`!g8C |*|T80fr9}H@0} ,@8x8|:|:})``!8C |*|T 80fv8}@0|,@,x8c|8|`|`!8cC 88`9} f f  8f f f f 8 *```!8c 8 C 8 j8p|8 ``!8c 8 C 8.f 8cf 2f 8cf 6f 8cf :f 8cf >f 8cf Bf 8cf Ff 8cf Jf 8cf Nf 8cf Rf 8cf Vf 8cf Zf 8cf ^f 8cf bf 8cf ff 8cf jf 8cf nf 8cf rf 8cf vf 8cf zf 8cf ~f 8cf f 8cf f 8cf f 8cf f 8cf  8 ,c88  8  8  8  8  8  8 H8888``!H8;f{ 8(>A8!}!AaN |K A HufTabInit888@| ````!8C 8 8< < @ DD H L P T X \ ` d h l p t x | $(,048<@DHLPTX\`dhl.... ...N @ InitBlock,aA<T>  U < yI  f i  W}<& F { WN T>N @X ReverseCode<|xd=|29( T<|cJ|@ Ayyd}2`!;|yId}I2 {dR.@}cJy*d}*2yjd}DR.|*A(yk{@}K2}|2Jk|*XAc }D:.{d}$J.|*HA,AHx d`T<}*2| &|H@\xd|`2 N {hxd}=2}_2)|+H@` FT<} |PAK}$:.|)AAKl @l pqdownheap=889@aA!aAd$$ {d;B       !  xd|.;,=@,$ =A?#=; {{d8````!=;; |`:{[dc|EZWZ:_.:|H@ W >a7|X~{8~.zB{dA`+P`5zd ; .A~.h.(.W>xh.D.vWz>.C D,*A88 ;|}+x|` ,=@p;?; ,=@$```!;{;,=A;;;J{j}JB{ByyyB, \ 9J\ [ 9J[ @?J; 9J}Jt}J9J}I` c`,=@9J,=@$```!;9J,=A}Z9J;{]]B}X{}]B ; [ 9J[ C |,)A<8 8 ||c"|y}i}GXP,$Axd}_}&;;8)| `})A@W>y=d}%| @|PA$...I``!,$;A ;&8| `})AK8C \!Aa!AaN c9J{]}X;]B{KB ;K{}d<8 |"|"| ``!D8;*|`[{}dce{W{:.;{|H@ W*>a;|Xy{8.BADKP:Y{:d= ;9= .A .W>h..C hK @ GenBitLen|`?aA`8`!;d8=!A,@<`| 88 8|:cB@P````!8, A`8| yHd|A. 89)C 8, Ax`8|xd|!. ,@D|z,%A<8,|888@x8c`h|z|,xd|2|< xdx`|;.C..=.8.|2.,|HP.@8AcK~$|p|,@@c|c|P|`!K1;cc|P||8@A<`|= `xd8c|x|xd8|~8;~*cc 8 ``!K{&d {%|c8xdx|yEd}$}Ec8* ]9J]}Kyld}L |2.}\B.|R:)8 |'H@8T>xC.:x3.} ;{Kcc8,|A$8xd| =  K c8|xd| KAcccEK8!}!AaN <,88|"8@d8c`g|z|,xd|*|< xxd|+.3..8.,@8AcK|zKhK89)C ,Kd A | BuildTree88|,xd,8|`8|3.M 89@9 9@8$} ````!`88|P|HA@`, } ayId}FJ.}J*}FK.8@9 9@C N L9 @9@C K9 9@C K,(, @8A$h8h, 8a@Kl8lK|8}Axd|:.8|;.d8dKAd@K09 9@K @dScanTree`l,|aAУ|!,8!AA:@8`8;;;&;l$;Db:c;|(|A@a xd|.|.K,A:~a`!$&Ka:|6@A,?:c @L8`8|=@Al8!}!AaN L8`@ 8K8`8K,?:c @K,9|@X, aA(hjK 8a8T>KKlnK8a8T>KKad f@ K8a8T>KK`xd|".|".KafdK}8a8T>KiK(@|=@@K(@(KH8`8K8!N A pSendTree|`8D!K8 8K8K8&886<8`&T:|:.,'@83%T:|:.,'@|80$T:|:.,'@|8-#T:|:.,'@|8*"T:|:.,'@|8'!T:|:.,'@|8$ T:|:.,'@|8!T:|:.,'@|89 T:|:.,'@x8T:|:.,'@x8T:|:.,'@x8T:|:.,'@x88`T:|:.,'@8`8T:|:.,'@|8 8`T:|:.,'@``8`T:|:., @ .8`8.H8`.|8.H8`.|8.H8`.|8.H8`.|8.H8` .|8.H8` .|8.H8` .|8.Ht8` .|8.H\8` .|8.HD8`.|8.H,8`.|8.H.|B8.8!}N .8!|8.}K A8 BuildBlTree|``aA|`88!aT>Ka8T>8cKI8T>c8K1,8c@H8;;&;d```!;{xd|".K;c8|=@A88DcK-8 8c8K8!}AaN A SendAllTrees|== aA`<!`9I9 888.?aA! .!XP, 8n>AcRCB#2ax*~"~::::\``!za7VaxA:, :@~ xd|".|".KmV~ .xt |@AaxKI8!}!Aa!AaN ~ x~".8T:|".|".KV:(| .,|@:@`zax|bxd|.|.Kܕ|., |Aax|.|PT>KqV~ .xt |@@KVax8T<|bxd|.|.K1|., |@Kax| .|PT>K :(@KD;::r@K\8!K۸ A CompressBlock<8. ,,@<.9|y( })..<|0@ 8.0||)N <|"8)N ?a'@P9.0}f9.T>yg }8).<8.|0@Kl8|g).T>x }8)K$.<@<.|H9&@.0#|}1K|:8)Kh @ FlushIncomp|` =888!., A Ke8!}N HMA(T~c8cK1,>AH)A(8|08|8cT>K8!}N A BitBufInit88xxhBX888C9; ,C9cDc; 89c9$c8( (#0N @InitDesc|`~aaA;`!`?#a?`y aW!1`@y.(8Y.8 x .<.0|2| @@||.8,%A<<.8)H `.<~@|P8`.<KK,&pY.8y.(:, .0z.@K`,ApcKcK֙8.ccK)|@@8`8!}K,8`8!}K8`8!}K A t CsRComprLZH|U > !Q 9Ap  W< vT>|!9$T> | |Uy", y "A|P|N U >| P|N y"y#"|P|N y y# |P|N | @P|N `(%@K( (@8@ `fc|t`} y(9)})B@4````!}@XP, @tcT>Uc>A|(P|N T>|P|N @ memcmpU168`N @memchrU(%8@08x |``!8|$A8C 8`N x|cN @L memchrU168`N @memsetU8(%@x |t8Tx |x9G}Kxxd}x}I`!8C |(Px$88|2(%L 8|````!8C N `f(%L K @ memsetU16|!KtA(8!p}N A$mallocU|!HUA(8!p}N A$reallocU|!HA(8!p}N A$callocU|!axH`ax8!}N A,memcpyU|!axH`ax8!}N A,memmoveU|!|& @(@0A8`"8!pN H`8`"8!p}N ``H`8`8!p}N Ah memcpy_sRFB|!|& @(@4A8`"8!pN xH`8`"8!p}N x``HY`8`8!p}N Ap memcpy_sU16|!|& @(@0A8`"8!pN H`8`"8!p}N ``H`8`8!p}N Ah memmove_sRFB|!|& @(@4A8`"8!pN xH`8`"8!p}N x``H`8`8!p}N Ap memmove_sU16@A( L| N HA( L| N |fx|#x|3xH @bcopy @memmove`A( L| N 8`N @CsRGetStorageSize,@ 8`N T>T>T>HD @ InitComp|a_,aA`}`!`aA!xp8! pA ,A,%A ,'A |%8@A |y }(}c@d?#<,AD|(|w}0y@,A|:@@p: >:@::x :@ : y8٫<|0|"x,A|};Z`|| 0x$} 2|u*}&J})|#H@tx|`<(|:@A~PPyH~|| A4@,A,Ac8H 9,A$, A8`8@(8!|PP虪}p|x!P|Aa!AaN 8`Kxc8H,Ad8`K\虫>cHe,A0$, A8`8@K,@,AK|cK8`K ,A`y@8||8P} ,}iP| PA0}8P|x$|u*,|PAH@| P, @|ZKЁ=}$,#AX0(|j| P|$PA,@X}"}I|c8cCB@0````!(8c8(DCC }(8(C8`8}$},AT|T~`|(0!J}~(}HP}((}8}pp8|V0}x}WU>9dA8e9d|i|FpTc>,#A}`f|"Tc8|@x|}0(|eP|# A,@L8} |B@,```!(8c8(C }(8(8`8}y쀽|(Ay,@,@l}0(|eP|# A,@D8} |B@$`!(8c8(C }(8(8`}y,#A]=8`y,A8<<8``B| 83|*|8 `!8c888 C ,<}8蚫`:r |d|xxc8czAz(| @@ ,A`cH`d,A,@H, A<<8dB.,@ 9B88ĦEx$8I8}%@P9xdx$y)9`DB (08@HPX`hp})```!|/8C |cZ8888xdx$88cH9`d,A``|(A:c#$,A9:<<`B82|*|28|6H@x@D`!:(x(FRL!A,| 8|6H@|eB.,`dAPxhA8`8!}!AaN <|*2:(0|% @@D9Wb8:(, }E@<8r|60@AP0aW}fP8}i8:B@L`!`=(,|`@9@̊~PP8(8@x:0aC (|'`@9@f,(g@D~˰P~PPz쀝8|f| @ x8c|*|*$B2z`K:~ګX:l8`t(|P |PKd`zhp8~ګX:l8`tx(|P |PKaWKDګX:l~,t(|P |P@ 8`K|8!}K88H`KcH)8:~(,8(d@`y`xKlګXzlzt8`(8!|P} |P!AaN ګX8~z8`8!Аlt(}!|Pa A|PN ګX8~z8`8!Аlt(}!|Pa A|PN 8`8!}!AaN 8`8!}!AaN 8`Aa8!N ,@,@4tx:lګX, A`zhp8ceګxK8~az8` A|P8!N 8`Aa8!N 8`a8!N 8`a8!N A  4 CsRDecomprLZC<8褫,@8 ( $|8P|%8|2A`|p,|8xA,|@,|`!褫 8 8C |*T8|(P8 p|pT ~!I||J|*9d}8 8 9 , |N0A8 9|P0!I|#x} |f |8|cP0|x|N 8K$Ī8,|8At ī0@d@H8|(0|8@08,@8 88ī8 (ī }P,|@8@L89 8 },@h,@0|| ``!ī 8 8C 8 T8|P8 KT} ``!褫 8 8C 8ī|(P# K,@K\,@K@K @GetCode`,|!axA8`8!N ?898 9@8` 9 8 98#)`^<|?8@888HH `caxcx |3xx K`8`8!}N AInitComp@AF8_2,#@ 8`N T>T>H @ CRC32HBuffer8xT?Tc>8M 8| B@0``!Td>|gx8T|e.|xT>C Td>|`xT|.|xT>N @pCRC32Buf,#@ 8`N 8H @CRC32FreeHandle|`8`!KNA(,#8AX(<@(8 8!}N 88!} K8`8!}N ACRC32NewHandle|!`h,T> c,A8AX|P}I8|9}J88|RT>|J||1|8P| * a%Kha#8!p}N |J||1|8PK ACRC32HBuffer@AF5_1|8!x |*xKM!A(c8!}N A@CRC32FreeHandle@AF6_3``aa\aA`T>!T>|aA!xp8"!9au:|y}xe ! aq8a9.!!,!!!!|!!!! ! !(!0!8!@!H!P!X!`!h!p!x!!@ l8a88xc$8|Px$x|  (08@HPX`hp`!|8cC 8a 8 8xcdx$8,?!8!!!!!!!A,:A`,&A,Ah8z B@<9````!xd(8cA| .8|!.C xd(Ax9|.8|.a|@AX8f!9, @9,'@9,'@9,'@9,'@9,'@9,'@9,'@9 ,'@t9 ,'@d9 ,'@T9 ,'@D9 ,'@49,'@$A|}';x( x @T>,)@9 ,'@9 ,'@9 ,'@9 ,'@9 ,'@9 ,'@9 ,'@9 ,'@p9 ,'@`9 ,'@P9 ,'@@9 ,'@09 ,'@ | 4(8 T A9 }(|`@@`} |H@@`8| H@|`0@}lHPy;!}i89`~yP.yy B@l}L:8yJ9aB@@````!~:8~~2,V;!:~4( |9.V~0A888T>|````!|28C A|88Ȃ 8;ZB@@```!zd,6A~.:~.zd|.8;ZC zd,6A&.:~.{&d|1.8| HAt9(:C; |Pxd{d88@;~HW~@bAPaH(@|2aH`,6A|88|0zd8:`~C*X|P|k|@x`}E8x$xd~2}8}èP|p0`z|cHPTd>| W|wP|@|!|P8c89J9@|08Tn>bC|"T>|P|(@| P@|a8B@8````!T<8c|(@|P@X}:8C TH8,#A,<8A}E, 8x$8;| A4p|kPaq/x&0|x(*x&|*p})*`|AP|,@A8`cap 0|zPaq|@@@\|Px8|`@P|(088`|8p|```!|8c|*x'|*~)*C X#8,A(````!|xT~|8,@}E8|0xd8|x|:8|g(.%8|(@A\KP8|08c%8|(@A48``!KP8|09J8f%8|(@@9JW:s|3@A8a@88ca@|#@A0,$8|48TA8`8!}px!Aa!AaN l|@@4(@8ax9pK8ax9pK,=A8,>A0|Pa |@@ 9x|.|~.paxK8`8!}px!K,8`8!}px!K8|p0KTk>K``gKp9 KD9KH9K@8|8H`K\ A BuildHufTreeHx&|"|:(`<H8dM 8`N @0 AllocHufTree|`T?`}!qAc$ 4c0P||0@|Ad8KU`8 8`|| 0|48!}N W>8cK`8 8`x 4| ||4|!|0K8`x8!N A FlushOut|``~aA|`!y)``a;a}x!!;,8,,~J.~.A,At,AL,AP@@8`@|(@@Ā~(,8|0@@T``!@><(8|f~D@|c80|(@|cKx~<@p,~(|@8A8`88`8!}a!AaN ;,8@~Px<@},0|:.|Pc@}88~:<|@@~(,8|0@@T``!@><(8|f~D@|c80|@|cKx~<@4,~(|@8A8X88``K;,8@܀<|8x&|P|{(@(cA<@P8c|<0T`><(`8|e~D@|c@0|@|cKx~<@4,~(|(@8A8`88`XK;,8@~Px<|*.c|(8T 6|2P|c0(A<@P|0<|0P@|@@(,8|0@@X```!@><(8|(D@|80|@|Kx<@4,(|@8A8~`88`XK;,8@Pxf<@|0|2.|c8P~@|08|e P<~Pz8~|(`|:8|x|(|!| @T>||թ|08|*8(|PT>T>A$`| V>8B@0```!UG>}2}#(}D2U>8}#9C UF>|(|:`~T>|1(@A|,5@<@|@@|~(,8|(@@P`!@<(8|e~D@|c00|@|cCx~<@,,~(|@8A88`8K;,8@<|8x&||*~P|((@(cA<@~P8|<0T><(`8|e~D@|c@0|@|cKx~<@0,~(|(@8A8`88`K;,8@~Px<|*.|08T 6|e2~P|0(A <(@~P|0<|0P@@`P88~|!T>(@@c8@K,@ 8K888!}8K(@`88`8!}K8`8!}aKcK!,@ 8Kt8X\8~`8!8}Kl`K88K<8`~@KX\88KAD,A$,@X~`8@KP`X8`~@KDX`8@KD A | DecompCodes``|aA!aA!xp!1, @"888a*a;a:a9a8a,8a#)J89{Z9`;9b})|!|)|1|9}A}WY}v! (08A@aH (08@HPX`hpx`x`w0`v`u`t`s`r`q`p`o`}s;p88R18899 9@9`aa8a;; }{Z~|!|)|1|9}A}1I}PQ}oY0PaXA`hpx!Aa``!#8cC } 9"ca;9_xa88a8 8a )apaaaaaaaؑKm,@,9`"(c8p9_8888 )K,AxccKI,A`8!|c}px!Aa!AaN 8`8!}px!HK8|c8!}HKt A DecompFixed|``aA;!Q( A x$8|d*|iN @(@ (,8| @@````!@<(8|dD@|c(0(|`;x<`@@;,(| @8A88`8!N Tc<@8cT~<8@(@;(,8| @@X``!@<(8|dD@|c(0(|c;x<@@,;(|@8A88`8!N <@`TT~<88@(@;(,8| @@X``!@<(8|dD@|c(0(|c;x<@@,;(|@8A88`8!N <Ā@`T>(8T><8@A,(A 888`,$A@8xfd8L|*(@;(,8|8@@X``!@_<(8|0D@|@0(|Sx<@D,;(|@8A88`8!N ,=9@Ѐ<U>T~xd|1.<@|@T8@@,8hd8d, @ cK؀h,Ad,&( A,|8!} N 8`8!|} K@,,&( A|Kc8KTf>,A8hKc0K,@0p|A8`( K,( |K88`|K8`8!|} K8`px8!} N l, Ah,A,K(,yA, AK8`px8!N C CsRDecomprLZHA( L| N A( L| N A( L| N A( L| N |}&`;aA;!!b 8X ؁@8|xc$,$|*ApA b , @K`b| @b , @?`8a ^! X85 XKA( 8;08cKA(@8|8Hx&x$|"|@*KɡA(cK`Pb0|#@AX|#@@b`8bhp0|$@@8bc9,#A$, @@c,#A0,A(,A W,#@bc,#A|bc,,#@lbc,#@\bcB,#@Lbc,A8, @@c,#A ,A,AW, A0b, @@`c 8 H,Abd, A\p`Ab , @8K`b| @b , @ 8;08cKA(@88Hx&x$|"|@* KǍA(cK`Pb0|#@AX|#@@b`8bhp0|$@@88` P 88! @}!Aa8N K`KK}`K|` @Kb, @b, @ 8;p8ccKƁA(H@8~ x&|"KUA(cKi`P|=@AX|=@@b`8bh8bd, Adp`Ab , @@K`b| @b , @  8;08cKřA(@88Hx&x$|"|@* K]A(cKq`Pb0|#@AX|#@@b`8bhp0|$@@88` J 8} 8 P8! @|!AaN KQ`KKE`K|` @K @8:Pbp;H~#@c8pKYA(8}x&|GHK9A(cKM`AXbp|#@@K @8Pbp;H~#@c8pKA(8}x&|AKùA(cK`A|K`c 8 H%,AK8`c 8 H,AKH@8bx&| *K5``|8bKE` 8q8b08KA(<8|x&|"脮(KA(8bK`Pb0|#@AX|#@@b`8bhp80|$@@88K8bc%,#Abc,,#@tbc,#@dbc',#@TbcB,#@Dbc,#@4, @,@,$@,$@c,@ b舃c)|,|+xxcTcz#@bc,#A ,A @bc,#A `,bc,#A @b,, @, @b|#yAD?,LB A0````!|+yA,LA@(%A`88K``d8ah;hK`8ahKA(,Ab|@, @@c0c8^?`9 _ppx@H=,ADcpKi`,#A,,Ab P, @pH~ @@X88b`8KA(8bcx&8c|"@KA(8bK`AK8b8`8KA(8bc8cx&|"`K}A(8bK`A@KD?`8$,$,@;hbc,,@,@bc,@, @@c0_p cpx @! H,AbB, @, A,#@`K-`c`f8al82$K]A(8alKq`b), @-, @,AW, @, A<, @c88 8K``fj?8al X_! h83T82Lp9! hKA(bB, AhW, A\bh,=AL|=@````!A W, A|Ax,|=@@8alKM`8b8), AЈ,, @Ĉ, @b, @,AcK A(,A8"9Bcb9bP x $|H*K`K48alK`cb83H8KMA(bKa`Kc88 8K``fj?8al?X ! x8582L!p9_x! xKA(K0c88 8K`K+9``fj8alX98382LKA(KXc88 8KU`K*``f?_8alj! A X8582L9! A K-A(KK*`a K*`c`g8al83H KA(KbcK@?_8alc! A 85  KA(8alK`Kp,@;tKp,@;K\,ADbcB,A(W,A(;A(;K ;KW(KbcK8"9Bbc9bP  x $|H*K`K cH,Abc,#K|, @@, @^,@h,>A\?`c8_f09 pxp@H,`|Ab@BH8bx&| *K``y8bK!`,b A4,@8b8P8KA(8yx&|1KA(8bK`8bhP`p| (@A`bc,#K<8b8p8KEA(8yx&|1K%A(8bK9`pbP| @AbpX|#@@b`8bh88@d,#K88b08KA(8yx&|1KA(8bK`0bP| @Ab0X|#@@b`8bh0p| @@8bc,#KaKHb@8bx&| *K``z8bK` 88b08KA(8zx&|1HKA(8bK`Pb0|#@A(X|#@@(K@bc-,A,A;K^`K,$@KHb@8bx&| *K ``z8bK` 88b08KA(8zx&|KA(8bK`Pb0|#@AX|#@@b`8bhp0|$@@8bc),@K8 8d;pc8KA(@8}Hx&x$|"|0* KA(cK`Pbp|#@AKKM`K|KA`KH| @LKT"Cx BrSyncBackup|}&KQ;;aA!xpahA`!XPH@!"`aȓ (ܓԓ08蓡 $@ (hH8ch, 8 |cxc$| *A0bpA ؈ , @ Г,,, A bpA  , @ 00, @a|`yA xx8a8KuA(;b 880ccKQA(@8{8BH"x$x&|"|0*KA(ccK)`Pb0|#@AX|#@@ b`pb0|#@@ bhb, @| f,@ K`BЈ, z8@ , AD, @ |, @ p, @ hb!,A,,A$,A,9A,A ,@T,A a, A , @, @, A,@ ܈n, @, A b8JKA(, A,A ,A bؓK]A(8c8x$| *K`aK1`w, A@ , AW, @ $XaX88K`a0, A܈ , AaW, @ aX,A Ĉ:, A ,A W, @ aX838KE`aX8aXKAA(8c8x$| *K`aXK`x,A 4,A ,(@ $,A ,A ,9A ,A ,A,A ,@H, @, A؈D, AЈB, AȈ:, AbxKe`b8.KA(aX,#A8bؐK%A(8c8x$| *K`zK`, AD, A, Ax, Aaa,#A\````!,@0Y, A$=, @, @ cx|`y@a,@4, @(, @, @, At/A0xW,#@$x,#@, @Hx@,#A<{B,#A0,$A$, @x,#A88K``dbK`s, AL4cb:c````!KA(:v:v,#@48bؐK%A(8c8x$| *K`aK`x, A8 , A<W, A0, A(|08818K`aX, AaX838Ke`a0,A,A. A, A , @, @$, A| j,@ Km`, @, AD, @a, Al,@(, @, @, AĈ, A aW, @,@, @, @, A@, @, @܈ , AaW, @Ĉ, A,:, A a,AW, AaXaX88K``dbK`8bؐKA(8c8x$| *KY`aK`d, At , AaW, A, A|08818K`aX, AaX838K`a0B, @,, AHa,A8W, @,, @, @, A(, @, A), A d,#A4W, @(,A:, @, A, A܈:, AЀ,AĈW, @d838K`as, A@;a;4c`!KA(;x;x,#@4aAH, A@. A<, A4,A0,A,,A$,A .A-A,A,A$,A, A,A ,@,A,A,9A,A,A,AĀ, A, A, A, A ,@, @b , Ab8b R,Ahb0yAd8'c```!KA(||ybNKEA(@ 8c|`K1A(8'yAcKHHHHH|HlHXHDH HHHHH|HXHdHLHHpH`HDH,HHHH$HHHHHlHHHALb````!KA(8(|`KA(b,>@, A , A 8bKA`b , @ b8LK!`a,>Aa,, L1AD@ bKA(8 |`KA(88`8T>axy@,, A, Ab8K`b8K`8,A|,At,Al,Ad,A\,AT,AL,AD,A<,A4b8,A$,A, A,A ,@,A, A8 ?@`8`8!@8pxKdi`a ,A|,At, Al, Ad, A\, AT,AL,AD,A<,A4,A,,A$,A,A,A ,@,bpA b , @8, A;< ``ГKA(,#A <a< t* 9X8@;``b0BP;$o H;;`}#P@a}0@!a 䂁**a A!aÿ*ˁHB@"a8@(0aaHPaaX`:`hƀaȀ pax$AAaa| b0C,@0" b~|cKiA(aX,#@P,AHbi, @<(, @4,,LFA, ,LFBA! 8)~0~@bCKA(,#@bC8)KA(,#@bC8)KA(,#AX88`888(H9:`aX`paA:bC8)KQA(,#A088y:`(PA:bC8*K A(,#A88`aXbC8*@AX|>@@b`80bp| @@bh8b, A, A ,A,A ,@b, A, @b, Aa,@ Tb , Aa,@ b, A xa,A h@8pH8b8)cx&|:E KA(8bKa`P|>@ApbX| @@b`8bh8b, A, Ad, A, A , @b, A, @4b, A , @b, Aa,@b , Aa,@0b, @, A@D, A4a,A$b, @Ĉ, @, @@8pH8b8=cx&|:GK}A(8bK_`P|>@ApbX| @@b`8bh8b, A, @b, @, @, @@8pH8b8Kcx&|:I`KA(8bK^`P|>@AX|>@@b`8bh8, A,A,A, A, A,A,A,A, A4bpA , @8, AbpAhb , @L8, Ax8`8`Z8!P|@H} P!XA`ahpx!AaKܬ; 880ccK)A(@8~8Hx&x$|"|@* KA(cK]`P|?@AX|?@@b`80bp| @@bh8KHHlHKY)`K8KKY`KxKY`KX8KT 88p;ccK-A(H@8~<x&|脰KA(cK\`P|=@AX|=@@b`8bh8KH@88p8bcx&|:BKA(8bK[`P|>@AX|>@@b`8bh8KH@88p8bcx&|:BKA(8bK[-`P|>@AX|>@@b`8bh8KH@88 p8bcx&|:AKA(8bKZ`P|>@AX|>@@b`8bh8KH@88Kp8bcx&|:IhK1A(8bKZE`P|>@A|X|>@@|KlH@88=p8bcx&|:GKA(8bKY`P|>@AlKXb, @l, @`, @T@8pH8b8Kcx&|:I`K]A(8bKYq`P|>@AKH@88Kp8bcx&|:IhK A(8bKY!`P|>@AX|>@@KH@88Cp8bcx&|:H`KA(8bKX`P|>@AHK4H@88@p8bcx&|:HKaA(8bKXu`P|>@AKH@88Hp8bcx&|:IKA(8bKX%`P|>@AX|>@@b`8bh8K0H@88Hp8bcx&|:IKA(8bKW`P|>@AX|>@@KH@88/p8bcx&|:EKAA(8bKWU`P|>@ATK@H@88,p8bcx&|:EKA(8bKW`P|>@AKH@88p8bcx&|:CKA(8bKV`P|>@AX|>@@b`8bh8KH@8808bcx&|:@K-A(8bKVA`P|>@AX|>@@Kb, Aa,Ap@8pH8b8cx&|:>KA(8bKU`P|>@ApbX| @@b`8KH@88p8bcx&|:CKEA(8bKUY`P|>@AX|>@@0b`8K H@88p8bcx&|:?@KA(8bKT`P|>@A@K,=K8K,A<,A4,A,Aa8ACa|4|c4|xT@B@b, @, A@,A ,@,ap8888KV`,A8ahKA(,#AA, A , @@b, A0b, @, A, A=, A , @,b, AD, A, A;, A , @8b, @, AE, A, A6,A<,A4,A,,A$, A, A, A ,@db, @\, @P, @D, @8, @,b, @, @, A,A ,@b, Abc6,A5a,@3bc, @d, A38a,@$;a;@5`r": `:xa,@3Po``!d~&88b8, A3p8Kf``e8a88KsA(8`U85x$| *K@`vp(0v:@8apK`|nyaaAc,#A2, ,AĀ8a82$,8@0.@0<+, A,, A N \!$<KrA(8aKB`y+.Vj, |,@/p8aA/ ap,n 8282LA$!!8a@.`xAAKrUA(8aKBi`:1!|@4,A ,@ , Aa,@c, @d, Ax, Ax;@8,=A=A````!;Z8a82$8KqA(8aKA`c88KdI``e[888acfKqMA(8aj82|V828ciKq)A(8aKA=`,=@lAȀ,A ,A ,A ,A , A4, A,a8@h(8C@C$8a84D8'Gg!0A@aP0@!PKpMA(8aK@a`b , ATa,AW, A8,A,Ax,A,Aa,A,A,,A$,A,A, A , @, A, @, @|, @pbHA8,<A;;G @.:0-9 `bpBh"0@Hÿ4d``!, @|@c,#A,A ,@X, A8, @(Y, A=, @<, ÄF, A,,LFLRLJA<, A, A h(,/bA,a8089Kn5A(8wx&| *KnA(aK>-`PbX8|6p@|@LB0BA0| @@ 88`|Fxy@H@8bx&| *K``|K=`, A, Ab , @|@0 88b8 KmAA(,@H@88b88cx&|"A@Km A(8bK=`b0P|#@AX|#@@b`80bp| @@bh8H@8bx&| *K`K<`K9)`,A ,@, @b , @L , A@80H8b8cx&|:?KlA(8bK<-`P|>@A0bX| @@b`80bp| @@bh8, A ܀,A ,@, @b, @ P , A @80H8b8.cx&|:EKkMA(8bK;a`P|>@A0bX| @@b`80bp| @@bh8, A , A , @؀, @b, A , @ Hb, @ 8 , A @80H8b8Bcx&|:H@KjeA(8bK:y`P|>@A0bX| @@b`80bp| @@bh8, A Ȁ, A, A,A,A,A,A,A8,A,A,A,AbH, Aha858K\U``d8a Ke`8a KA(,A,,A$,A,A, A , @d, ATa,@Dc, @d, A,,A,A, AaKA(, A4bpAT , @<8, AbpAb , @8, Aaր8Kڌ; 880ccKhA(@8~Hx&x$|"|@* KgA(cK7`P|?@AX|?@@b`80bp| @@Hbh8K8K4`K8KK4`KK3`K8Kb`cHKaA(bh8HKhcKAA(,@(b`c| @@tbh8Kd869"Bc96bbP x $|H*KQ`KH@8bx&| *Ky``{K6`K3`,A,@0<cc8cx&8t|:箈Kf!A(ccK65`P|=@A0bX| @@b`80bp| @@Dbh8K40<cc88cx&|:HKeA(ccK5`P|=@AK|,@dH@808b8t<cx&|简Ke=A(8bK5Q`P|>@A0X|>@@0K H@8808b<cx&|@KdA(8bK4`P|>@AKH@8bx&| *K`K4`K11`KH@8bx&| *Km``{K4`K0`0<cc88ncx&|:Kd)A(ccK4=`P|<@AX|<@@b`80bp| @@,bh8KH@8bx&| *K``{K3`K0E`0<cc88ncx&|:KcuA(ccK3`P|<@AX|<@@b`80bp| @@lbh8K\H@8bx&| *K``|K3`K/`b0 c88cfKbA(<8|x&|"脰KbA(cK2`P|;@AX|;@@b`80bp| @@bh8KH@8bx&| *K5``|K2I`0 c8 8Kb A(,@8|8x&|A@KaA(8bK1`b0P|#@AX|#@@b`80bp| @@bh8H@8bx&| *Ki``{K1}`K-`, A, A0cc88cx&|BKaA(ccK1)`P|<@AX|<@@b`80bp| @@bh8KH@8808bcx&|:B`K`A(8bK0`P|>@AX|>@@K|8|x&|AHK`IA(KpH@88J08bcx&|:I@K`A(8bK0%`P|>@AX|>@@b`80bp| @@bh8KH@88<08bcx&|:GK_A(8bK/`P|>@A@AX|>@@KH@88G08bcx&|:HK^A(8bK.`P|>@AX|>@@b`80bp| @@bh8KH@88(08bcx&|:EK^]A(8bK.q`P|>@A$KH@88+08bcx&|:E`K^ A(8bK.!`P|>@AX|>@@KH@8808bcx&|:CK]A(8bK-`P|>@AX|>@@b`80bp| @@bh8KH@8808bcx&|:>K]-A(8bK-A`P|>@A(KH@8808bcx&|:? K\A(8bK,`P|>@AX|>@@KH@cc8b8cx&|"AHK\A(K|P 88 8bK\aA(,@`H@88bc8cx&|"A@K\)A(8bK,=`8Ppb`|$(@@LK<H@cc8b8cx&|"AHK[A(K0 8 c8K[A(,@T8|88x&|A@K[yA(8bK+`b0P|#@AX|#@@Kp8|`x&|AHK[-A(Kbx&| *K``waK+!`K'`89Kh(~ ,#AT, @H,@088a82$KZA(8aK*`, @ ,A,A|,#,@`|@,8a8482KZ9A(8aK*M`KT8a8482KZA(8aK*%`K,|h\@48a8482aaHKYA(8aK)`K| 8a8482KYA(8aK)`K|,LLAr< , r@88a84h82La(!  ` KY=A(8aK)Q`KX|\!p8a8482LKY A(8aK)!`K(|| ,#@,8a8482La(KXA(8aK(`K|h\8a8482LKXA(8aK(`K8K,A,A\,@ J, Ad I|,,'/@ @0, @4@@, AԈA, @1A, A|888KU)`88KJ`a@`g,@d8,,&@@,A @8a83HKW}A(K8a82$`KWeA(K8K|88KJ`a@`g,@Kh@@@KT@@KH@KЀ/,'@K@,@tKH@8bx&| *K``{K&`K#9`0cc88Bcx&|H@KVmA(ccK&`P|<@A0bX| @@b`80bp| @@Lbh8K84KLQA(8aKe`xyA,AHPKK>``fp8a84482KKA(KK>``fX8aj84>829KKA(Kt82$b`KKA(K,8K8}8K>e`a@`gK@@Kx,'@l@Kd}(=@]8K@8aKE`KPp8a84482a(KKA(K b, @4a(&@p8a8482KJA(K08a8382VjKJA(K8a8382VjKJqA(KbB, AT~,#AD88 8K=`Xj`f8a>84829KJA(K08a8382Xj9KIA(Kb, ATa,@DT,@8h0 ,$@   a`a88, @, @, A,A W, @b:, Aa,@ bc, @(d, @b+, AT!8a83p82L)  V jII!`Axipa!`KHA(K!8a8382L)  V j!ppI!pKH]A(K|+, A, @, @la,@c, @8d, @,0!8a8382L)  V j!pI!KGA(K8a8382LVjKGA(K8a8382L(HVj!A!AKGeA(K8a,@XbcJ,@T,@8bN,@ acT,@T|"!8a83T82LApj(!}J!KFA(K8a82L83TpA!Kah(, @ a, @ a, @  aXK8aK5`8Kd8K8,AL,ADa\,@b J, A b I, @a, @\, @,@,@<@, A0A, @$b0@#A, @Xa@, A$,Aa@a,@8, @0, AbB, Aa, Aa, AX, A b J, @ I, A0a83H@8aKDqA(Ka83H@8aKDEA(K@8a82$KD)A(Kt8K88dK6`a@K~888KA`88K6`a@Ka, A@Ka@K|8'K,!ap,82,@(`82Lx!8AKC]A(K8'82LA!8xKC9A(K8a83Al82L!p,8n !A$a@$kxaAAKBA(KЌ9`'xAAaKBA(Kl! 82Xp82Lx8!A KBA(K<@*\+, AϠ, Aϔ. `*|$Kxa, @; 8p8ccKBA(H@88~x&|""@KAA(cK`P|=@ApbX| @@b`8bh8K8; 88pccKAA(H@88~x&|""`KA]A(cKq`P|=@AKl8`Kwu`8apKnE`|nyaaAԀc,#@8` Kw=`8apKn ``n``aK͜8abK@A(K\9'K̼pcKm`,#aA, APa|`yA,A, @p; 8p8ccK@MA(H@8~x&|""@K@%A(cK9`P|=@AHK4; 88pccK?A(H@8~x&|""`K?A(cK`P|=@AK+, AL, A@8 $$K8`Ku}`cpKlM`,#aA, @8` KuI`cpKl`aK`Ku)`KDH@8bx&| *K~``~K`K Q`p c88K>A(b, AaH@8b8cx&|"1K>IA(8bK]`bpP|#@AX|#@@b`8h8b82̘KA(ab8)|KA(a, A,#A | @AH@8bx&| *K}``|K `b0 c88$cfK=uA(8|x&X|DK=QA(cK e`P|;@A0bX| @@b`80bp| @@bh8b@88ԐKP;`{8 K A(a,#A@H8bx&| *K|``~K `cx&| KAp8H@8bx&| *K|``{K `ccx&| K;A(ccK `8 K8@8bHx&| *K{``{K `cccx&| K;iA(ccK }`8vK8 KA(axKH@8bx&| *K{``|K 1`cx&| K:A(cK `8vKaKXH@8bx&| *Kz``~K `K5`p c88K:uA(b, ADaH@8b8cx&|"1K:-A(8bK A`bpP|#@AX|#@@b`8h8b82K{A(ab8)|K{qA(a, A,#A | @At; 88$0ccK9A(H@8~Xx&|"DK9UA(cK i`P|=@AK82KzA(ax,#@x,>Ap8H@8bx&| *Kx``{K `ccx&| K8A(ccK`8 K8@8bHx&| *Kx}``{K`ccx&| K8QA(ccKe`8vK8 K}A(axKaK8`KnI`8a,#AaK`a,Ad,AԀ, @H@8bx&| *Kw``|K`b0 c88$cfK7uA(8|x&|XDK7QA(cKe`P|;@AX|;@@K@H8bx&| *Kw ``}K`K`p c88K6A(b, ApH@8bp8cx&|"1K6A(8bK`bpP|#@AX|#@@b`8h8b82KwA(aXb8)|KwA(a@X, A,,#A$| @@82KwA(ax,#@x,>Ax8H@8bx&| *Ku``{K`Xccx&| K5A(ccK`8 8K@8@8bHx&| *KuI``{K]`Xccx&| K5A(ccK1`8v8K 8 KzUA(axKpK$84"9Bb894bp x $|H*K`KK!`; 880ccK4YA(H@8~ x&|""K4-A(cKA`P|=@AX|=@@b`80bp| @@,bh8K; 88pccK3A(>^8}H@!pAx&|"pK3uA(cK`P|<@AX|<@@b`8bh8, @8bpAb , @8, @,K`; 880ccK2A(H@8~ x&|""K2A(cK`P|=@A0bX| @@b`80bp| @@bh8; 88pccK2%A(H@8~x&|"CK1A(cK `P|=@AX|=@@K ; 88pccK1A(H@8~82x&|""K1A(cK`P|=@AX|=@@b`8h8bؘKY`K@K`K K , @bpAb , @8܀, A`,A<,A4,A,,A$, A, A, A ,@b, @, @, AbB, @b, A aW, @,@b, @, @t; 8p8ccK/A(H@8~82x&|""K/A(cK`P|=@AX|=@@b`8h8bؘK`K`; 88pccK/UA(H@8~ x&|""K/)A(cK=`P|=@AX|=@@b`8bh8, A , @b, @x,@|@,@; 88 0ccK.yA(H@8~88x&|"A@K.MA(cKa`P|=@AX|=@@K; 88 b0ccfK-A(H@8|ccx&|"AHK-A(cK`P|;@AHK4,@ 8p;8 ccK-A(H@8~8x&|"A@K-UA(cKi`P|=@ApbX| @@b`8K; 88 pccK,A(H@8}cx&|"AHK,A(cK`P|<@AKt; 88pccK,A(H@8~ x&|""K,]A(cKq`P|=@AX|=@@KK`K88K4; 880ccK+A(H@8~82x&|""K+A(cK`P|=@AX|=@@b`80bp| @@bh8bK`8KK`K8KcKymA(,Apbd8KPbpA8b , @8Ԁ, @lH@88p8bcx&|:#`K*A(8bK`P|>@AtX|>@@|! ,LZ~&~( LF~ &, OBA\~ AT~( AL,AD,A<,A4 , @$bpA , @8, @TH@88p8bcx&|:#`KaA(8bKu`P|>@A K ; 88pccKA(H@8~ x&|""KA(cK `P|=@AX|=@@b`8h8bؘK`KKA`K8K|a|PKK`KK `KbK}`Kc8P8KAA(cx&|"K!A(cK5`8bPpB`|# @@ h88K( b80}~CbCK_eA(,#A:bC80K_EA(,#AH:bC81,K_%A(,#A :bC81\K_A(,#A:bC81K^A(,#A:bC8/K^A(~(#A:bC81K^A(,#APccx&| *K\``}bK`K]`~( A,@b ~,;~&, @b088sKmA(~ @x&>c|8脮`KAA(bKU`0bP| @AbX| @@8b`0bp| @@bh888`::̐aK4x&>c|bE脮hKA(Ktb808KA(~ @Px&>c|8脲`KmA(bK`0bP| @Ac|bE脲hK!A(KB b808KA(~,;@(>8cx&|脰 KA(K\x&>c|脰(KA(Kcx&|KA(b#K)`A0bX| @@8b`0bp| @@bh8ax8caxaKb#808KA(b>cx&|K}A(b#K`LJpBAKt8c KTA(a`pKbCKSA(,#aX@\KbCKSA(,#aX@|d |v~x8@b@bT>bCb8-xKIA(,#AL~x8~( @b̈B, A,@, A  |`|x|v~8a|8bC8-KI9A(,#A88`aKmbC8-KI A(,#@8-bCKHA(,#@Km88`aKm@ K8=F (~ &K/ K</ A$KbC8-dKHA(,#@8+bCKHiA(,#@ (~ &K`bC8)KH=A(,#Ah,@\c, @d, AD, @B, Ap, @dx88'8K ``dbCKGA(,#aX@B,A8x!`b ,A,@|8q8'8```!K``dbCKGYA(,#8@81x!`8'8~ yA,@ qKaXKLaXAD, @dB, A, AL8cKGA(a`pccx&| *KE``}b#K%`Kѝ`d ;~, @b#088EKA(cbx&|HKA(b#KԽ`A0bX| @@8b`0bp| @@bh8ax8caxaK(b#808EK5A(cbx&|HKA(b#K)`LJpBAKx8c KFA(a`pKbCKE}A(,#aX@dKbCKE]A(,#aX@DKbC8-0KE=A(,#AP8)bCKE%A(,#A88-HbCKE A(`qbC8+KDA(|pyXA,1A, A8q`8K`,@h, A<,@0T,@$8oKEqA(x8 aK8oKEQA(x8 aKhB, AȀ,@c, @d, Ax`~yA,@9p88```!K``d8aKB!`8q8K`,AD8x8~yA,@pK`8 aKaKDUA(pKbC8+KCMA(aaXK\bC8)KC1A(,#A8)bCKCA(,#A8)bCKCA(`t, ~ &~( @8t 8.KFA(aX,#@@8~( :A,7AaЀ |@ 8Kp8cKCuA(~( a`t8:`AHKccx&| *K@``}b#Kб`K)` b#8080KiA(;8}bx&|FKEA(b#KY`LJpB8A b`0bp,$|@~ &@8bhKbC8-KAA(,#A@, @(, @B, @~ Au``}bK΅`K` b808_K=A(;8}x&|+KA(bK-`LJpB8A b`0bp| @@bh8=, @ 8=F, ~&K܈, ~&KbC8-K?=A(,#AKbC8,K?!A(,#A88,bCK? A(8c K?A(Tq>!8a$XKxbC8,K>A((#: aX@`pX,0AH, A)A(8c8$x$| *K`qbK;`KbC8,pK=A(,#A(8c!K>mA(a Tq>!8XKbC8,K=UA((#:aX@`pX,0A, A|bh#!~7yAh, @,q@, @a |A,``!x~yA$, @Kb8 K@mA(|oya@A 8bK`,@(,/A 8 88`a K8#bbKa0KbC8) K MA(,#A0, @tK`bCK %A(,#@0bCK A(,#@bCKA(,#@, A,b, A8~4|4|8T@88`a(KbCKA(,#A8(bCK}A(,#A888`8@a8Kd8(8 KiA(,A(b , @,1@bCKA(,#@bCKA(,#@xbCKA(,#@`bCKA(,#@HbCKA(,#@0bCKA(,#@bCKA(,#@bCKiA(,#@0, @܈, Ab, A ,5A88`a(K xbCK A(,#A88`a8KbCKA(,#@bCKA(,#A8(bCKA(,#@bCKA(,#Ad88`a8KlxbCKmA(,#@bCKUA(,#A0aKbC8(KA(,#@8(bCKA(,#A088`8T>0Kcx&| KA(cK`8`A :!~@|PaKD$B! b~ |c K1A(aX,#@K:8/KA(aX,#@K:8*8cH `K:8/KA(aX,#@K:x8*8cbEH `K:`8 8;b08ccfKA(@8|8(THx&x$|"|(*KٙA(cK`P|;@AX|;@@b`80bp| @AK7bh8K7K`K78K7a828K`a88(Ra@K qA(a ,#@ b8 8KCbpAb , @8, AK78 88!;08ccKmA(@8}8(lH8x&x$|"|(*K)A(cK=`P|<@AX|<@@KK`K@8K<8!K5bK)A(,AbpAb , @8||, @P, Ab, @d8  8;08ccKAA(@8}8Hx&x$|"|(*KA(cK`P|<@AX|<@@b`80bp| @@bh8cKA(8^H@ca8c|f8b|1x&|@KeA(8bKy`a8 8c|c|aKA(,A 8 8bK@X8a a@K$-A(,A8bd|A b88K@ 8a 8JK)A(a,#@ b88K?p8a 8K.`,@K?, @  , @0b#(@(b8&K)A(b ,>@Ѐ,A,A, A ,@b0,>@,A,A, A , @b0,>@DbK&A(,AbpAb , @8, @b0,@$bKA(aX,#@d*,A,A<,A4, A,,A$,A,A, A , @b0,>@pb, @T8 8;08ccKӑA(@9 8}H8'x&x$|"|(*KMA(cKa`P|<@AX|<@@b`80bp| @@bh8cKA(8^H@ca8c|f8b|1x&|@KҵA(8bK`a8 8c|c|aKIA(,A 88bK<,A,,A$,A,A, A , @b, AB, @b, A a,AW, Ab, @, @,A@,A8, A0(a(a@KA(,A8bd|A b88K;(8JcKA(,#a@ b88K;dpc8K*-`,@K;0, A b8'KA(~8 K1A(aX,#A bK"A(,A hbpA Lb , @ 08, A aK)A(,A 88bK:0a(a,A<,A4,A,,A$, A, A, A ,@b, @, @, AbB, @b, A aW, @,@lb, @\, @Pb88d,#@ L8'bK`b, @ , @, ÄD, AbK`b8K`, A,a,@c, @<d, @0,A,A, A,A8#8aKy`a,@ bc, @d, @b, AH,@8d, A,8a K`8 8a K`~^98?(9! _@`pxK `ab, A;, @, @b8(K-`bK`8bK `a868K5`aa@KmA(,A8bd|A b88K7Lb, AE, @ , @a,@8a8((K̽A(8aKA(,A8bd|A b88K68a8(0KaA(8aK}A(,A8bd|A b88K6\a8JKyA(a,#@ b88K6$`dbKA(,AbpAb , @l8, @Db, @<8 8;08ccKQA(@8}8(8Hx&x$|"|(*K A(cK!`P|<@AX|<@@b`80bp| @@bh8cK A(8^H@ca8c|f8b|1x&|@KuA(8bK횉`a8 8c|c|aK A(,A 88bK4hb, @, AbB, @Ā,A,,A$,A,A, A , @b, A a,AW, Adb, @T, @Hb0,@xUda88p8K`,@K3Ā,A,A, A, A8 , @`b , APb08 899 c#||#xx8K#`a ,A,A, A,A,A, @Pb , A@ Bp8`88899?(RKH`a ,#AK&K 8`8Bp899?(RKG`a ,#AK%Ka828K` "p89`g8`K0`,a@K24K^P?@`8`8!@8pxK`a K8!KP<KK`KK`K8Kb88 K1Pb8( K `Kp98`!_@`paxe^%`K`aK8a8 K E`KX8K8"K8(bK `(bK `8bK `KbK `KDbK `K,bK `K8'KA(aX,#A8'bK `bX8 K q`8bK a`Klb8 8cK A(aX,#@b, @8 8;08ccKYA(@8}8'H(x&x$|"|(*KA(cK)`P|<@AX|<@@b`80bp| @@bh8H@8bx&|"@KġA(8bK픵`K K)`K;8cKmA(`ec8*H `KK`K8Kb88 K.l8bK `b8/cK iA(aX0||px|XbK y`Kb8'KýA(b8/K A(aX,#A0,@8 Kb`H(KK `Kb8'KA(aX,#A|`}cK5A(`e8}8*H `KTb KA(aX,#A8/K]A(aX,#A8*8ccH `K8/K-A(aX,#A8*8ccH `KtK=`K$8K b88 K,8'xbK`bcK`8'bK`K8'8bK`bcK`8'XbK`b~, A, A', @#, @|b, Ab, @\8'\bKI`b, @b8K)`K8'`bK`b8K`Kb8 K`K8/cKA(,#aXA8@KA(,#AcKA(|}8'cKA(aX8X`, @AȀ(88, @A(```!8c88, @@쐁(XKcK}A(8' |~ KiA(KP0K$b0,&A b8&K5A(K b8&KA(KK팭`KK팡`K\8|KXb8 8 K*b8L8 KA(bKA(8T8 |`pKA(b0yAx8'c```!KA(||ybNKEA(@(8c|`K1A(8'yAcKXb08,>AHb```!KA(8(|`KA(b,>@80bKE`b , @`b0@,>A@b`!KiA(8(|`KYA(b,>@,A,Ab8K`b , @8bK`,@|b, @b, @8bKe`b, @<, @,, @4, @(b8K`,@db, Ab0, Adb0,Ab0,Axb, @b, A,@Db0, Ab0,Ab0,Ab, Ad,@Db0, A$b0,Ab0,Ab, Ad,AD,AAHb```!K A(8(|`KA(b,>@8hbKu`8bKe`8bKU`8bKE`8bK5`8bK%`8bK`8bK`8bK`8bK`88`aaKX8c|`KA(Kb8L8 KA(bKA(8T8 |`pKA(b0yAt8'c``!KA(||ybNKA(@X8c|`KqA(8'yAcKXb08,>AHb```!KA(8(|`K A(b,>@cKA(8 |}KA(cKA(8$|}KA(cKA(84|} KA( ,>@,b8\K`88`aaKxcKEA(|}8HcK9A(K8c|`KA(Kb8L8 KA(bKA(8T8 |`pKA(b0yA|8'c````!KA(||ybNKA(@8c|`KqA(8'yAcKXb08,>AHb```!KA(8(|`K A(b,>@,A,@$b, Ab, A,A ,@,,>Ab,@$KA(8c%|`KA(8|a88T|>xy@ , @,b8K`88`aaKhb8K`K8bK`K8K`Kb8K`KTb84K`K@8c|`KA(KtcKA(8|~KA(K 8 bKI`W||p|cx`$xd|`"|P,AK 8bK `K 8 bK`W||p|cx`$xd|`"|P,AK 48bK`K 8bAP|ؖ|.p|2x>$x.xd|(P||P,@XKA(8`|`KA(8bKQ`bKA`8bK1`K K%`K8bK`K b8K`K 8c|`KAA(K cK%A(|?|*c $(0KA(|}8cKA(K<8L8 cKA(cKA(8T8 |~pKA(Kb8L8 KuA(bKaA(8T8 |`pKIA(b R,Ab0yA|8'c````!KeA(||ybNKA(@8c|`KA(8'yAcKXb08,>AHb```!KyA(8(|`KiA(b,>@b, @, @, A\b, A0a,AW, A0bB, @ , @, ALb, @\b, A0aW, @,@0bB, @ b, @, Ab, A b9, A , @a, Aha,AhW, @\:, @L, @@,A, @, A?, @80bK]`b , @hb0@,>AHb```!KyA(8(|`KiA(b,>@a,@d, A|(@b0|P8Lc| A |eP8caL;,4@b; , Ab؃L``!KA(c8h|`KA(8bK9`8bK)`;b|@4b, A, A, @P, @D, @8, @,b, @, @, A b, @, @, A a,A ĈcW,#@ bc:,#A , A a, @ 8bK`b :, A \b, Aa,ALcK1A(|~8K%A(b8K`b, @, @, A4b, A0a,AW, AbB, @b, @, @a,@td, Ad|(@Tb0|P8Lc| A |eP8caL8,4@l;;, L````!@bKA(8@|`KA(8;4, |@ě8b, @\b, A0aW, @,@0bB, @ b, @, Aa,@ d, A|(@b0|P8Lc| A |eP8caL8,4@l;;, L````!@xbKA(8p|`KA(8;4, |@ě8b, Ab, @084,@h;;, ```!@bKA(8@|`KA(8~;4, |@8b , @Tb8KY`b, Ab9, A, Aa,AXW, @L:, @<, @0,Ä, @, A?, @tb, Abx,pAb8K`KcKA(|~8KA(b8K]`KcKA(8l|~KA(K`, @, A, @\cKIA(8|~K=A(b8K`KDbB, A8bK`b , @pcKA(8|~KA(,@bc, @d, Aa,$AȀc8t8cax| Ab;fg8 ax`!K`W||p|`x`$xd|`"|P,AbKA(8 e|`KA(8;{bؓax8 T>|(@t88 bKe`80bKU`b8KE`K8bK1`Kh8bK`Kb8K `K8bK`K08bK`K|b8K`K8bK`Kb8XK`KHcKA(8|~KA(K,@ÿ@AAf, @|b", @4cKyA(|~8JKeA(K@cKIA(8<|~8JK-A(KcKA(|~ 8 @ KA(b@bx,n@b", @8cKA(|~8 h%!00KA(KlcKuA(8 ||~8&!@@KQA(K,8 TcK`KlcK!A(|~8 KA(K8bK`K8cK`b, A|, @pT,@`:, @T, @HcKA(|~8 KA(b :, @Tb8 XK`K@bKMA(8 |`K9A(,@, Aa8p8da4|Ab;fg8 a4```!Kq`W||p|`x`$xd|`"|P,A\bKA(8 e|`KA(8;{bؓa48 T>|(@p8K8bK`K8bK`8<`ff8aA;#fg\acy;AȈ,/$/``!L^2.-. @@. A MVPBAhAX, A8, @AHY, A<~(,@,<, @ ,8@A |@`xcx|`y@da,8A,=@PbKA(8 |`KA(8`8;8\,$T>,aA,AxW,#A, @;A:4|A~b8 ``!K`WC|Ȗ|p|cx`$xd|`"|P,A`bK5A(8 b|`K%A(b8bؒ\T>:8 ~|0@4K8bK}`K8 bKi`WC|Ȗ|p|cx`xd$|d|P,@8bK1`Klb :, A8KDb8 XK`8K80bK` , @b0@,>ALb````!KA(8(|`KA(b,>@bn, @l;0bГ4,@:bB0#;:&````!bKUA(8b|`KEA( , @܈n, @h ,6@8bK߱`;|@4b0(,>Abp``!KA(8|`KA(b,>@pKT88bK9A(|uyb8DXAK` bK`8PbK`bK`8\bK` , @  , @8xb؈ , @̈, @, AD, @8bKq`,9Ah8bKY`bKڥA(88|`KA(8bK`8bK `KH8bK`KK`,9AKx8pK`,9AK`8hbKݵ`,9AKD8bKݙ`,9AK(KA(8b|`KA(K8}Kۙ`,@P,6@ (4@K`bKuA(8(b|`KeA(K8bK`Kb08cK`|`4T@Kpb0K`88bKܡ`KLb```!KA(c8h|`KA(8bKY`;b|@K08bK1`b , @b8K`K8bK`b8K`K88bK`KcKA(8D|~K A(K@, @, A, @cKA(8|~KA(KB, @, A8bK1`b , @hcKiA(8|~KYA(,@bc, @d, Aa,$AЀc8l8ca4| Ab;fg8 a4```!Kq`W||p|`x`$xd|`"|P,A|bK֕A(8 e|`KA(8;{bؓa48 T>|(@l88 bK`80bK`Kh8bK`Kx8bK٭`KcKA(|~8KA(,@c, @d, Aa,$Àc8h8ca4| Ab;fg8 a4``!K`W||p|`x`$xd|`"|P,AbK%A(8 e|`KA(8;{bؓa48 T>|(@h88cKq`cKԽA(8|~KA(B, Aa,@Ȉc, @d, Aax`yA最,@8~8K``d8aK-`8a;s;a,$A04`!KIA(;{;{{,#@䓁4bKA(88|`KA(xyA,AX`K8bK1`KX80bK` , @b0@,>ALb````!K9A(8(|`K)A(b,>@a,@Ld, A<| @,0|dP8L~|(A |dP8caL;,4@;@b8!L`!bK҅A(8cE|`KuA( , @b,TP*@KEA(8E|`K5A([,:@,8bKչ`;|@t4K0bKA(8cE|`KA(K?@K8bKa`KX8bKM`b , @b0,@xUddcKmA(f8|}KaA(b8,>@b8K`KlcK)A(|}8cKA(b8Kԭ`K8<dK|8bKԍ`KP88bKy`Kh8c|`KA(KbKХA(|?_|*`% E(e0KYA(8c|`KIA(Kb8L8 K1A(bKA(8T8 |`pKA( R,A00yA|8'=c#````!K%A(|xybNKϥA(@08c%|`KA(8'yA=c#KX8,=ALb````!K9A(8(|`K)A(b,=@, @, @, AB, A-,@B, A, @ , @(a, @(,A(A(p?, @(d80bK` , @(4@,=ALb````!K9A(8(|`K)A(b,=@a,@'xd, A'l|(@'\|e P8caL|A |e P8L;,4@x; , A&b؃!L`!K͉A(c8h|`KyA(8bK `8bK`;b|@4, @"h , A,H, AaW, @, Ä, AD, A, @,AԈ, @4, @(, @, @, @,=APX<`;@H`fb0; /@: 9EA9e@~# @@:@a}#@a, @LY, A@=, @4}@, @$8`=:,1/ @Hx,@@x, @x, @lu, +A\pK`a,#@K ,@4x, @(uPKD `,@, @8KK`V||p|`x`dxd&|d|P,@8bKʭ`KԈ, @ b, AE, @ , @a,@b, A aa|`yAP,@$Y, A=, A,``!cxa|`yA,@K|+yAT,@He,#A<, A cK A(8D|~KA(b, @ h, @ \, @ P, @ D, @ 88,=DHAX:b@B!8F`!,@Y, A=, Axy@J,A8 , Aa,A, AbH, @, @I, @, @|b8Ki`cKıA(8|~KA(8cK1`8b, @, @, AB, @a,@Јd, AĀ|(@b0|P8Lc| A |eP8caL8,4@l;;, L````!@@bKñA(8@|`KA(8;4, |@ě8b, @B, A, @a,@d, A|(@b0|P8Lc| A |eP8caL8,4@l;;, L````!@bK±A(8p|`KA(8;4, |@ě8b, A084,@h;;, ```!@tbK!A(8@|`KA(8~;4, |@8b , @b8Ki`b , @a, AbB, @b8K)`K،8bK`b , @|cKMA(8|~K=A(,@bc, @d, Aa,$AԀc8`8ca4| Ab;fg8 a4````!KQ`W||p|`x`$xd|`"|P,AbKuA(8 e|`K~eA(8;{bؓa48 T>|(@`88 bK`80bKõ`b8Kå`K8bKÑ`Kh8bK}`Kxb8Ki`K8bKU`K8bKA`Kb8K-`K8bK`Kb8XK`K8pbK`hb,>A܈axy@`8K8 bK`W||p|`x`&xdd|`"|P,@p8bK`K\cKA(F|}8cK{A(K8}8Kn`ah`v, +@,8}b`d@,~,5@T8`.#A@}H|@0 |P,@ ,A|@L2A|@AD},#A,8AbKA(8Dc|`KzA(bKA(8H|`KzA( }H8;9aDH`w!8KH8;88Kma``xaK`}8KPbKQA(8~c|`Kz9A(ADK8`,5b~A,.#K,#AcK`~y,~AtKpK`,#a@K\,@$x, @bPK8I`,@8{,#@Ka,@D88dKl=`ah`~, +@bf, ATa, ADcKA(|}8lJ`KxA(8aKcKA(8|~J`KxA(KxpK`,#a@K,@@bx, @0PcK7`,@b@, @8K88;8Kk `aKKcKA(|~8KwA(, @\b , @d , @T, A0, Ab0, @,bx, @8Kxb8,K`8KPccKX, @48cK`@, @, A`W, @T, A b J, @ I, A,cKA(8 |~KvA(, @0bx, @ , @~, +@\b0,@,@,Abh`,=cAb;@"@```!| @AY, A~|@b؈@, @,8AtW, @hKA(8 c|`KuA(, @,}x, @, @, +@x`y@TcKAA(8|~Ku1A(, @,b , @L , @<, A, Ab0, @bx, Ab8,K]`KpK`,#a@K$,@,x, @ }PK3`,@, @YKKIA(8 |`Kt9A(KK%A(8|`KtA(KxpK%`a|`y@Kހ,@bx, @t~PK2i`,@\b@, @L8K@cKA(8 |~Ks}A(KcKeA(8 |}KsYA(KbdbK%A(,A\bpA| ,#@4,2A, @88B 8b0KrA(8b8b8cx$x&|(*| *KrA(8bKB`LRPBpb0|@A b`C@ bhCbKaA(:^8`r8b`|x&~1|8*Kr1A(8bKBE`8|~8b:@K(K>`KK>`Kb8 8 K bPK0Y`,@Ā, @鸓XKKA(b8|`KqyA(K|(@T88bK5`bKA(8|`KbqA(,@c, @d, Ax`yAո,@լ8}8KT``d8aK `8a; s;,$A<4````!KA(;9x;x,#@!4bKA(88|`KaA(xyA,AL`K8bK`Kh8bK` , @XbK-A(8|`KaA(,@c, @d, AԀ, A:}8ca4X|A|(@X88 bK`80bK`K|8bK`Kx8bK}`K80bKi` , @@,=ALb````!KA(8(|`K_yA(b,=@a,@Ld, A@|(@0|e P8caL|A |e P8L;,4@$;"8T>````!bKA(8c|`K^A( , @b,TP*@KA(8|`K^A(,8@,8bK `;|@t4KpbK=A(8c|`K^-A(K?K8bK`KX8bK` , @,@xUdPbKA(R8|`K]A(b8,=@8bK9`KдbKA(8c|`K]qA(8bK`K|<PKx8bK`KP88bK`Kp8c%|`K]A(KπbKA(|?_|*`% E(e0KA(8c|`K\A(KΤb8L8 K\A(bKqA(8T8 |`pK\YA(', A@%, A4 , A(, A, @, @7 R,A7$0~yAx8'b```!K5A(|uybNKA(@68b|`K[A(8'~yAbKX8,7ALb````!KIA(8(|`K[9A(b,7@, @0P, @0D, @08, @+|, @%(, A, @4, A', Ax%, Al&, A`, A$,=AD```!,@X, A8, A$4xy@ ,=A, A# , ADaW, A, A#,A#, A, A#, A"X:, @!a,A!W, @!8 PbK=`,=Aa,@!. @D, @8, @,, Aa,A:, Ada,A:,$A!(,A! W, @!@ f, A 8 bK`8 bKy`@, @, A ,A T,@la,A\#, Ab0c , A<%(@ : bKQA(8 cb|`KX=A(,@a, AbK A(8 |`KWA(. A,@c,@$@d, A :, ApC, @P8bKA`, A؃,A,@la,A\#, Ab0c , A<%(@: bK)A(8 cb|`KWA( , A ,A(W, @a,@:, @8 bKa`, @, @@, @4, @(, @ , A, @ , ADa,AW, @, AH, A8 bK`bh,=A(<`ff::fg```!},#@}@c,#@܈{,@w,@}W.#@}h,#A @w,A}W.#A, b8 A K `Vb؈W8||p,|xdx&|*|P,L3BAKA(8 |`KU A(88`8T>axy@8bKu`8, A , AH, @, AȈH, A, A\, A, A 8,>DHA::x@8F``!~,@,$~X,A|~8,@|bA,%HN@D |@P/@4A A$>NA Af(ALZLFA $KYA(8 p |`pKSAA(@H,n@ Ј"b. K A(@ 8 h |`KRA(8bK`A A fb, A KA(8  |`KRA( H>f:D`~8aH`!xy@0@AA, @\", @ bKA(J8 F|`KQA(, @, @, A, Aa,@d, Ax8,4@h;;, ```!@PbKAA(8@|`KQ1A(8x;4, |@8. Aa,@Ԉd, AȀx8,4@`;;, `!@bKA(8p|`KPA(8x;4, |@8- A, @|x8,4@`;;, `!@bKA(8@|`KPA(8x;4, |@8 , @x8bK]`A,:, @  , Aa,A@ , Aa,@,@@AAԈf, AȈ, AlT,@`a, ATbKA( @8@P|`@PKNA(8bKi`KbKA( @8$`p|``pKNA(8bK`Kl, A\T,@Pa, ADbK=A(8lJ|`KN%A(8bK`KbKA(8J|`KMA(8bKu`KbKA(8d|`KMA(8bK9`K, A, @, A8,>DHИA@8F``!~,@L,$~X,A<|~8,@,|bA,%HN@D |@P/@4AA$>NAAf(ALZLFAKyA(8 |`KL]A(A8A0fb, A K%A(8 |`KL A( H>f`DaH`!Иxy@!@A`AT, AHbKA( 8|`KKmA(8bK`KPbKEA(J8F|`KK-A(8bK`KbKA(8|`KJA( H>fKKA(8cc|`KJA(KX@A AK@ AAKbK}A(8H|`KJmA(8bK`KP8bK`K|8bK`K8bK`Kl8bK`K8bK`K8XbK`KbKA(J8F|`KIA(KbKA( 8 |`KIA(b@Lbx,n@", @DbKEA( 8 h|` KI-A(8bK`KHbKA( 8 |0|`0KHA(8bKy`K8 TbKe`K`bKA(8 |`KHA( H>fK 8 |b |`KHaA(Kp8 TbK`K$". K1A(@$8 \bebF|`KHA(K88 |bebFb|`KGA(K@|AlAtKd@lAHAdK@bKA(a@8 bKQ`,>A<`ff:::fg````!, @t~@X, A,$8,@ ,@@bK)A(8 |`KGA(8}8a8T}>xy@| , A,H, @ aB P X||*8bKI`8K8 bK!`W||p|`x`&xdd|`"|P,@ 8bK`K |`|x|v~8 K08 4bK`bKA(8 c|`KEA( , @\,@$bKA(8 c|`KEA(, @8bK5`.,>@ , AAh :, AHC, @8bK`K8 hbK`8bK`K8 XbK`KbKA(8 c|`KDA(Kt8 bKu`AK\8 bK]`KbKA(8 c|`KDA(K8 bK`KK`W. bKUA(8 A0|`KDAA(K48 bK`8K\, A,@ÿ@AAf, @x", @4bKA(8 J|`KCA(KbKA(88 J|`KCmA(KbKUA(8 8 @|`KC-A(b@Lbx,n@", @XbKA( 8 h|`KBA(bKA(8 |`KBA(KbKA(8 8 | |` KByA(K8 TbK`KXbKMA(8 |`KB9A(Kp,@ÿ@AAf, @p", @0bKA(8 J|`KAA(KbKA(88 J|`KAA(KbK}A(0@8  @|`0@KAUA(b@Lbx,n@", @DbKA(P 8 h|`PK@A(8bK`K$bKA(8 8 |`|``K@A(8bKE`K8 TbK1`K\bKyA(8 |`K@iA(,@d,@X,ALbh`,=A8|=@`!A X, Aw|Ax,|=@@`KbKA(8 |`K?A(KbKA(8 c|`K?A( , @,@hbKuA(8 c|`K?aA(, @ 8bK`.,=@ , AA,Ax,@8, @,, A , @bx,n@,@܃,A|,@xa,Ah, @\#, Ab0c , A<%(@ : bKUA(8 `cb|`K>AA(,A8 cK`,@h :, AHC, @8bK`K<8 hbK}`8bKm`K8 XbKY`K8 bKE`8 cKu`,@x8 bK`KdbKeA(8 c|`K=UA(K :KbK5A(K8bKl`K8bKl` , @,@xUd8|`K&A(b8,=@8bKl}`.@,, A a,@c, @,@488bؐ8Kl%`@,, A a,@c, @,@<8, AbKh-A(8c|`K&A(88,@48, A@@ hdc858Ku``d8a Kc`K|XH@8bx&| *Kca``vKu`K`A @0 b88rbK#!A(<8v85x&|"脮HK"A(bK`P|7@A0bX| @@b`80bp| @AK{dbh8K{T0 b88bK"A(<8v85x&|"脰K"]A(bKq`P|7@AtK` 880;ccK"A(H@8~8D<x&|脰K!A(cK`P|8@AKH@8bx&| *Ka`K`KA`K`H@8bx&| *Ka}`K`K ` 88r0;ccK!EA(H@8~8D<x&|脮@K!A(cK-`P|8@A0X|8@@0K H@8bx&| *K```wK`, @ b808K A(<8wx&|"脰K qA(bK`Pb0|#@AX|#@@b`8pb0|#@AKx8bhKxK`KXH@8bx&| *K_``vK`Ky`0b88bx&|BKA(bK`P|7@A0bX| @@b`80bp| @AKwbh8KwH@8bx&| *K_5`KM`K`', @܈#, @`@80H8b8cx&|:B@KA(8bK`P|>@A@X|>@@@K0; 880ccKA(H@8~x&|"BHK]A(cKq`P|8@AKA#, @; 808ccK A(H@8~x&|"BHKA(cK`P|8@ADK0; 880ccKA(H@8~x&|"BHKmA(cK`P|8@AK"H@8bx&| *K]1``wKE`, @(, @, @, A , A8aW, @,@B, A, A `, @ T, @ H,A, A, @l, A, AT), @H, @< b8088K%A(8wx&|GKA(bK`0bP| @Ab0X|#@@b`80bp| @@bh80,@,@,Abhc`,#AlX`:qGBh:`9```!| @A,X, @Y, Av|Ax}{y@`, @ , @|,@8c, @d, A x,6A:X`bh:Q,`:1,hp9`04`!:b88, @4B, @(aK 1``eb88~K9A(a848K[A(,08bP~ @@8c8b`KA(8b8cx&| *KA(8bK`A0| @@0bp| @@p~y@ 4Kq8b8c`KqA(8b8cx&| *KMA(8bKa`AKxK ``eb~88KA(88c8b0KA(8b8cx&| *KA(8bK`0bP`| @A|$@@K, @@B, @4c, @d, A8@4b85 0KiA(84a08KZ%A(,@:88c0bK-A(8wx&|,`K A(bK!`0bP| @A0bX| @@b`80bp| @AKp(bh8Kp:88c0bKA(8vx&|,hKmA(bK`0bP| @AtK`0848bKYA(,@d:88c0bK A(8wbx&|,`KA(bK`0bP| @AK:88c0bKA(8vbx&|,hKA(bK`0bP| @AK|c, @d, A|@xb85 K9A(:88c0bKA(8wx&|,`KA(bK `0bP| @AK:88c0bKA(8wx&|,`KA(bK`0bP| @AK848bKW1A(,Ah:88c0bK9A(8ubx&|,hKA(bK)`0bP| @AK:88c0bKA(8wx&|,`KA(bK`0bP| @Ab0X|#@@K88b880KiA(8nx&| *KMA(8bKa`0bPp`| @A |$@@| (@@KK`KK`b808Ax&|H KA(bK`Pb0|#@AX|#@@b`8pb0|#@@8bhbx&| *KSi``wK}`KЈ, @, @, AH,A, A4, @, A), A, AH, @< b8088KA(, A8wx&|GKA(bK`0bP| @Ab0X|#@@b`80bp| @@bh8B, @Kj,AKj|c, @d, @Kj`x`~y@KjL,AKj<X`:Gbh:@98w8K``d8aKQ`8a: s:,$A84```!KSA(:1p:p,#@!48888b0K)A(88ox&| *K A(8bK!`0bPp`| @A |$@@U| (@@Sx~yA,A`KiKK=`KK1`b808Ax&|H KiA(bK}`Pb0|#@AX|#@@b`8pb0|#@@8bhbx&| *KP``wK`KK܉`, A , @, A, A$ , A, AĈ, @, AdD, AX, @L0b88;cx&|G`KEA(bKY`P|8@APK<0b88Icx&|I KA(bK`P|8@AK0b88Acx&|H KA(bK`P|8@AK0b88>cx&|GKmA(bKށ`P|8@AxKdd88K`aKf888K`aKf88dK`aKeaX88K`a0Kdb8818K`aXKdaXKdtc8838Ki`aXKc|08818KI`aXKcdb0,@a,Ah,@<n, @, A$b8JK A(Kc(b8(K A(Kc b8(K A(KbB, AKc88_~aKQA(aX, @Kc ,#@Kc, A, AKbV80K YA(KbKaXb0KL9`8.`wKQA(,#aXA 88bKMA(8c8x$| *K`zbKK`K`ac(#@K`zK`H@8bx&| *KK``uK۝`, @4, @(, @, @, A P,A ,A w\,@| J,#A | I,#@ w@,A,AwЈc,#+A ,LFBA A, @ b0@#A , A w888K`88KY`ah,A $B, @, A, @, A , @  b808_K A(8uHhx&|+K A(bK`0bP| @Ab0X|#@@b`80bp| @@bh8, @, AB, AW, A<0,@H,@<,A0bhc`,#AXbH: `Bh`:c+````!| @AԈY, AȀw|@Ѐ\,/,@ J,A I,A4A$h88_8b0KA(8ba8cx&| *KeA(8bKy`0bPp`| @A |$@@4| (@@2  x~y@ `,@, AЈB, @@848bKIA(,A:88c0bKA(8tbHx&|,hKA(bKו`0bP| @Ab0X|#@@b`80bp| @@bh8,@@, @4, @, @, AB, A,@8c, @d, A x,5A0bH: 4pX:c,`:C,h`h``0```!;a88, @ B, @aK``eb88KA(a848KGA(,08bP~ @@t8c8b`KA(8b8cx&| *KA(8bK`A0| @@<0bp| @@0p~y@ 4B, @KY,AKY؈c, @d, @KYx`y@KY,AKYXbH: `bh9:+:C,`8~8K``d8aKD`8a:s9,$A04`!KFA(:o9o,#@488_8b0KYA(8b8cx&| *K9A(8bKM`8cb08Pp`f}#@@8bA |&@@50a~(@@3KA(88nx&| *KA(8bK`0A | @@5@3xyA,A`KX 8b8c`KeA(8b8cx&| *KAA(8bKU`AKK``eb88K A(88c8b0KA(8b8cx&| *KA(8bK`0bP`| @A|$@@K@8B, @,0848bKDMA(,@;88c0cKUA(8~bHx&|,`K1A(cKE`0bP| @AXb0|#@@b`80bp| @@bh8Kx;88c0cKA(08~bHx&|,hKA(cKѡ`0bP| @ApK\;88c0cKMA(8~Hx&|,`K)A(cK=`0bP| @A b0X|#@@K:88c0bKA(8uHx&|,`KA(bK`0bP| @AHb0X|#@@DK4hK8pa8KA`ah`oKK`K ah88'8K`ahKw88K`ahK\,A I, A, @<@, Aw,#@hKP8/KEA(,#AhK0K9`b8H08-x&|EKmA(bKρ`Pb0|#@AX|#@@b`8pb0|#@@8bhbx&| *K?``uK`KKˍ`, A, AT , A, A, AD, A, @0b88'cx&|DKmA(bK΁`P|>@A0bX| @@b`80bp| @AKRbh8KR0b88Fcx&|HKA(bK`P|>@AK|0b88-cx&|EKA(bK͵`P|>@AHK40b88*cx&|E@KYA(bKm`P|>@AX|>@@KaX88K`a0,AhKQb8818K`aXKQDXKQ8x88K``dbK<`KP x838K``dbK<`KO@{,#@{,#A{B,#@b0c,@,A`,@<n, @, A$b8JK A(KOb8(KA(KOb8(KA(KOB, A,$@ , AW, @, A :, OBӂAW, A888XaXK=``dbK;M`KOx8838K`aX88aXK`K|08818K`aX88aXK`KbK:`KNa, AKMXKMLbK:`KL4b0K:`KL a, A KLtKLhac(#AzKLPbH@8bx&| *K:%``vK9`, @(, @, @, A  , A a,A |W, @Ј, @,A,A0 b88 bKA(8vx&|AK]A(bKq`P|7@A0bX| @@b`80bp| @AKJLbh8KJ< b808KA(8vx&|@KA(bK`0bP| @Ab0X|#@@ b`0bp| @@ bh0,@,@x,Albhc`,#ATXB`:3@h9``!| @A X, Au|Atx}sy@`, @, @X,@\d, AP؀v8,4AKH:`8sh`:`h:XA`~!0A`````!b#08~P8p, ~'@@AbCK``eb88aKA(888b0KA(8b8cx&| *KA(8bK`0A | @@}:pb04|#@@|| (@@A;;KGK!``eb88aK)A(b#848K7A(,88b@T80KA(8b8cx&| *KA(8bK`A$0| @@K80KA(8b8cx&| *K}A(8bKő`AK, Ac, @d, A|@xb85 K-A(:880bK A(8vx&|`KA(bK`0bP| @AK:880bKA(8vx&|`KA(bKġ`0bP| @A@K,c, @d, A@b85 0K=A(84a08K5A(,@d:880bKA(8vx&|`KA(bK`0bP| @AK:880bKA(8ux&|hK}A(bKÑ`0bP| @A0K0848bK5A(,@d:880bKA(8vbx&|`KA(bK`0bP| @AK:880bKA(8ubx&|hKA(bK­`0bP| @ALK8848bK41A(,Ah:880bK9A(8tbx&|hKA(bK)`0bP| @AK:880bKA(8vx&|`KA(bK`0bP| @Ahb0X|#@@dKT88b80KiA(8b8cx&| *KIA(8bK]`0bPp`| @A |$@@| (@@  KK콙`KDK콍`0b88bx&|?KA(bK`P|7@AX|7@@ b`0bp| @@ bhbx&| *K0e``vKy`KK`0b88bx&|?`K!A(bK5`P|7@ApX|7@@lK`K켑` , A, A  , A, A, AX, @L0b88bx&|>K}A(bK쿑`P|7@A4K 0b88bx&|CK5A(bKI`P|7@AK0b88bx&|?`KA(bK`P|7@AK0b88bx&|?KA(bK쾹`P|7@A\KH,A8K?p`ucK`,#a@KX܀,AK?D@, A<PbK`,AK?b@, AK?K?: 88PbbKA(H@8wbx&|"5KA(bK`b`|6@@`bhKTaX88KM`aXK>XK=z8818K!`aXK=z8818K`aXK=cK/A(V80|xKA(K<|b8(KA(K | LB0BAqt:;:Kx@8,@ -6KL 8b88K%A(@8b8cx&| *KA(8bK`AЛqH @c`;@:KbcKpKY`KbcKKA`K0bPahp~ @} @KPK `Kh| @Kp"Ccompr_rate_get|}&ۡہ9@9`;aA ;;!;`;@; ;::axAp!h`XP99!ahpb!x8 A,&|x$a8| |)*A0pACb , @CK징`b| @Cb , @CP 8aabh!p~g85PKڙA( 8:08bKqA(@8u8Hx&x$|"|@*K5A(bKI`Pb0|#@AX|#@@b`8bhp0|$@@8b, Ab@, @b, A, AB<,AB4,A,A ,@$`u , AA,@At`o,A,A ,@ 8 X~5@@.X-|aA<,A4,A,,A$,A,A,A ,@ b, @ , A h5, @\,A,LNBA D, AB, AC, A , Ab, @ b`, @xb`cHaaxK&aA(,A,b|A8"B9bb9 x x $|H*K`, ,AL,AD,A<,A4@b P;H@~5@8b8b8KqA(8hpx&|KMA(8bKa`AX|5@@b`8bhp|5@@8, @bd, |` A0p`Ab , @tKa`b| @b , @@ 8;08cKyA(@88Hx&x$|"|@* K=A(cKQ`Pb0|#@AX|#@@b`8bhp0|$@@88`8   |ˡ ˁ 8! } PX`!hApax!AaN K`KK`Kb`cHK#eA(bh8HK4, A,A,A,A,A,A,A,A0,A(, A , A,A,A,A,A,A,A,@bP @H~5@, @X8b8b8KYA(8bp8cx&|1K5A(8bKI`AK8b8b8KA(8bp8cx&|1KA(8bK`AX|5@@K 8kb;8cKәA(H@8~hx&|"-`KqA(cK죅`P|5@AX|5@@b`8bhp|5@@8K 8gb;8cKA(H@8~hpx&|",KA(cK`P|5@AX|5@@b`8bhp|5@@8Kb P;@H~5@A8cb8KAA(8hpx&|KA(cK1`AKa8JKeA(bh,#sH@X89`"b9Bxi{$|H*K켵`Kpa8bK*`,A0B,%A&,bC8'KIA(t8 KA(,#A%HbCK#A(,A%DbpA8b , @%8r8 KMA(,#@$b, @$"8 8:0b8KНA(B@8tH8'x&x$||(*KUA(8bKi`Pb0|#@A``bX| @@b`8h0| @@88bx&|@KA(8bK`sHKA(,AX8"B9bb9x x $|H*K캑`K @ah8`pp!xxKu```"aa8``8a9)(RbKN`|syaA(bpAb , @"b8 8:B0bC8KΡA(@8rH85hx&x$|"|(*KYA(bCKm`Pb0|#@A``bX| @@b`8bhp0|$@@88<`b`KmA(,#A$<`:@BPp`kHb }@h(b@`p8Xa:&"`n9&#`!|&|5P@|`&|5@a|&``! bh@ہpx`!pAxK`8T8|d*(A|iN 8,@-8bpAb , @\aKA(|`~@r, @ 8^, @ 8^, @ 8^aH8bx&|@KMA(8bKa`, ^@ 8 , ^@ 8 , ^@ 8 @bpAb , @::@|P}aaKMA(,#@habKVY`a`,t aA,A,A,A,A ,@`bh ,%APbpAb , @Pb8  8:b0bc8KA(@8sH 85x&x$|"|(*KʩA(bcK욽`Pb0|#@A``bX| @@b`8bhp0|$@@8bh ~b|P~CbCKA(,#A ,@b<PH`pb  :"9E#`A ("h}@8@`  0;^|`&|58@a |&|5@ |& (``! bCh9@!pAxہp`xK`8 T8|d*(A |iN 8,@ -8bpAb , @ bCK A(|`}, @, @, @bEH8bx&|@KȩA(8bK옽`, ^@ 8 , ^@ 8 , ^@ 8 @bpAb , @:8bh|pP b~CbCKA(,#@t 0hd 4p AX"8 B9 bb9  `x $|H*K`KKUA(,AX8 "B9bb9  x $|H*K]`Kl`| KQA(,Ab|@48bh |,A ,:@,8A`bP; bHB@}5@pAbhp}@ , @K1`8b8b8KqA(8~cx&|"KMA(8bKa`NJBAb`8@8KLK쒱`Kx8bc8KA(8~x&|"KA(cK`LJB8A b`hp}@@8bK앥`KbPp; bHB@}5@h}@KccK`,A`,;,A,=Ap@Lbd, |` A0p`Ab , @ K쑅`b| @b , @ 8;08cKĝA(@88Hx&x$|"|@* KaA(cKu`Pb0|#@A``bX| @@b`8bhp0|$@@88`8K K쐉`K$K}`K`HKA(bh8HK@Lbd, |` A0p`Ab , @ K`b| @b , @ 8;08cK1A(@88Hx&x$|"|@* KA(cK `Pb0|#@A``bX| @@b`8bhp0|$@@88`8KK`K$K`K`HKA(bh8HK@Lbd, |` A0p`Ab , @ K쎭`b| @b , @ 8;08cKA(@88Hx&x$|"|@* KA(cK쑝`Pb0|#@A``bX| @@b`8bhp0|$@@88`8KHK썱`K$K썥`K`HKA(bh8HKAK8 "9Bb9 bP   x $|H*K쫱`KK%`KHbK쐕`K8bCK]A(~A ~|@ 8 8bP8x&|8*K%A(8bK9`8`p@888b08KA(8b8cx&| *KA(8bK`0P8bX|7p@|@LB0BAbp|7@@8bK쏍`;:8K,K`KD88bP8K1A(8b8cx&| *KA(8bK%`8q@8`q;;;`;K8,@;`-8K88bP8KA(8b8cx&| *KA(8bK쎕`8q@8`q;;;;`-8K-8KbpAb , @8, -8LJBA88b08KA(8b8cx&| *KA(8bK`0bP8X|8@| @LB0BAbp|8@@8;}KHK `KP8, KL-8K(8,@ -8K88bP8K!A(8b8cx&| *KA(8bK`8q@8`q;;;-8K,:@ -8K8b8b8KA(8b8cx&| *KyA(8bK쌍`A 8H LBBAa (|h @8;@; ;Kpb, A0b@, A  | A b1, A;-8KbKA(`nbCKA(|r( A,>@@bbDKE`b8 KA(,#A8;-8KLb8 K`Kb<bP-H`ph`:%" }+@(b@8h 8 H|`&|5X@a @|&|5@ P|& X```! bCh@ہpx`!pAxKQ`8 HT8|d*(A|iN 8,@-bpAb , @|bCKMA(|`}, @ 8^, @ 8^, @ 8^bEH8bx&|@KA(8bK`, ^@ 8 , ^@ 8 , ^@ 8 @xbpAXb , @<:8bh|pP b~CbCKA(,#ALKdK`KbKQ`KbCKA(~A 8~|@,AbpAxbPp}5@} @ , @L8bH8b8x&|#`KA(8bK숵`NJBAdKTK!`K8b8b8K]A(H8b8cx&|"K5A(8bKI`P8`}5@LJBApbp}@@8bK `KK섁`K88bP8KA(8b8cx&| *KA(8bK쇱`8t@8`t;;;`;K8,@;`-K88bP8K-A(8b8cx&| *K A(8bK!`8t@8`t;;;;`-KTbpAb , @8, LNBA88b08KA(8b8cx&| *KaA(8bKu`0bP8X|8@| @LB0BAbp|8@@8;}KK삥`KT8, LNBAKPKl8,@ -KX88bP8KA(8b8cx&| *KA(8bK셩`8t@8`t;;;-K,:@ -K8b8b8K-A(8b8cx&| *K A(8bK!`A P8H LBBAa X|h @8;@; ;Kpb, Ab@, @$b, A0, A ,@  @| Ab1, A ;KbKIA(`nbCK9A(|r( A,>@@a885K5A(,@h8b|K`b8 KqA(,#Ah, @;8-8K08;-8KbaK`Kb8 Kq`KTa885KA(,@8b8 ~CbCKA(|pyA,>@08bbDK `8 ;-8Kxb8 K`8bbDK`KKx`KHKx`K@:8cKA(`eb8*H `KKx}`K8"9 Bbb9x hx $|H*K얩`KӸbC8K`b8/cKA(0||px|bCK`KbC8'KA(bC8/KmA(,#A0,@8 KٸHb@8bx&| *K``r8bKz`b, @, -,A,LNA,A@ 88b08KYA(8rhx&| K9A(8bKzM`Pb0}#@A``bX| @@b`8pb0"h|#@~&~ @8b, @, @ , A$ap884KiA(,@ 88b08KmA(8rpx&|`KMA(8bKya`~aA 0bX| @|@b`8~ @8AK 88b08KA(08rpx&|hKA(8bKx`@d|aKp, A ,A ,A ,A ,A ,|aA ,@b, @, @ , @b, A  8`8b08KA(8rhx&|,KA(8bKw`Pb0}#@A``bX| @@b`8"hbp0|$@@8b, @ , A$ap884KA(,@ <8c8b08K A(8rpx&|,`KA(8bKw`A0bX| @@b`8b0p|# @@8,AD,A<, A4, A,,A$,A,A,A ,@`b, @, A), AT, @H, @<, A b, @, Ab, A" 8a8b08KA(8rhx&|, KA(8bKu`P0|0@AbX|0@@b`8"hbp|0@@8b, @ , @- , AT,-A(,A ,A,LJA ,@$ap884KA(,@Xb 8cb88bKA(8rpx&|,`KA(8bKt`P|0@AbX|0@@b`8p|0 @@8A ,@b, @, @ , @b, A|" 8b8b08KA(8rhx&|,@KA(8bKs`P0|0@AbX|0@@b`8"hbp|0@@8b, @, @ , AP,A(,A ,A,MBSA ,@$ap884KA(,@b 8cb88bKA(8rpx&|,`KA(8bKr`P|0@AbX|0@@b`8p|0 @@8,@b, @Db,A),A,,@ ,@b,A Pb0}#@@\88b08KA(8rhx&|1`KA(8bKq`A0bX| @@b`8pb0h|#@~ &~( @8b 8c088bKIA(8rpx&|,`K)A(8bKq=`A0bX| @@b`8~( @8, @Ǽb, Ab, A" 88b08KA(>8rhx&|脲KyA(8bKp`Pb0}#@A``bX| @@b`8pb0"h|#@~&~ @8b 8088bKA(8rpx&|脲KA(8bKo`A0bX| @@KKlI`K8b808KA(8rhx&|1hKiA(8bKo}`pb0h|#@~ &A@``bX| @@AD|>@```!A W, A|Ax,|>@@8ahKa`88z, ATp`A܈ , @4K^I`| @ , @; 880cKmA(@88Hx$|0*x&|" K9A(cKaM`Pb0|#@AX|#@@b`8bhp0|$@@88` @ (8! 0}a8!AaN K]%`KK]`K|` @K8ahK`}`83H8bKAA(bK`U`K<|d!p8ahp8Al82Lxc!pKA(KcKu``fVj8ah8382LKA(KcKE``f?_8ahVj8382L!A!AKA(KK`82$b`f8ahKeA(KpK`aK`83Hb`g8ahK-A(K8,@:t@K,@:@K,AHA<W, A$(:@ @K:@K:@K|:KtW(KcpK`,#A,Ahb P, p~ @@8b8`8KQA(@Hc8b8cx&|""@K%A(8bK^9`AXbp|#@@b`8bh8z, A\p`A܈ , @| LB1~ &~( A(b, @aKg]`,Ab, @ , AL5, @0,@8, AB, AC, AccKyA(,Ahb|AP8"Bbccb9$ x$|8*Kh `AHc8JKAA(,#@\8"B9bbcc9 x $|H*Kg`AHac8beKy`,A|0",%Ab#8'K|)A(~8 K}A(,#@b#8K`b8/cKMA(0||px|b#Ke`HPb#8'K{A(b#8/KA(,#A0,@ 8 b#KEA(,@\8"B9 bbcc9 hx $|H*Kf-`AH4bpA@b , A KG}`8q8 K1A(,#A(;8cKA(`ec8*H `b, A KG)`8808b8Kz]A(bcx&|8'x$|0*KzA(8bKJ1`AXb0|#@@ b`#@88bb%x&|@KyA(8bKI`aKmA(,AX8"Bbccb9)x $|H*Kdy`AH @a8`bDapcxK;]``d8`889biK`,Aae, A|}&aA:@:!xp:h`"}B!8c},$|cxc$ p8Ѐ|*ApA , @xK@`| @ , @L?`8a^! X85ci XKs!A(: 880bKrA(H@8t8x$x&|0*|"KrA(bKB`Pb0|#@AX|#@@b`8bhp0|$@@8 , A\c, @d, ADB, A8, A, A bЈ, ATbhc,#AD (`!,@8 @`es(cx|`y@Ԉ9S, A$,#@@, A ,A,AW, A\), @P-, @DB, @8b`, @c pcd8K,A-8;=A<y, Alp`A؈ , @LK=`| @ , @ ; 880cKpA(@88Hx$|0*x&|" Kp}A(cK@`Pb0|#@AX|#@@ b`bhp0|$@A`8`8 0 * 8! |} `hp!xAa!AaN Ka`Pb0|#@AX|#@@b`8bh0| @@88`8KK:`K,A|aK}A(,@ H@8bx&| *K-``x8bK7=`@, A, @,@T;h, A,#AԈ@, @KE``xccK5``g8al88!!8,%|x$|*A@pA@b , A K`K`b| @H | @b , A KY`?`8a^c! X85 XKRA( 8;08cKRaA(@8}8Hx&x$|J|@*KR%A(cK"9`Pb0|#@AX|#@@b`8bhp0|$@@8,@bc,AH@8bx&| *K``|8bK!` 8p8b08KQaA(8|x&|.KQAA(8bK!U`Pb0|#@AX|#@@b`8bhp0|$@@8-;Hbc@/#AP,A\,@8b, @c8(8KCu``~Hb),LFA(c88KC=``~HA0,#A$c88KC ``~HT, A(c838KB``~H$c88KB``~-;@,@bcB,#A|8ahcK`;h/A4\,A@,AH, @@c,#A@,A bc/ALFBAH,AH$,LFBAH8| NFBAA, @|, @pb, @`b0#@AH, A<888KK`88KA}``}H`88KAY``}H<A H0c8*8KA%``}Hbc9/#A$bc,#ADbc:,#@4bc,#Abc,#Abc),#@x, @@c,#A ,@Xbc:,#@\bc,#@L@,#A,,A$bc,#AЈc,#+A,AW,#AbcB,#@`b, @(c888K,@ 8@8H$c888 K,@ @b, @b, @ 8g;p8cbKLA(H@8}cx&|",KLiA(cK}`P|7@AX|7@@H| 8:;p8cbKLA(H@8~x&|"G@KKA(cK`P|7@AX|7@@b`8bh8H ,@PA,bc,#A, @@c,#A@,#A;`8`@|` MLbc),#AP,AH;A;,;`@;bpc,#Abc,#A|H;b,c@/#@$A,@ ; HD; H<@$A,@ ;H ;HA,@;bc,#AHbc,#A8bc,#A$A,@ ; H; H;bc,#@bc,#@ pH, @@c,#AbHB@8bx&| *K``y8bK`b, At 88b08KIA(8yx&|1@KIuA(8bK`Pb0|#@AX|#@@H,AW,#@,A 8q8b08KIA(8yx&|<膮 KHA(8bK`Pb0|#@AX|#@@b`8bhp0| @@8,@bc@,#AdHLbc,#AbcB,#A H<^H4bc@/#;`pA,@ ;H;`@,@bcB,#A,A|\,Ap,Ah, A`bc,#@Pbcx,#@@PcK5`,@$b@,@8H, @@c0H bc@, A ?H9 _ȟ ccapxKj,AHb@`z`y8bx&| *K``x8bK`@Xb, Ab, @8,@b;hH,,@b;tH,b;A;, @0cK``f8alc8;KF9A(H,#@DK`a pcK``g8alc8

`aA ;`;@!axAp!h`Xb!8Ȉ8,$|x$|*A@pA`b , A K `K `b| @0H | @$b , A K `MAHMBB"0P H~9@@Ah 8ab!85chK@@c?-?A ;b#@|~`&~h @bd, Atp`Ab , @PK`b| @b , @ 88b08K A(@cc8Hx&x$|"|@* KA(8bK`AXb0|#@@ b`b0p|# @A`8`8@:8!0|px} !Aa!AaN K`KK`K|` @pKc@DKaA!: xp!"ag88cg|c,$xc$|*ApA , @Kܽ`b| @Ĉ , @l;b 880ccKA(@"8{Hx$x&|"|0*KA(ccKߵ`Pb0|#@AX|#@@b`8bhp0|$@@8bW@>+| ,={/LB|&T 6,||#xxTz"A \, A <"p@ 8(A HX0@:bP:bh~ @} @`!, A 4,1a@, @ bb@, @/, @x&,@8|(*KNI``tbCKY`bC088x&|8*KA(bCK)`8LJBb`0Ap`|$(@@8K-`,@, A, dA|p`A , @\K)`| @Ĉ , @,; 880cK IA(@88Hx$x&|"|0* K A(cK!`Pb0|#@AX|#@@b`8bh0p| @@88`8PJ8!@|px} !Aa!AaN K`KK`K|` @pK; 88pcK A(H@8}x&|"`K A(cK`Pbp|#@AX|#@@b`8bh8K8c&H 9,@, @^+, @/b#KYmA(,Ab|@b#8JKRA(,#@X89`b&"9bbp]eyJ$|P*K`K`n8?"bE88A\| KXA(,@X9`8b&9"b}dxxj$bp|P*KM`KhaKQA(,@~Ppb0|9 @~# @}&|#@~&|9@}&b#\@<(8`!!xpK-,@b@xH b8@X, @8ۈ/c&, @@" ,@8K IA(8t8`bEx&| *K %A(bK9`b`~ `x&@8} | *@8KH``taK`a088x&|8*KA(aKح`~ `08bp}%@LRBA@8K`,0A}@``!a8c&H@,bA8(AĈ, @@/, @4@x&,@8|(*KG``taK`a088x&|8*KA(aKש`c#8`LRpBA@8K`,AK., @K@., @pKb#KUIA(,b;@bx&| *KF``tcK `b c808KA(cbFx&| KA(cKֹ`0bP| @A | @@8b`0bp| @@8, dA p`AԈ , @K`| @ , @ b808KA(8t8x&| x$|0*KA(bK`0bP| @A | @@8b`0bp| @@88`8KK`K@K`K|` @Kb9`8Bb&9"B{d xg$bP|8*K`" b8P8KA(cbEx&|`KA(bKԱ`8Ppb`|$(@A`KX89`b&9"bbp]eyJ$|P*K5`KP89@bb&9bP.K y)$|H*K`KaP8888K%`,@Hb@,@8b@K(acc89c)H.`qKHX0bP@::bh~ @} @`!, A ,1a@, @b.b@, @,/, @ x&,@8|(*KB``tbCK`bC088x&|8*KA(bCKҙ`8LRPBb`0Ap`|$(@@8Kޝ`,AtK 8c&H,AKacc89c)H,`qKacp8H58,AK@ "PK"pKȈ., @@"PKK1`KK%`K`| @0Kl"Ct BrLabelWrite|}&aA`;!;;;`;@:; aA!xp!axb8x8, |x$|*ApAb , @K`b| @b , @L 8;08cKA(@8xHxx&x$|"|@*KA(cK`Pb0|#@AX|#@@ b`bhp0|$@@8|,A ,@X|?@@ pb, A X; axb8 8K8``wb, @ 88`b"8899)(RcK~`,#ADapAb , @  8:b0bc8KA(@8sH85hx&x$|"|(*KQA(bcKe`Pb0|#@AX|#@@ b`bhp0|$@@8>`bvb`KEuA(,#ApbdXPbH.:b0B|?(@"h@9"}?@}@|&``!bCxcKL`,,/A A A0,@bpAĈd ,#@bCK?A(8^|fBH8bbE}ƒx&|J,' , @@,& @@KA(8bK`8 n8 ,#^@, ^@8 n,#^@@bpAԈ , @; 8b|f`rKCA(,#@abcK`,Ad,<`y@X~?@AT,:AbP; bHB@}?@pAb"hp}@ , @KA`8c8b8KA(8}bc&x&|"K]A(8bKq`@ b`@cA 8c;8cK A(H@8}xx&|"KA(cK`P|?@@ b`bhp|?@@cbd, Ap`Ab , @dK `b| @b , @0 8;08cK%A(@88Hx&x$|"|@* KA(cK`Pb0|#@A``bX| @@ b`bhp0|$@A`8`8PJ8!@|px} !Aa!AaN KŹ`KKŭ`K|` @pKKŕ`KL8cc8KA(8}bx&|"KA(cK`@ b`"hp}@@8bKȑ`KbPp; bHB@}?@"h}@K88K+`,A0b/, A,ALbd, A(p`Ab , @Ky`b| @b , @ 8;08cKA(@88Hx&x$|"|@* KUA(cKi`Pb0|#@AX|#@@ b`bhp0|$@A`8`8KpKÅ`K,Ky`K|` @Ka88cH,@X|?@@tKK5`K@bKƥ`K0bCK8mA(|A`||A |PKbX}?@~?@pA|b}@ , @\8cH8b8x&|#`KA(8bK `MRSA@cKKe`K 8c8b8KA(bH8b8cx&|"KuA(8bKʼn`LJBb`A}@@cbKY`KK`K8bpA , @8, LRBA8 8b08KA(b8b8cx&| *KA(8bK`;@b`|3@X|p@LB0BA~b0|#@@cK K`KX, LRBAKXA,@K,<A| @;;`.:K8 c8b8KA(b8b8cx&| *KA(8bK`;@b`@@cK8,@ .:KH8 8bP8KmA(b8b8cx&| *KMA(8bKa`;@b`|4@;@c.:KK뿭`KD8K;axb88K,``wb, A8KH@8bx&| *K2``s8bKµ`K-` 88b08KiA(8sx&|@KIA(8bK]`Pb0|#@A |#@@ b`bhp0|$@@8KK뾑`KK뾅`K|| @PK Ct BrTapeRewind|}&aANB`;!`N1BNRBaA!xp!ba`hg88cg|c,$xc$|*AlpA , @LKq`| @ , @ ;B 880cCKA(@8zH`x$x&|"|0*KYA(cCKm`Pb0|#@AX|#@@ b`bhp0|$@@8;@,9Ap|`|xxTz"Ad, Ap,````!y, A@8apK55`yp##y,@@H8bx&| *K/]``y8bKm`K`a`8,K4A(,#@Xb0|#yALc`| (@A0````!c|#yA| (@@`ah 0P|v,}$@@8b808KA(@H8y8p`x&|"0KmA(8bK뾁`AXb0|#@@ b`hpb0}@@8~a`8pb8K'`ap``8``88899;(RcKm`,#APaxpA , @888b80KA(@8y8?hHx$x&|"|(*KIA(8bK]`AXb0|#@@ b`@8b<x`bK4A(,#AAXXb0|#@AHP|> @A |>@A H<`#I?:^{?:#NF:D"8@``!b؀||@ c||b||c|xhcO|y@},pcA ,/$@ 8;A;@@hpA , @DAXbbxK3A(,#@XaxpcKv`,AP`v@,@@Hc#x&| *K+`8bK뻵`K-`a`8,K0A(,#@h,@8b808KMA(@H8y8p`x&|"0K!A(8bK5`AXb0|#@@ b`@cb蛃ӈ}, ATp`A , @4KU`| @ , @8b880KA(@8y8Hx$x&|"|0* KEA(8bKY`AXb0|#@@ b`A`8`8PJ8!@|px} !Aa!AaN K1`KK%`K|` @pK8b880K]A(@H8y`x&|"1K5A(8bKI`AXb0|#@@ b`@cbCKh,@l8b808KA(@H8y8p`x&|"0KA(8bK븵`AXb0|#@@K8b880KeA(@H8y`x&|"1K=A(8bKQ`AXb0|#@@KK봱`8b88cKA(@H8ybpx&|""KA(8bK`P|>@AX|>@@ b`bp|>@@ca`8,K,A(,#@h,@8b808KEA(@H8y8p`x&|"0KA(8bK-`AXb0|#@@ b`@c,#ApA , @KU`| @ , @8b880KA(@8y8Hx$x&|"|0* KEA(8bKY`AXb0|#@@ b`A`8`8KK벍`KPK벁`K$| @K,8b880KA(@H8y`x&|"1 KA(8bK뵥`AKxh,@\8b808KYA(@H8y8p`x&|"0K-A(8bKA`A(K8b880KA(@H8y`x&|"1(KA(8bK`AXb0|#@@KbK&A(@`p8|``89#8b|}/|8,$ x&@~9`| *|x, @~y|p, @~qK)A(8bK=`8b|`d|(, ^@ 8 |)|x, ^@ 8 |y|p, ^@8 |qKKe`AKAT| @0 , @N1@KK-`| KbK볕`| K888bcKMA(8y@px&| *K-A(8bKA`p|>@@cNRKLK믙`b؀||@ c||b||c,|xhcO|x,K|AbK벽`K888b0K}A(8y@px&| *K]A(8bKq`@cNRbKQ`K(H<`#I:^?[?:#NF:d"9@````!b؀||@ c||b||c|xhcO|y@l},pcA ,$@4,;A;@@8pA , @A$bbxK(A(,#AdKTbK#5A("@`p88|8b8|a&|a%| ,' x&@~!a(!|x|8*, @~y`|p, @~qKA(8bK`8b|`d|(, ^@ 8 |)|x, ^@ 8 |y|p, ^@8 |qKK`A KAXN1| @0 , @ @KK묽`| @KbK!`| K888bcKA(8y@px&| *K߹A(8bK`PX|>@|x@LB0BA b`bp|>@@cN1NRK(K`b؀||@ c||b||c,|xhcO|x,KAbK%`K888b0KA(8y@px&| *KA(8bK`@cNRbK뮹`K0P|>@AX|>@AH<`#I0?{?:@^:#NF|'@:"9$@!|&````!b؀||@ c||b||c|xhcO|y@l},pcAl ,$@ ,;A;@@8pA , @A$bbxK%-A(,#AKTbKuA("@`p8|8a&|9a%8b}| ,' x&@~F!a(!|x|8*, @~Fy`|p, @~FqKA(8bK `8b|`d|(, ^@ 8 |)|x, ^@ 8 |y|p, ^@8 |qKK5`A KAT| @0 , @N1@KK`| KbKe`| K888bcKA(8y@px&| *KA(8bK`p|>@@cNRKLKi`b؀||@ c||b||c,|xhcO|x,KAbK뫍`K888b0KMA(8y@px&| *K-A(8bKA`~ LJBA b`@cNRK|X<`#I:^B0H{?:#NF[?|*@:"9$@!}`&a````!b؀||@ c||b||c|xhcO|y@l}pcA ,$@8,,;A;@@8pA , @A$bbxK!A(,#AKTbKA("@`p88|8b8|a&|a%| ,' x&@~!a(!|x|8*, @~y`|p, @~qKiA(8bK}`8b|`d|(, ^@ 8 |)|x, ^@ 8 |y|p, ^@8 |qKK륥`A KAXN1| @0 , @ @KKm`| @KbK`| K888bcK؉A(8y@px&| *KiA(8bK}`PX|>@|x@LB0BA b`bp|>@@cN1NRK(K뤱`b؀||@ c||b||c,|xhcO|x,KAbK`K888b0KוA(8y@px&| *KuA(8bK막`~ LJBA b`@cNRK|K`K|8b880KA(@H8y`x&|"0KA(8bK`AKah 0P|v,}$@@\8b808K֝A(@H8y8p`x&|"0KqA(8bK릅`AK8b880KEA(@H8y`x&|"0KA(8bK1`AXb0|#@@K8ap8 K`KDp, @,8apKi`9p,, A!a>T>aA!b!;,848|xc$,$|*A pAb , @ K`b| @b , @  8;B08cCK1A(@8zcHx&x$|"|@*KA(cCK `Pb0|#@AX|#@@b`8bhp0|$@@8b,=C@$,;AXHb0P;bB@;%`p~# @h}#@b@``!c8cK@,cuApccH, @/, @x&,@8| *K``{bK`b808x&|8*KҡA(bK뢵`LRPB8c0|@A@8K`,@bd, Ap`Ab , @`K`b| @b , @, 8;08cKA(@8H86(x&x$|"|@*@KљA(cK롭`0bP| @Ab0X|#@@b`8bhp0|$@@88`80*8! |!A} a!AaN Kq`KKe`K|` @|K|,=~@xxTz#`A\bk, @bxc|`yA<| @A `!c|`yA | @@8,#@b+, @\bcaKEA(,Ab|@`px8ac!%(E@`K,A|acccHA,#AH`|bd, A0p`Ab , @ K`b| @b , @ 8;08cKA(@8cHx&x$|"|@*@KA(cK`0bP| @Ab0X|#@@b`8bhp0|$@@8c8KDK`K$K`K|` @K 8c;B8cCK!A(Hb@8zcx&|@KA(cCK `P|>@AX|>@@b`8hBp; |>@@8,=@L88b08x&|KuA(8bK띉`0bP| @Ab0X|#@@ b`#b0|#@A`?K8"9Bb9bP  x $|H*K`KcP8888K9`,@b@,@8KhbHXb0PB@;";@`~# @ph}#@"`!c8cK,c3Ac#., @Ј/, @x&,@8| *K ``ybcK`bc808x&|8*K˽A(bcK`LRPB8c0|@A@8K`,A K0bP| @A\b0X|#@AL,;A$c8cK,A|Kc8cK,A\K,;A$c8cKɩ,A4Kc8cKɉ,@pKKY`K`KM`K,| @K8"C BrLabelRead|}&aA!`a; ;`taAT>!xp"!B8c|cxc$8@,$|*AXpA܈ , @8K1`| @ , @: 880bKQA(@8wHx$|0*x&|"KA(bK1`Pb0|#@AX|#@@ b`#bhp0|$@@8, @k, Al.b8(R0KA(,#@|b|AL8"Bccbx$9$|8* KU`bPp; H@~;@h};@8b88cfKA(8}x&|@KA(8bK`AX|;@@ b`#@c ~,#A\pÄ , @aA!xp!"bBBaȀi8L8ci|c,$xc$| *A pA | , @ K|`"| @ X , @ @;" 880c#KA(@8yHx$x&|"|0*KA(c#K`Pb0|#@AX|#@@b`8bhp; 0| @@8|<@@ l,;A P, A 0,;@, @ac88ccK,#@, dAxp`A , @XK{`| @ , @(; 880cKA(@886(Hx$x&|"|0*@KqA(cK~`Pb0|#@AX|#@@ b`#bh0| @A`#8`8z8!p|px} !Aa!AaN KzE`KKz9`K|` @pKa8cK1,ATH@8bx&| *KM``t8bK}]`, @b,>8A8<`ffc:@:#fg````!Tb,@48@||p|2x$x|:|(P,@0KY`bKI`bEs:R~C8,3@0b :T"0bP, ~1@@8b8b&8KQA(bCx&|K-A(8bK|A`AX|1@@ b`#ha}1@@c ,;A, A/, @t@X9}@`!8kac8,&cfAH,(@<8bK5,,AbAL,@<@., @,/, @ x&,@c | *K``t8bK{!`888b0x&|8*KA(8bKz`cLRpB`A$@c K`,AK/, A, @, dAp`A , @Kv`| @ , @8b880KA(bCcx&|@x$|0*KA(8bKy`AX|1@@ b`#A`0c8KKv-`K\Kv!`K,|` @K8a8cK,A:`ApBc, @ $~ yAL, AbCK5``rqc8cK`}`:s`pK,bA8p,>A@:`<`UUc:#UV`!b`r,$A :sb8AT~e8T,@0|ƈ|*||*xd|0P|P,@HK`bK `rc8cK_`ap8apKUA(8A,x"x"8ax|x"8|| !8lKA(8ALbK`8xbKq`8APbKa`rC~@y@"0b 888bb&KA(:T8tx&|KeA(8bKty`P~1@A@X|1@@aA!xp!b8\8|xc$,$|*A%pA%hb , @%xKnu`b| @%@b , @%$ 8;08ccKA(@;}8}Hcx&x$|"|@*KIA(cKq]`BP}@AX|<@@b`8"hp|<@@8b|>@|`|x|&,7xTz!~&| @$~ A$b, A#cbAX}<@A|6@~&~ A~ AA xb@bH|<@~6@B`:#:}&```!c8bK,8bA<8" b8, @/, @,@8KA(cc@cx&| *KA(8bKo`c@@8Hx&| *Ky``}8bKo`@8c8b8x&|8*K=A(8bKoQ`c8@} @8K{e`,@ 8c8b8KA(@Hcccx&|"KA(8bKn`|>@AX|>@@ 8;a|h @8bd, Adp`Ab , @@Kj`b| @b , @  8c8b8KA(@cc8Hx&x$|"|@* KA(8bKm`AX|<@@|<@A`8`8PJ8!@|px} !Aa!AaN Ki`KKi`K|` @pKb+, @ bKA(,Ab|@ $b8JK A(,#@X8"B9bcb9 x $|H*Ka`KD}`o"9E8?KUA(,@X89"Bcbb9xx $|H*K`KaK]A(,@}X~<@|6@}<@}&b8pxc!G@'(`K),8b @h8~ "bA, @~ @., @8/, @,@8KA(c@ccx&| *KA(8bKj`@8c~ @H} @8x&䘹| *K]``}8bKjm`8@c8b8x&|8*K!A(8bKj5`8LNPBcA@8KvI`,A~ @LS|~&A````!c8bKa,c@AH., @/, @|x&,@8| *KM``}8bKi]`@8c8b8x&|8*KA(8bKi%`8LNPBcA@8Ku9`,AK`!c8bKq,c@A(H., @/, @x&,@8| *K]``}8bKhm`@8c8b8x&|8*K!A(8bKh5`8LNPBcA@8KtI`,AK`!c8bK,c@A4H, @~ @., @/, @x&,@8| *KU``}8bKge`@8c8b8x&|8*KA(8bKg-`8LNPBcA@8KsA`,AK@Hcx&| *Kֵ`8bKf` 8c8b8KA(@Hcccx&|" KYA(8bKfm`AX|<@@ 8:@8bK=A(,@bxc|`yA8| @A$``!c|`yA| @@8=(c8]@`cp8v5Hx!Ku,Ab=(8]@`c!pxcK=,A`bd, Ap`Ab , @Ka`b| @b , @ c88bc8KA(@cc8Hx&x$|"|@* KA(8bKd`AX|<@@A`8`8KK``KPK``K|` @K(8"9BbcCb9  x $|H*K`K8"9Bbcb9 x $|H*K~`K89`"BcCb9i x$|8*K~e`Kc8888cHKs`,@D,@8K,B`bH~<@}6@b@:#:``!c8bK,8bA8" b8, @/, @,@8KeA(cc@cx&| *KEA(8bKbY`c@@8Hx&| *K ``}8bKb`@8c8b8x&|8*KA(8bKa`8c@8Kn`,AKAxb@bH|<@~6@B`:#:}&``!c8bK,8b A\8b8., @,/, @ ,@8KA(cc@cx&| *KA(8bK``c@@8Hx&| *KН``}8bK``@8c8b8x&|8*KaA(8bK`u`c8@} @8Kl`,A(KB`bH~<@}6@b@:#:`!c8bK,8b A8b8., @/, @,@8KA(cc@cx&| *KiA(8bK_}`c@@8Hx&| *K-``}8bK_=`@8c8b8x&|8*KA(8bK_ `8c@8Kk%`,AK~ AAB`bH|<@~6@b@:#:}&`!c8bK1,8bA|8" b8, @H/, @<,@8KA(cc@cx&| *KA(8bK^ `8c@H@8x&| *Kͱ``}8bK]`@8c8b8x&|8*KuA(8bK]`c8@} @8Ki`,A`b| @b , @88b08KqA(8|8x&| x$|@*KqqA(8bKA`AXb0|#@@ b`A`8`*} 808! |!AaN K=u`KK=i`K|` @K8"9Bb9bP  x $|H*K[`Kp8"9Bb9bP  x $|H*K[=`K`8"9BbbP) y)$|H*KZ`K8kc&8b8KoA(8|x&|-`KoA(8bK?`P}@AX|9@@ b`KH@KK;`KK;`K| @K"C  BrHeadVerify|aA!!ba88c,$|dx$|*A8pA~ ,#A K:`K:`| @H | @̈ , A K:`;B 880cCKmA(@8zHx$|0*x&}"KmA(cCK=`Pb0|#@AX|#@@b`8bhp;@0|$@@8H;@"2, ADk, A0, @$pa8bKk,A؛YiHpa8bKk,A|0ax8-x8Tz#HK_`aKA(,AXb|A@8"B9bPx$D |8* KWu`Xa8px;([@`!Kh,Ac@hYiaK%A(,A\b|AD8_9`"9bPyJ$g |P*KV`a8XKjE,A@K`8a0 8KA(,A088a0cKA(,#@h4p Al"8B9 b9 P c`x $|H*KG`b, AKxcK9A(,@xbn, @bq, @a KmA(,A|b |Ad8"B9b9P c  x $|H*KF`b, AKa 8KyA(,@Pbd, A,p`Ab , @K(`b| @b , @ 8;08cK[1A(@88Hx&x$|"|@* KZA(cK+ `Pb0|#@AX|#@@b`8bhp0|$@@88`8KK'!`K(K'`K|` @K8"9Bb9 (P cx $|H*KE1`b, A,K8"9Bb9 P cx $|H*KD`b, AK 88a0`!KaA(,8a08cA KA( 8,#8a0A`K89 "Bb9 (P chx $|H*KD`b, AK8"9 Bb9 (P chx $|H*KC`b, AKt8a0KmA(8|c8=KXUA(K08a8 pKX1A(K8aH (8)`ax, A88KE``wb8(RK]A(,#A``v, A0ax88KE``ub8JKA(,#@p8"9`BcCb9x$i|8*K=y`|, A p`A؈ , @K`| @ , @; 880cKQA(@8~8Hx$|0*x&|" KQA(cK!`Pb0|#@AX|#@@b`8bh0| @@88`8KK`K;;aAU;>;@!T>9 :;xp::ahA`:`:@!XP:: H@99U >9!Ab a A b a ,'A 8|a A x$B ! ( 08 8 @! H|!*@A|pA , @|K `b| @b , @|;b8B0cc8K>)A( , A|\`@8{Hx&x$}B| *K=A(ccK `Pb0|#@AX|#@@ b`bhp0|$@@8b, @bc f,@ Ks`,>@zb, Abh,7A:bPbBBp"````!@, A4X, A8, AyY, A=, Aylx~y@8aKmA(,#Ax8aKA(b`CA x  c"{a a KA(,Alb|AT8"B9b9BpcC  x $|H*K'`;"bPH@hc8~:@Ku`c8cF8x&|K;A(cK `AX|:@@ b`bd, Alp`Ab , @HK`b| @b , @c808K; A(8y8x&| x$|@*K:A(cK `0| @Ab0X|#@@ b`b0|#@A`8`8 8! |@H} P!XA`ahpx!AaKpK`KK`K|` @pKa 8JKQA(h,#dAubpAb , @u\b88;B08cCK9A(@8zH 8:x&x$|"|(*K99A(cCK M`Pb0|#@AX|#@@ b`bhp0|$@@8 4,9T~a L|&T 6 @mx , AtbHH;@ `@;":^:w@! 9h`!8uX,>,hA@m8, Ai<;hx~y@ bhcKA(,@h0b. Ag| , A8d|`y@gD,@$b`{`rKA(,Ab|Ap8 "B9bbFBp9 cC  x $|H*K"`;"bPH@hc8~:@KbC8JK~A(h,#dAfbpAb , @eb8 8;B08cCK6A(@8zbHH8:`x&x$|"|(*K6A(cCK`Pb0|#@AX|#@@ b`bhp0|$@@8b0c,;AdH;@ @;":^b:@86|"h```!K5A(bpAdd ,#@dbKwA(a`s8c#|x&~1|8*K5A(c#K`8b|C!bKYA(,bAc{86|`y@T , AP`@H;@ ;":^"h:@```!h, @b8{x`y@bhcK|A(,@ab. 8a8!08:K4A(8a8;08:K4A(8a8408:K4A(8a8108:K4mA(8a8?08:K4QA(8a8\08:K45A(8a8O08:K4A(8a8K08:K3A(8a808:K3A(b8A  , Ab0c,;@`4b0c,;A`cc8:Kwq`,A_cc86(KwU`,A_bcd88cxK&1``dbKsA`a . 8:Kx`b X,$A_ a Kx`a h @^4,>@^a 8:Kx}`b::$(:*a 8;`nKxI`B`aKx5`A] , A]b, A\؈, W`>| LB3BA\,>@\a8;4Kw`A  , Ab0c,;@\ b0c,;@[Al , A@0d|`y@[\,@(a8;\Kwu`aKwe`A  , A0d|`y@Zb, @ZAZx , AZlb0c`yAZ\, @Z(8aKsIA(8c8x$| *K`a aKq`KU`,;"@HbPc8AYc#x&| *Kp``ycK`Ki`c808K0A(:8y8$x&|K0A(cK`0} @Ab0X|#@@ b`hBp0}@@88` "88899)(RcJK`,#ALa ȀpAb , @X88bc08K/A(b"x&|85hx$|(*K/qA(cK`AXb0|#@@ b`@8b< `a bdKvA(,#AbX<`#D 0B0|:@?#S =#R8ON8@ ;AV =TO=#B$$! "`~& >PI:D= : bpA b , @VT | @Ud9888`889 8 a 8a$ 8 K}`:(a$|"xT>|*xA|hBx|g:xaT>|2x  } Kx|+x|fRxT>}%|#x}|Zx|}$||jbx (|3xU>|Kx|! 0|v}Ey|v|;x|Ā8|c`8|vT>a Th> (| H8! 0AS(a$|xT>|c"x|`yAR؀(a$|"xT>|d2x|+x,@cT>ĀȀ"|e*x|"xT>|2x|#x|f:x|T>|Ј|x|c+x,|`v}8 @cb$, B@%, RAQx8a$8;xKvA(|py@bpAb , @b KsA(,#@a cEK `,A`q,A8`s`r@ , @Xa ,#AA  , @c808K*A(<b H8x&|"脾K)A(cK`AXb0|#@@ b`@cKc8cF8K)A( bbfx&|2K)iA(cK}`AX|:@@ b`Kdc8cF8K)A( bbfx&|K(A(cK `AK,>@db, Ab, A, A , A , Adc8cF8K(uA(< bbfx&|"脼K(IA(cK]`AKc8cF8K(A(< bbfx&|"脼hK'A(cK`AKc8vcF8K'A( bbfx&|.K'A(cK`A4K$ , @K4 | @,,>A , A\c8cF8K')A( b8x&|2K'A(cK`AKc808K&A(<b H8x&|"脾K&A(cK`AKc8cF8K&qA( b8x&|K&IA(cK]`AK,>@b, Ab, A, A , A , Adc8cF8K%A(< b8x&|"脼K%A(cK`ADK4c8cF8K%iA(< b8x&|"脼`K%=A(cKQ`AKc8vcF8K% A( b8x&|.K$A(cK`AKxc#x&| *Kd``ycK`K@c#x&| *Kd``ycK`K8A~:@ , @c808K#A(<b H8x&|"脾K#yA(cK`AXb0|#@@Kc8cF8K#5A( bbfx&|K# A(cK!`~:@AX|:@@K~:@,>@Lb, Ab, A, A , A , @Kd , @K | @,>A ~:@K~:@K~:@,>@b, A b, A, A , A , @,Kc#x&| *Ka``ycK`Kb, A%, Ah , T>| LB3BAL,>@Dk, A8 , A,a ,#A bn, @ , AXb!,A< | / LZBA,>@Ĉk, A , A 0 (|||`x,Ab~:@x&cn,#@<|c8d8cFLK A(cK`AdKT|c8dcF8LK A(cK`A,KOFӂATby, T>| LB3BA8,>@0 0 (c|4|T~| 9Acdb`sKn1A(,@ 8bh,<A dK` ,A  | @4,>Aa ,#Ad80c8KA(a bcx&|2KmA(cK`AXb0|#@@ b`@c,@c808x&|KA(cK`AXb0|#@@ b`@cb,A  | @t,>@lbh,>A\b:@"`!@, AX, Ab, @xy@b, | LF|`&|h Axb, @hbh,>AXb:`B ` X;`u P````!@, AY, A8, A=, @88b, A~`,A, +@b#>`8 P>pAxR@pKA ,c#Ahx&| *K]``ycK!``,:DA:CK}`, A~,#@~K9``pb#K)``g8a bEb84KA(8a K`8a XPp`,(8@b, Ab, A, A , A , @`c088K-A(<a bcx&|"脼hKA(cK`AKc808KA(<a bcx&|"脼KA(cK`ALK8c8v08KqA(a bcx&|.KIA(cK]`AK | @<,>Aa ,#A\80c8KA( b8x&|2KA(cK`AtK`c808KA(<b H8x&|"脾KqA(cK`AXb0|#@@Kc808K-A( b8x&|KA(cK`AK,>@b, Ab, A, A , A , @`c088KA(< b8x&|"脼`KYA(cKm`AKc808K)A(< b8x&|"脼KA(cK`AKc8v08KA( b8x&|.KA(cK`AHK4c#x&| *KSu``ycK`Kx8""9`cc9"bBd  x $|H*K1`Kc8XcF8x&|+KA(cK`~:@AKt |K8KHa `nKQA(`o8||, @ 8^|8||, @ 8^|8||, @ 8^|cx&|@K9A(cKM`8||, ^@ 8 ||, ^@ 8 ||, ^@8 |Kc8cF8KA(b x&|"KA(cK޹`  V> | LB0BA8 Kc808KIA(b x&|"K)A(cK=`|2@LJBA@c8 Khb8;|KQ`,@. , A ,>A-\b8;KQ`,@ , A+ , }&} A'@,.L|&T 6a A , A , A ,$@ | AK8`8;xKX}A(|py@8 @8`98x$| *K` 89 g8`x$| *K٥` @p, p: A8a H8ca HKbKNYA((#A@(# @ 8  @, Ab`KP `,A8` 98x$| *K`bKK`a @K8`8;xKW%A(|nyA%(9 |yA$d ` `!,?A$܈X, @#xb,@ ` / AD@ , @a ,#Al , A$,>@8, @ , @Y, A=, @,>A <, Ab8, A@Ta ,#L|&T 6 @ , @ , @ , A , A,>@c8cF8K yA(bx&| K YA(cKm` U>~ | LB0BA8a |h  AޜKxc8fcF8K A(bx&|,K A(cK` U>~ | LB0BAKx,>@b, Ab, A, A , Aa ,#@p8ccF8K 9A(b>x&|脼K A(cK)` U>} | LB0BAKc8cF8KA(b>x&|脽KA(cKؽ` U>} | LB0BAXKP,A\,@tc8wcF8KAA(bbx&|.K!A(cK5` U>~ | LB0BAKp88K``pKx , A9ccF8a8dKA(bx&|x$ |0*K]A(cKq` a T`>} | LB0BA Ka KIA(88d cFa8|cKA(b=x&|z脬KA(cK` a T`>} | LB0BAK|c8cF8KA(bx&|0@KiA(cK}` U>~ | LB0BAK8`8;xKQA(|nyAaKH A((#Aaa 8KI`,@ 88`8;xKQ5A(|ny@8 @,<A;KY` } A  @, @c088KA(a=b x&|z脼@KUA(cKi`A |2@@@c, @ 8 Л=| d8AxKTc808KA(a=b  @x&|z脼@KA(cKԵ`AXKLc808KqA(a=b x&|z脼KEA(cKY`|2@LJBAKc#x&| *KD``ycK!`K@aKEA((#A(# @ 8  @, Aa`KG`,A8` 88x$| *KE`aKCy`a @K8baKEQA(8c8x$| *K``oaKC%`a 8K0c8cF8KA(b>8x&|脽@KA(cK` U>} | LB0BA8 K8`8;xKMA(|oy@8 @8aKT%A(,#A|,@b ,$9hA ,,>@ $,<A;K`bB, @, A , Ap,#@t@, A<b, A0pKqQ``npPKqA`aa`g8a 84KA(8a Kѵ` @,/@8a  `8;82LKiA(,AhW, @\, @P8a 8KF`8a KE` p8 @X(d8,@d , AXa ,#AL p h;`n@``!8, Aa, Ax}sy@ h pbB, A8 , A,b(, Ap,AcdK`,AD,<Ad;c8a08KA(bx&| KA(cK`|2@LJBA@cb@, Ap, @dp88)8Kq``p8Kl`,Ac8a08KYA(bbx&| K9A(cKM`|2@LJBA@c | AӈKdb@,@c | A`K<c#x&| *K>``ycK`K|8Kk`,A,<Ad;c8a08KiA(bx&| KIA(cK]`|2@LJBAKc#x&| *K>``ycK%`K|0dh8<KA`9,@n,#@cDnKa`,<,@pA@;KE`c808KA(bx&|KeA(cKy`|2@LJBA@cAn,#A ,/A aK|cDK``o,A ,@8AaKHc808KA(bx&|KA(cK̹`|2@LJBA@cKxc#x&| *K<]``ycKm`KaK8.`8 9 axpO@`KTo?@,<Ax;c808KA(bx&|> KA(cK`|2@LJBA@cKc#x&| *K;q``ycKˁ`Khc8cf8K=A(bx&|>@KA(cK1`a |h @pKh8a }K@bc,#@p,#@,AW, @|`, @p@, ApЈ, +AT,<A ;KI`,A\,@, Ap,#AT@, @HKf`a aKf``g8a a84 K1A(8a KE` @,/@8a  `8;82KA(bB, A,/A|8a K8A(`naKfA``e8 |n8< KA(8a Kƹ` p=} ( Ȁp8AK8a 8K;`K8a  a`8;82K)A(K0pKe`a aKe``g8a a84 KA(KaKeY``f8a a8;KA(Kp88K``nKc#x&| *K5``ycKő`K,>@L,<A\;K`, AbB, A@, AP @, @t8a  `84482KA(8a K ` @p, A,b, @pЈ, +@ bKH=K@8a  ` `8<(82KA(Kb, A,p,#A 88K-``gK$p88K ``gKp838K``gKc#x&| *K3``ycK`K,@$b ,$9tA,>@Kx,@$b ,$9A|,>@tKP,@$b ,$9AT,>@LK(,pW(A,,#@$b ,$9A,>@K@$b ,$9A,>@Kb ,$9AK88`,<eA a ,,#A|A<,>Ac808KA( bcx&|2KaA(cKu`A0| @@@ccC8b>y$$x $| *|H*K `~:@Kc808KA( bcx&|KA(cK`AH0| @@@K8,>@c8v08KQA( bcx&|.K)A(cK=`AKA,>A`c808KA( b8x&|2KA(cK`ApK`c808KA( b8x&|KeA(cKy`AK,>@Dc8v08K)A( b8x&|.KA(cK`AKc#x&| *K/``ycK`KaK1A((#A0(# @ 8  @, Aa`K3a`,A8` 98x$| *K `aK/=`a @KAh@d , A,>Apc8cF8KA(bax&|1KA(cK` U>~ | LB0BAKc8cF8KA(bax&|@KmA(cK꾁` U>~ | LB0BAK,>@$c8xcF8KA(bax&|/KA(cK ` U>~ | LB0BAK , @[, Ac8cf8KA(b>ax&|脽KqA(cK꽅` } @c | AKc8tcF8KA(bax&|.KA(cK ` U>~ | LB0BAKa ,#O|&T @ , @ , @ , Apc8cF8bKiA(bax&|KIA(cK]` U>~ | LB0BAK a ,.}&K-A(} A8b 8cF8|cKA(b =x&|z脽KA(cK` a T`>} | LB0BA\KT8b 8dcF8|cKUA(b=x&|z脬K1A(cKE` a T`>} | LB0BAKc8cFb8KA(bax&|0`KA(cK` U>~ | LB0BAtKl@| Apc8cF8KmA(b>ax&|脼KIA(cK]` U>} | LB0BAKc8cF8KA(b>ax&|脽 KA(cK` U>} | LB0BAߌK߄[, Ap8`8;xK4A(|nyApaK+uA((#A\aa 8K-E`,@D 8 | Ac088K-A(a=bx&|z脽KA(cK`|2@LJBA@c? pa 8pp| A/.@/@0L1@b, ATP, AHB, @A0Wb,LFBA,/A, @A aaK*`,@\K8a898Kٱ``oKȈY, @[, A 8, AKc8cF8x&|6@KuA(cK궉` U>~ | LB0BAKb8;K*`,@,>A8`8;xK1iA(|pyAbK'A((#Aba K)`,@l  , AT 8`a @} | LB0BAc8 b8;K(u`,@4b, A$8`8;xK/A(|pyAbK&MA((#Axba K(`,@ K֬9bbK& A(8c8x$| *K±`bK#`a KXc8cF8KA(b8x&|KA(cK곭` a T`>} | LB0BAc8 b8;K')`,@b, @p} @ըb8;K&`,@ KՄ} @|b8;K&`|`4bT~ 8;K&`K 8`8;xK. A(|pyAbK$A((#Axba K&e`,@ K9bbK$UA(8c8x$| *K`bK"-`a KԠc8cF8KA(b8x&|KA(cK` a T`>} | LB0BAc8 Kt8`8;xK,A(|pyAbK#qA((#Aba K%A`,@$ @b8;K%`KT9bbK#A(8c8x$| *K뿽`bK `a Kc8cF8KA(b8x&|KA(cK갽` U>} | LB0BAc8 K8`8;xK+A(|pyAbK"9A((#Axba K$ `,@ K\9bbK!A(8c8x$| *K뾝`bK`a Kc8cF8KߥA(b8x&|K߅A(cKꯙ` U>} | LB0BAc8 Kшb8;K#`,Alb8;K"`,APb8;K"`,A4b8;K"`,Ab8;K"`,Ab8;K"`,Ab8;K"i`,Ab8;K"M`,ATp|`xa|"x|#x|x|yAa |yA, @K8`8;xK)YA(,#@@<<@<@r  9__8a 8*$<,4*  H `88aИ>K/=A(,#Aa x aa  K.A(`28a$ |K.UA(,#A,<A;K꩙`2$(@b!, @c808KܵA( b x&| K܅A(cK꬙`|2@LJBA@cc808K9A(b8 x&| KA(cK-`|2@LJBA@cKpa 8l88a K8a$8 KA(|pyApKA(,A88pKA(`8a$8 KA(,#AԈ, :@ , A9`8p```!K`,a@p`x~yA|pK8a$8 K A(|pyA8pKA(,A$bKiA( ,0A@b,@#````!cx|`yA,@Kb蛣YKa `oK9A(`n8||, @ 8^|8a ||x, @ 8^|y8||, @ 8^|cx&|@KA(cK`8 ||, ^@ 8 ||x, ^@ 8 |y|, ^@8 |KK`KK`K|hBp~:@Kla8K`acdK`Kb0c`yA, Aa8K`Ka8;tKu`AK@c8:TK`,@a8;dK=`Kc8:TKe`,@A , AKcc8:K5`,A@cc86(K`,A$a8;TK`acdK`AhKcc8:K`,Acc86(K`,Aa8;TKY`acdKI`AKa8;HK-`Al , A`KLb, AX, ALa W`>| ,#LB3BA4,>@,a8;K`A , AKa8;(K`A , AKa 8:Ky`b;$K ,>@b, LRA, At , Aha ,#@0a 8:K`b:c:$a(Ka 8:K`b:Ԉc:$a,Kpa 8:K`b:$KLa K`a h @(,>@Kb88'8cxKƥ``dbK`a . KtbxK`a KXcc8:KQ`,Acc86(K5`,ApK8"bFBb9Bp cCx $|H*K`;"bPH@hc8~:@Kb86|KA(bpAdd ,#@bKA(a`s8c#|x&~1|8*KmA(c#Kꢁ`8b|C!bK$!A(,@089 "BbbF9Bp cChx $|H*K`c8bPh~:@KKi`K$8 "bFBb9 Bp) cChy)$|H*K꼕`c8bPh~:@KK`K| , ALKK`K$9` 9b"bF9 BBpdcCx $|H*K`;"bPH@hc8~:@Kc8:TK`,@K8a8!08:KЉA(8a8;08:KmA(8a8408:KQA(8a8108:K5A(8a8?08:KA(8a8\08:KA(8a8O08:KA(8a8K08:KA(8a808:KϩA(b8K8 "9 Bb Bp cCx $|H*Ki`;"bPH@hc8~:@KP,1b,A , @9, A,,//ALOBӂADW, @8, AD/, A4,A,@, @, @B, A0\b,/@0,&@5` L`,@|!*bAP8:,!K1A(b, @ @||#x|v|x8T>pAhc ,#@bKA(`r8c#|`x&~1|8*KͭA(c#K`8b|C!bKaA(,A  K89 "Bb9 Bp cChx $|H*K9`c8bPh~:@K,Kꙝ`K! 8:, KA(KUA(b8:8! (A 8 ( 8K̵A(K! HA X8:8b H XK̍A(K\8:LpbAKqA(K@pb8:LKQA(K LA|@b,@@86|A(b, AP86|K A(KKA(KpAb8:L, AtPKA(K8u898K``f,>b@$5`! h`8:, hK˅A(KTp8:LKqA(K@<, @p, AK, , A0H: `@;":^bP:w@ ` ```!8zY,#hA8, Ax=, @l,A8zW,#@,bc,#Ah, @`z@, @PbB, A~W, A4,5@,,>@,.A,?A?, A~\,@,&AzW,#@,'A,>@pb8bpAlb , @bK A(`r8|c#`x&~1|8*K]A(c#Kq`8b|~#!hbK A(,A b, A  ,AP\,AD,AAX , @Lb86|8KuA(bpAb , @bK AA(8^@H`{88b|`|9x&|@K A(8bK`88 b||!hbKA(,@8"B9 b9 Bp cChx $|H*K겙`;"bPH@hc8~:@KK`Kz88K`cdK`,@tb@,@cKX89 "Bb9 `Bp  cChx $|H*K`c8h~:@KK9`KbKA(:! x|`8< xKeA(Kpb8;KIA(KLz,,&@hbcx,@X@Xz@,@H,@889`8K``fpb8;KA(KAbc,#@$z@,#A8bcB,#@(P,Abp8;KyA(z``,@x, A@, AAD,+A8,>@8b8K `bbK `KA$oH,>@b8Kz88)8K`,>`u@b8K M`K@, AK`8889Ka``fKKܛh;K,>AKK`K9`9b"9B BpdcCx $|H*K`;"bPH@hc8~:@K8"9Bb89Bp cCx $|H*Kꮥ`;"bPH@hc8~:@K8w80HK%`wPKaA(,A|@x,9b@LB, @@8 wB9 7`qpAxPJ@K,A bK;"~:@H@hc8Kccc9 Px $|H*Kꭕ`KTbHB@8bx&| *KQ`8bKe`8^B8b08x&|+KA(8bK-`Pb0|#@AX|#@@ b`bhp0|$@@8KlB8KKQ`KdKE`K0| @K<"C~4 BrUtilCall|}&KA`9 9@9`aA;;!xp;;`h`;@;XPaHA@:`!80( 9b!p!x8,'A|ax$8| |)*A0pAb , @IK`b| @b , @IL 8;08cKA(@8}Hx&x$|"|@*KA(cK`Pb0|#@AX|#@@ b`bhp0|$@@8, @bc j,@ K`d,#A``!;c|`y@,?|&| A"HPc9Xb0@::J B`~# @}#@;"h;`!, @G8, @E@x,7@b0r,@`bX@|(@|@,AD8@9!bPbX<, ;@b;" | 0p`}*K|d A>8`8A,,L0BA$;@YT>r`r`Z*Rx,2@~H,4A;$8:`H!xc8Ap889apK{e,Ac| Al8`,$A<,ؘ`@ `!8cx|dyA`,$AK8`8HC,A:88aK AA(,#A98aKA(("c#CaPAX!`p} hA9Pbt, @9@ax|h @bhB`:!8 Axcca|h Ad``!p],#A(p=,#Ap<,#@p:,#A,x~y@8c#8dp8KA(8yx&|8< x$|0*KAA(c#KU`pbP| @Ap| @@bd, |` A0p`Ab , @DKu`b| @b , @c#808KA(8y8x&| x$|@*KaA(c#Ku`0bP| @A | @@0bp| @@88`8 8!| (} 0!8A@aHPX`hp!xAaKKA`KK5`K, A, AB, A6T, @6Hb, @6 W, A6p,#A588K ``d8aK`b,@/ A4,$@p@, A b/ A4,@4xb9(@9a(|h A4@bct,#A.bc,#@8} ,#@ }:,#@,$p@,A-,,$@-,$@p@,A ,A,AW,A-0pT>| ,LFBA|0@@,Xb8 (@8b88KU,A+8qXax:8x |a@ :s:R|$@Ahx88`!xb:`H,)a|}:+@}@&,A}&(| Abt, A*8apK!`a`t8| ,A| @4cE```!8|A*,8C b| |ApAd ,#@c#8b08K1A(b8yx&|!KA(c#K%`0pw|4@|@LJBA@8`wP(| d8@KKQ`K`b, @D , @(:, @x$8 |f*@, A'xb, @'hx$8 a|*, @g@Lc,#A ,,AAW, A'@0| Aa|'@@&b8 `8 |z$(|Đ*@8a88KM,b, @:bPp}@Ac#b`8:8KiA(Abx&|G@KEA(c#KY`Ap| @@ax8cax,@,b, @8a(|h AKc#8p8x&|KA(c#K`AKc#8gb`8KA(88Px&|bC',K9``fbb$bEKAA(c#KU`A p| @@K@ a<8bh;@|*a, AB, A$Ĉ, @$b, @$xaW, A$hc,#A$\A88Ky``d8aK`z$bh| *, A9!xd^}I, `A@#e@c0 `8Apba99 xK@Kr=`a9b9::@: bppAb , @#L88c#08KA(8y"`x&A|b85x$}P*|(*KAA(c#KU`0| @LJBA0pw|$@@8`w8h `|8*KuA(,#A;@8ya,3-a|&``!a, @" c@c0 8ab9!9@xpK@K`88T8|d*(A|iN ~yA-bpAb , @taKA(|`}z, @ 8^, @ 8^, @ 8^c#ax&|@KA(c#K}`, ^@ 8 , ^@ 8 , ^@ 8 AbpAb , @dbp;@8a h|Pb}aa|0*KA(,#@H(| Abt, Abh|c *4p @Tbh|c*KeA(,@,2A,1@bpAb , @8, :pbP}@AKx`c#8p8K)A(bx&|"KA(c#K|`Ap| @@c#8kbp8KA(Abx&|-`KA(c#K{`Ap| @@ax8cax,@KXc#8`8KAA(bx&|"K!A(c#K{5`Ap| @@bK{`KKw`Kx,3Kx:pbP}@KxaKq`,Ab, A$a,@Hb, A8a<| d8/@`@, A a, T`>| LFBAP0| OBBAdb, A, AHa|A,Alb@` *0 $ $(,@ b <<@ b <@2b8**H `88a2KA(,#A`PAXA!`h!apKqA($!@ b <<@ b <@$8a|"KA(,#Ata8|fW(@`aa0,T`>| LFBA| @b, A, AA!x8r:~8xH1I,@ x,ApbP}@Kc| A````!], A(=, A<, @:, Ax~y@x,AX(| ADbt, @4, @,, A, Ax, Ac8:`| AD8=, @?, A=8cx|`yA=, @Kc8HAp88899 pKf,Ax8`8H/,A@8c| xAB, ,8/ ```!/@8/@LA$-/.A NްBA8cx``/@x| @K蜈| LFBA|0@@b`8 |(*(@8b88K,AXh88;@xd|g!.a|*8 8(:| xd~)*~&.AKb, @c#8gp8KeA(88x&c|,K``f8yccK!A(c#Kr5`pbP| @AKc#8:p8KA(8yx&|G@KA(c#Kq`pbP| @AK`8`89bA"p8<p|*K M`,9yd|n!.@b, @Hc#8gp8K%A(88cx&|,K``f8yccKA(c#Kp`pbP| @AK@dp@c0`~ 9p9 b^0`x|*pK@KbA,9zDd|o!.ATKbcK@, AX,A<, @p@c,#A$@,ApW,#@ ,@ b, @8 , @:, @@, Ab, @, @p@c,#A ,A,AW, Ap0pp,T>| LFBA|0@@b`8 |(*(@8b88K,b,A$@<8bh;@|!*K(@c#8gp8KA(88cx&|,Ky``f8yccKA(c#Kn`pbP| @APK@8`889Bpb8<9+(RpK`h,#A|d*@XKc4c#x&| *K``ybKn `b, @~/,:YA0b8a8KA(bCx&|, KA(bKm`A0| @@b0p}@@8b8c08K-A(bC8x&|,`K A(bKm!`A0| @@@8, @p@c0p^980`N@9 pxK^``d8`Bpb88899+(RK-`h,#|d*@KHbcKb808K-A(bCx&|1`K A(bKl!`0|.@LJBAKKh`K c4c#x&| *K``ybKk`b8qb08KA(8y>\x&|脮 KqA(bKk`0|/@LJBA0pw|$@@8`wb, @pK8c4c#x&| *K``ybKk`b8b08KA(8yx&|1@KA(bKj`B0|2@LJBALKD, AH!, A , @,LZBAB, Ab(, AD, AXb,A(,A , A, @09, @$@, AB, A : K: Kp88K``d8aKٵ`KTp838Ky``d8aKى`K(c4c#x&| *Ki``ybKiy`Ke`9:Y} @"0b8?8KA(bC @x&|KA(bKh`A0| @@0pw}@@8`w9$@<<~&~ @<@$(@b!, @b808K)A( bCHx&|HKA(bKh `A0| @@@8b8b08KA(bCx&| KA(bKg`A0| @@@8KLb8cd8~ | LB0BAb@8K8bC80b8KA(!bx&|1KmA(bCKb`0bP| @`|@LFBA0pw|$@@8`wKbC8jb08KA(8yx&|-@KA(bCKa`B0|2@LJBAK|9 9 "`BBbp|ɀ*x$|8*K|`K8 9`"`9Bbpg`|`*x$|8*K|1`:@KTbhp|c*K`a,A VR>K@:@VR>K4K]e`K| @bK``K|aKґA(~~|x@hbpP~ @pA`b , @Dc#8p8x&|#`K-A(c#K`A`AKK\`Kc#8p8KA(8yx&|"KA(c#K_`Ap| @@bK_`KDK\1`K@@Kc#8bP8KeA(a:"x&| *KEA(c#K_Y`!~( @8:8: K~y8`aA -Kc#8bP8KA(a:"x&| *KA(c#K^`!~( @8:: KbpAb , @8, LNAc#8b08K-A(a:<"x&| *K A(c#K^!`A: 0| @@ : 0pw|$@@8`waT`>| KߔKZQ`KT,3LNAKTKt~yA -Kdc#8bP8KiA(a:"x&| *KIA(c#K]]`!~( @8:: K,2A -Kc#8bp8KA(a:\"x&| *KA(c#K\`!aT`>~( | LB0BA:@: K8KXbcKKY `KܰbcK,A88rK``d8aK-`Kۤ`nc838K~``d8aK`Kt!b`b8 |8(Rz$|c*KAA(h,#|d*A 8 x$a|*Kڤ89":``9Bbp|ǐ*x$|8*Kvm`c#8kbp8K-A(A8y8 zE$x&||(*-`KA(c#K[`pbP}@A | @@ax8cax,Aش8c#p8x&|KA(c#KZ`Alp| @@dK\88xd|.Ka8 xd$8 || *K,b, @c#8gp8KA(88x&c|,K|``f8yccKA(c#KY`pbP| @AЈKxc#8:p8KyA(8yx&|G@KYA(c#KYm`pbP| @A(K8`8bX9"p8<pK`q,@`b, @\c#8gp8KA(88cx&|,K{``f8yccKA(c#KX`pbP| @A\KL@Pp@c0p}9b^0`9 XxpK@KIɐq,AK|bcK@b, AX,A<, @p@c,#A$@,ApW,#@ ,@ b, @8 , @:, @@, Ab, @, @p@c,#A ,A,AW, AT0pT>| ,LFBA|0@@Xb8 (@8b88K},b,A@<8XK@c#8gp8KA(88cx&|,KyI``f8yccKQA(c#KVe`pbP| @A K8`889Bpb8<9+(RpK`sX,#AKLc.c#x&| *K``yaKU`b, @},8yaA0a8a8KyA(x&|, aKYA(aKUm`A0| @@b0p}@@8a8c08KA(a8x&|,`KA(aKT`A0| @@@8, @p@c0p98^0`9 xN@pKF``d8`Bpb88899+(RK`sX,#AK΄bcKa808KA(ax&|1`KA(aKS`0| @LJBAKKPU`Kc.c#x&| *KÕ``yaKS`a8qb08KeA(8y<x&|2脮 KAA(aKSU`0|.@LJBA0pw|$@@8`wb, @KLc.c#x&| *K``yaKR`a8b08KA(8yx&|1@KA(aKR`0|.@LJBALKDbc,#@K؈, AH!, A , @,LZBAB, Ab(, AD, Ab,A(,A , A, @\9, @P@, AB, A8b(| |`|xxTz9@䀐@4Kb9 (@9a(|h AKʰp88Kt``d8aK%`K p838Ks``d8aK`K8`Ki`,A ]KƬb@,@8b@]Kƈ89@"b89Bbp Zx$|8*Kk`KTb@,@8b@KŰ, @| AXc```!], A0<, @$\,,L0BA:sY`cx|`y@8cAp~d88899 pK?,AƐ| APc`!], A08`, A \,,L0BA =`cx|`y@8`8H,A@| AP```!]b, A(8<, AY, @]xy@| @|h;;B"::dPe`!K̹A(,A|@L8;Z:s|:p@@t:Kbd, |` A0p`Ab , @KJ`b| @b , @c#808K}A(8y8x&| x$|@*K}A(c#KM`0bP| @A | @@0bp| @@88`8KDKI`KHKI`K9"B bPx$|8*Kh`Kb@,@8b@K}b#~ yA0`q4@*1,LBA4```!1~ yA@q4@*1,L@@Z*88Q4r8T>rqr, ЛY`A Br, A, @, @W, Ar,#A88Kn``d8aK`8aKA(-,Ab|@ADb~H l|,LEAbPRx~@y@K,4@K~H,4A$,A,@؀,@8c#8dp8KzA(8yx&} x$|@*KzA(c#KJ`pbP| @AKxB99`89""b ibPx$|8*Keq`AKrKm``d8aK-`Kh838Kl``d8aK `KD, U>|d A$,A,LFBAhK 8"89Bbp  x$|8*Kd`K`K_`K8,.aA!`xbB|a~}&8c~,$|dx$8l!!|*A8pAX} ,#A KB`KB`| @0H | @$ , A KBi`NAH NBA;" 880c#KuA(@8yHx$|0*x&}"Ku]A(c#KEq`0bP| @Ab0X|#@@b`8bhp0|$@@8b, ,/%APE, Ab;:cHdb@, c@P, @ ;:H<;:H4Ab;:cH Ab;:xcH :`; ,3@,9@;  ;88dPc?Kt)A(H@8x89x$x&|0*|" KsA(cKD`bhp`P|%@$A`#HbcPK`,#A, A,@H@8bx&| *Ki``u8bKCy`K?`p 888bbKs-A(8uc%cx&|<臛@KsA(8bKC`P|4@AX|4@@b`8bh8@8,?AHH@8bx&| *K``w8bKB`K?`p 888bbKrYA(8wc%8:x&|<臛`Kr1A(8bKBE`P|6@AX|6@@b`8h8bcKA(,@A\b|AD8^9`"bfbP9yJ$g |P*K\`88`K.q`{, A8p`A} ,#A K=`K=`| @H |` @Ȉ , A K=`; 880cKpA(@88Hx$|0*x&}" KpA(cK@`0bP| @Ab0X|#@@b`8bhp0|$@@88`88!} |a!AaN {, A8p`A} ,#A K`0bP| @Ab0X|#@@b`8bhp0|$@@88`ax88!} |!AaN C  \ BrStopCheck|}&aA;;!;;@aA!xp!b"ax8(f8cf|c,$xc$|*A(pA  , @K8`| @ , @; 880cKl!A(@8x89Hx$x&|"|0*KkA(cK;`Pb0|#@AX|#@@ b`bhp0| @@8x8`88999(Rc 8K`,#AapÄ , @ 88:b0bcKk A(@8s89BH"x$x&|"|(*KjA(bcK:`Pb0|#@AX|#@@ b`bh0| @@88> b5b`KA(,#A(P}@A X|8@A 8@:bH::`B0| 8"9@95!b*A: ^-?````!w KA( `ebKA(,A0@,<@\| @4 , @@ , @@4A(|`K]A(|`||A|xP|``pKA(,#@Pac8K`,A,=|}A,@~x{, App`A܈ , @PK5Y`| @ , @$; 880cKh}A(@8~cHx$x&|"|0* KhAA(cK8U`Pb0|#@AX|#@@ b`bh0| @A`8`8z8!p|px} !Aa!AaN K4`KK4 `K|` @pK,<A:bPp;}@AD , @,K3` b88cKgA(@Hcc8x&|""KfA(bK6`AX|8@@ b`bh b88.cKfA(@Hcx&|"%Kf]A(bK6q`AX|8@@ b`h{, Ap`A܈ , @K2`| @ , @ b808KeA(@c8Hx$x&|"|0* KeA(bK5`0P| @Ab0X|#@@ b`hb0|#@A`8`8KLK1`K4K1`K|` @KK1`K b88cKdA(@Hc8x&|""KdA(bK4`AX|8@@ b`Bhb؛K4`KH:P;}@K4:P;}@K;pAl , @T@Hb88cx&|:#`KcA(bK4`A8X|8@@4K(K0u`K b88cKcA(@Hc8x&|""KcA(bK3`AX|8@@ b`hb؛K3m`K |``pK-A(|`@bb~, , @0,' x&@0@0| *KbA(bK2`8 p,#^@ 8` p,$^@,%^@$KK/)`@@K K/`pAKbK2}`pAKb 88cKb-A(@a8x&| *KbA(bK2`;@h;:K@bpKyA(`}hbKeA((#(A:`A:`V}?~s.=A| @Kb(KA(,#A,:\,#,LFA8 KA(,#A8 98cKA(|nyAx88aKA(88cx$| *K?`ae`rc`K`,f@L,p@8 @Ka89Ku`T`b`d@cKa89KE`T``@cKb0KA(,#A :eKb8KA(,#A :fKb@KA(,#A :oKbHK}A(,#A :pK`bPK]A(,#A :yK@bXK=A((#A(:zK :8@:XH:`bb/: ^|8@| B9D"A9d@a9-?`p|&````!w KA( `ebKA(,A|@,<@| @h , @D@ , @ @\A,|`KA(|`|AL||xP~bKA(,#ADKL~bKEA(|`}, @/, @/, @/@bbx&| *K]A(bK.`, ^@ 8 , ^@ 8 , ^@8 AKK*9`@8AKK*%`pAKbK-`pAK b88cK]9A(@a8x&| *K]A(bK-%`AH LNBA b`bh;@;:KpbKmA(`}hbKYA((=A:`(#A:`V}?~sNA| @K(bKA(,#A$:\0, A`,#AX8 KA(,#AD8 98cKA(|nyA(8a8KA(8c8x$| *K:`0ae`fc`K`,f@D,p@8 @Ka89Ka`T`r@crKa89K9`T`r@crK0bKA(,#A :eK8bKA(,#A :fK@bKA(,#A :oKHbKyA(,#A :pKhPbKYA(,#A :yKHXbK9A((#A0:zK(K'`K@K' `K(pKK&`K| @K C BrPlusVersGet|}&aA9 ;!;;`;;`;@aA; !xp!apxb!888, |x$|*ApAb , @K%`b| @b , @~8ap8KXA( 8;08cKXA(@8x8Hx&x$|"|@*KX}A(cK(`Pb0|#@AX|#@@ b`bhp0| @@8b, @ , A5, @ L~8ap89!px%@@`K`a``8`"`88899)(Rc KQ`,#AapAb , @ 8 8:0b8KW1A(@8uH85hx&x$|"|(*KVA(bK&`Pb0|#@AX|#@@ b`bh0| @@88>bb`K A(,#AXxbPH:` .:|%@hB`" :"}%@@}@|&``!8bxp89 9@p(@@`K*y`,,/A A A,@bpAd ,#@bKA(8^|fBH8bb}ƪx&|J,' , @@,& @@KU)A(8bK%=`8 n,#^@, ^@n, ^@n@bpA , @; 8b|f`uK9A(,#@acKE`,A,<`y@Xax|#@A,:A`dbP; Hb@~$@pAb}$@ , @K `8x8b8KSA(8~c&x&|"KSA(8bK#`@ b`@h, @bd, Ap`Ab , @\K `b| @b , @( 8;08cKSA(@8~8Hx&x$|"|@* KRA(cK"`Pb0|#@AX|#@@ b`bh0| @A`8`8PJ8!@|px} !Aa!AaN K`KK`K|` @pKb`cHKA(bh8HKD, @Hbd, A$p`Ab , @K9`b| @b , @ 8;08cKQQA(@8~8Hx&x$|"|@* KQA(cK!)`Pb0|#@AX|#@@ b`bh0| @A`8`8K4KI`K0K=`K|` @Kb`cHKA(bh8HKK`KL8cx8KPAA(8~x&|"KP!A(cK 5`@ b`bhx}$@@8bK `K;P}#@ Hb@~#@K8Km`,A8,>A, @Hbd, A$p`Ab , @K`b| @b , @ 8;08cKOA(@8~8Hx&x$|"|@* KNA(cK`Pb0|#@AX|#@@ b`bh0| @A`8`8KK `K0K`K|` @Kb`cHKeA(bh8HKK`K`bK5`KPbKA(|`||A |PK0b~8@pAtb , @X8cH8b8x&|#`KMA(8bK`AX|8@@̛KK`K8c8b8KMAA(H8b8cx&|"KMA(8bK-`AX|8@@bK `K(K}`KH8bpA , @8, LRBA88b08KLA(8b8cx&| *KLiA(8bK}`;@0Xt`|$@|(@LB0BA~| @@ctKlK`K\, LRBAK\A,@DK@,<LJA8x8b8KKA(8b8cx&| *KKA(8bK`;@;ax|;@@;`a|h @c.:K;;.:K8,LJAp88bP8KKA(8b8cx&| *KJA(8bK`;@;@c;.:KKa`K\b`HbKA(,Adb|AL8"Bbcb9) y)$|H*K5a`Kb8JKA(h,#vH@X9`9"c9Bdx $|H*K4`K a8cK`,A0,%Ab8'KIA(u8 KA(,#APHbK9A(,AbpA0b , @8t8 KA(,#@xb, @\8 8:0b8KHA(b@8tH8'x&x$||(*KHA(8bK`Pb0|#@AX|#@@ b`h0| @@88bx&|@KH!A(8bK5`vHKA(,A8"Bbc9 x $|H*K2`K KI`K:8cKA(`eb8*H `KhK`KD8"9 Bbc9 hx $|H*K2A`Kxb8K`b8/cKYA(0||px|bKq`Khb8'KFA(b8/KA(,#A40,@$8 KK`KxpK@K`K<| @KH"C BrRemCmdRun|}&T>;aA;;`!;@aA!xph`!"ag8D8cg|c,$xc$|*A pA  , @ K`| @ h , @ P@ 8ap89H@KE A(; 880cKDA(@8x8pHx$x&|"|0*KDA(cK`Pb0|#@AX|#@@ b`bhp0| @@8bЈ, @ 8, ,@ A P 8aX89`PKDA(8`8X888999(Rc Kí`,#AȀapÄ , @ 8 88:0bKCA(@8u85hHbx$x&|"|(*KCYA(bKm`Pb0|#@AX|#@@ b`bh0| @@88>bb`K}A(,#AP:bbHX:^->h:v}0@:C":#@~8 @``!,=@pA ,#@l@,;@pAl ,#@T;@8b|f`oKA(,#@a8XcK`,A,=`zA ,@,;A:bPap;~8@A h, @KY` b88cKAA(@Hc8XcFx&|""KAmA(bK`AX|8@@ b`b , @b88acKAA(@Hcx&|"L K@A(bK`AX|8@@ b`|, App`A؈ , @PK =`| @ , @$ b808K@eA(@c8Hx$x&|"|0* K@)A(bK=`0| @Ab0X|#@@ b`b0|#@A`8`8 p j X8! `|} `hp!xAa!AaN K `KK `K|` @lKb88acK?)A(@Hcx&|"L(K?A(bK`A X|8@@KK y`K b88cK>A(@Hc8Xx&|""K>A(bK`AX|8@@ b`hb؛Ku`K:Ph;~8@Kx b@Pb0,$BH~#@@808b8`K=A(8b8cx&|LK=A(8bK `AXb0|#@@ b`h0} @@8,#ApA , @K `| @ , @8b880K=-A(88b8cx&| x$|0*KKKy`KpKtKe`Kx| @K"C` t BrQioCreate|}&ۡہ`U>U=>aAU\>!!8Pab,%8|xc$|*AHpA,b , @$KY`b| @b , @ 8;b08ccK7qA(@8{Hx&x$|"|@*K75A(ccKI`Pb0|#@AX|#@@b`8bhp;`0|$@@8B, A8((@$ce|xxTA8H8a8K)m``d8aKv}`.<A8aKA(p8acKcu`,#A|, @p@ 8@`apxca 99  @```!KY,8`@l 8K#`, @,@A`a@0capx899   K bd, App`Ab , @LK`b| @b , @ 8;08cK4A(@88Hx&x$|"|@* K4A(cK`Pb0|#@AX|#@@ b`cbhp0|$@A`c8`8 |ˡ8!} !AaN K`KK`K|` @Kbd, A(p`Ab , @KA`b| @b , @ 8;08cK3YA(@88Hx&x$|"|@* K3A(cK1`Pb0|#@AX|#@@ b`cbhp0|$@A`c8`8KpKM`K,KA`K|` @K 8a@`capx9 9  @KV),@؛ 8aKYA(8`8K A`,ADbd, A$p`Ab , @K`b| @b , @ 8;08cK1A(@88Hx&x$|"|@* K1]A(cKq`Pb0|#@AX|#@@ b`cbh0| @A`c8`8KK`K0K`K|` @K8`8K`,AKP8aK]`,#AU7>|bB"~8\8c,$!~|dx$A|*A8pA} ,#A KA`K9`| @H | @Ĉ , A K `: 880bK.IA(@8vcHx$|0*x&}"K.A(bK)`Pb0|#@AX|#@@b`8bhp0|$@@8(8:(A8K|~xx`TA8Ha88K Y``d8aKmi`x, @4PcK`,@b@,@8, +Ac88)8K`aK`,@ 8`8K`,@tHT,@H@8bx&| *Kl``v8bK` 8b88r0K,A(8vx&|.@K,aA(8bKu`Pb0|#@AX|#@@ b`bhp0| @@8Hp88@ c8x@`99 p  KO,@d8`8 K`,@ z, A8p`A} ,#A K`K`| @H |` @ , A K`; 880cK+A(@88Hx$|0*x&}" K*A(cK`Pb0|#@AX|#@@ b`bhp0|$@A`8`8HDz, A8p`A} ,#A K`K`| @H |` @ , A K`; 880cK)A(@88Hx$|0*x&}" K)A(cK`Pb0|#@AX|#@@ b`bhp0|$@A`8`8H(b,  A8pA} ,#A K`K`| @H | @ , A K`; 880cK(A(@88Hx$|0*x&}" K(A(cK`Pb0|#@AX|#@@ b`bh0| @A`8`80ˡ8! }!AaN "A ? BrCopyRestore|}&aA`T>!;;:;aA!xp!A8ab8,$|xc$|*A|pAHb , @XKi`b| @ b , @b 88b08K&A(B@"H8b8cx&x$}|0*K&EA(8bKY`P0| @AXb0|#@@ b`"hbpa0| @@888a8p8cȘK`,AH8bx&| *Ke`a8bK`K)`88b08K%iA(8b8x&8c|<脾K%=A(8bKQ`0| @~&~ AXb0|#@@ b`b0|# @|&| @8b, @, @, @8a8p88K$A(8`8"88899)(RcK%`,#AapAb , @8c808b8K$ A(8bx&|8c88lx$|0*K#A(8bK`~ AXb0|#@@ b`a|h @88<`c`KjA(,#A~?@AX|?@A<bH:::":c@9}? @`: `!a88KdA((#bA:V?~-@8,=@b| @ , @l@b , @L|d`oKd}A(|f8ba8^}zx&,' , | *@,& @@K"-A(8bKA`8 o,#^@, ^@/, ^@/A$|`KcA(|`||A`|P|``oKiAA(,#@acKI`,A -|u~A ,A$,=Ab~? @pA\b}?(@ , @8K`8c8b8K! A(bH8b8cx&|"K A(8bK`AX|?@@ b`@c, @, @8b8c8K qA(H8b8cx&|<脾K EA(8bKY`AX|?@@ b`@cbd, Axp`Ab , @TKy`b| @b , @ 88b08KA(88b8cx&| x$|@*KaA(8bKu`0| @Ab0X|#@@ b`b0|# @A`8`88!|px} !Aa!AaN K5`KK)`K|` @pK8b8c8K]A(8H8b8cx&|<脾K-A(8bKA`AX|?@@K8aKl)A(KdK`K8c8b8KA(H8b8cx&|"KA(8bK`AX|?@@ b`a}?@@8bK`K0a~?@}?@K8aKkeA(,Axb|A`8"B9bc89  x $|H*K`~?@}?@K8a8JKdA(,#@h8"B9bc89 x $|H*Ku`~?@}?@K`r88KjyA(,A XbpA4b , @ ,b88KA(bK]A(8*|ebH `8808b8KA(9H8bx&|8c88x$|0*KUA(8bKi`a~h AXb0|#@@ b`| @88bx&|@KA(8bK`bCKbA(,@ , @ l8a8p888KA(8`8"88899)(RcK9`,#Aa(pAb , @ 8808b8K!A(H8bx&|8c88lx$|0*KA(8bK`a~h AXb0|#@@ b`a|h @88(|P}ƪaKaA(,#A~?@AtbX|?@Ah<H`: :":d@}?(@:^9 ``!a88KZA((#b8@b,|M@,=@|b| @H , @ @b , @|d`nKZA(a|d8b}rx&,& , | *@, @@K=A(8bKQ`n, ^@.,#^@,$^@A$|`KYA(|`||A(|P(|``nK_UA(,#@a(cKa`,A||A ,AX,=A:aA!`xp!Bahg8Ԉ8cg, |`x$|*AppAL , @PK`| @, , @ 8b880KA(@bHBh8b8cx$x&|"|0*KA(8bK`P0| @Ab0X|#@@ b`bhpp0| @@88ah8pb8t8xcptK`,A x@H8bx&| *KG%`ax8bK5`Kӭ` 8b880KA(@H8th8b8cx&|"<脾KA(8bK`0| @~&~ AXb0|#@@ b`0pbh| @|&| @8,$@, @8apKTUA(,A,b|A8b"c8p9"[ yG$|8*K`|>@p~>@&p, @tb , @8b88cK}A(@Hh8b8cx&|"<脾KMA(8bKa`ah AX|>@@ b`bh@8,$AtpA , @TKс`| @ , @( 8b880KA(@8H8b8cx$x&|"|0* KiA(8bK}`0| @Ab0X|#@@ b`bh0p| @A`8`8 8! |px} !Aa!AaN K=`KK1`K| @pK8b88cKiA(@H8th8b8cx&|"<脾K5A(8bKI`ah AX|>@@K8apKQ)A(KX8ap8JKJ]A(,#@l8b"9`Bc8p9"ix$|8*K`|>@p~>@&K`o86|b%KPA(,ApAd , @b86|b%K5A(bKD!A(8*`t8b|H `b8 88b80KA(@869pBH"8b8cx$x&|"|(*KA(8bKѭ`~ AXb0|#@@ b`bh| @88t9^@h"H|t8b`}x&|@K A(8bK!`8 b|aKHA(,Ah8b"c8p9"[yG$|8*K`|>@p~>@&K8`8x88899:(RcK`,#AapAԈ , @d8 88b80KA(@86b BH8b8cx$x&| *|2KA(8bK`!~( AXb0|#@@ b`bh| @88>bb`KFA(,#A0|>@|&| A X|>@A bH8p:`:@:#"|5(@8@-b:^|&|>(@|&,<}@&A```!a86K@QA(,#A,9@<; ;| @  , @@ , @| @8-A }|` M@ , @|P}aKEA(,#@\a8xcK`,A(,9`{A ,A,7A|>@|`&paA p, ~> @@KE` 8b88cKA(@H8xcf8b8cx&|""KUA(8bKi`ah AX|>@@ b`bh@8K`Kɩ`K\ 8b88cKA(@H8x8b8cx&|""KA(8bK`a|h AX|>@@ b`bhp~> @@8`dbؘḰ`K|>@ap~>@|&K8apKJaA(,Ab|@@Haxx&| *K;`8bK `Kȅ` 8b880KA(@H8th8b8cx&|"<脾KA(8bK˥` AXb0|#@@ b`bh| @8,$ApA؈ , @Kǹ`| @ , @ 8b880KA(@8H8b8cx$x&|"|0* KA(8bKʵ` AXb0|#@@ b`bh| A`8`8K@K`K8K`K | @K9`8"b9bd x$8p|P*K`K|>@ap~>@|&KKQ`K||`K;A(|A`|A |KP@| ap~>@, @\@H888bcx&|:#`K9A(8bKM`ah AX|>@@KKũ`K 8b88cKA(@H8x8b8cx&|""KA(8bK`ah AX|>@@ b`bhp~> @@8`dbؘKȁ`K}aK:AA(|`}z, @, @, @@a8bx&| *KA(8bK`, ^@ 8 , ^@ 8 , ^@T8 KHK9`K0K-`pA(K bKǑ`| @ K 8b88cKAA(@8b8x8cx&| *KA(8bK1`bh!( @c:::@KPa86K8}A(,#@086aK8eA(,#@86aK8MA(,#@8aK:m`,@(,N,LPA| @ Ka86K7A(,#@86aK7A(,#@a87K7A(,#@a87K7A(,#@a87(K7A(,#@ha874K7A(,#@Pa87@K7iA(,#@8a87PK7QA(,#@ a87dK79A(,#A4a87pK7!A(,#@a87xK7 A(,#@a87K6A(,#@87aK6A(,#@87aK6A(,#@87aK6A(,#@x87aK6A(,#@`@;`:`KD 8b88bKA(@8b8x8cx&| *KA(8bKġ`hab`h @c`:::@Kp:`bH8p:@-|5(@:#"8@b !:^|&|>(@}&,<}&``!a86K5A(,#Ah,9@; ;| @ , @p@ , @T| @8-A }|` M@D , @,|P}aK:A(,#A4KXK`K|`K5A(|A`|A|K}aK4A(|`}z, @, @, @@a8bx&| *KA(8bK©`, ^@ 8 , ^@ 8 , ^@8 KK`KK`pAKbK9`| @Kh 8b88cKA(@8b8x8cx&| *KA(8bK`!X( |@LB0BA b`bh| @c:::@Ka86K3A(,#@86aK2A(,#@p86aK2A(,#@X8aK4`,@(,N,LPA8| @dKHa86K2A(,#@86aK2iA(,#@a87K2QA(,#@a87K29A(,#@a87(K2!A(,#@ha874K2 A(,#@Pa87@K1A(,#@8a87PK1A(,#@ a87dK1A(,#A4a87pK1A(,#@a87xK1A(,#@a87K1yA(,#@87aK1aA(,#@87aK1IA(,#@87aK11A(,#@x87aK1A(,#@`@;`:`K 8b88bK9A(@8b8x8cx&| *KA(8bK)`hab`h @c`:::@KpKi`KK]`Kt8b9`"Bc8p9"ixx$|8*Kى`|>@p~>@&KbKʥ`,@b@,@8KK麹`KPppKK麝`K| @K C<BrSsJvUsrPwdSet``b|}&aA!`aT>aAT>!x8!,$8|xc$|*A pA b , @ Ky`b| @ db , @ HB 88b08KA("@cH8b8cx&x$}|0*KUA(8bKi`P0| @Ab0X|#@@b`8hp0| @@888abK`,A8bx&| *K+`a8bK`KM`88b08KA(8bc8x&8c|<脾KaA(8bKu`0~ @Ab0X|#@@b`8b0:}#@@8b, @, @ TH!`8b@@H%Y`H`,#A -~`4`oT~@ \,;@ T,>@b88a(H`o, A888bc8KAA(8bx&|<8c86x$脿|8*KA(8bK `~<@AX|<@@ b`}<@@8o, @aH}`, @8b8c8KqA(8bc8cx&|<脾KIA(8bK]`AX|<@@b`8;@8bd, Alp`Ab , @HKu`b| @b , @88b08KA(88b8cx&| x$|@*K]A(8bKq`0| @Ab0X|#@@ b`b0|#@A`8`8z8!p|x} !Aa!AaN K=`KK1`K|` @tK8b8c8KeA(8bc88cx&|<脾K9A(8bKM`AX|<@@K8c8b8KA(8b8cx&|<86臢KA(8bK`AX|<@@ b`A`KaHa`H9`,#A `o@,;@,>@|b8@8a(H`o, A<888bc8KA(8bx&|<8c86x$脿|8*KA(8bK鵽`~<@AX|<@@ b`}<@@8o, A88bc8K=A(8bx&8c86|<脢K A(8bK`ATX|<@@PKDaH`8a8bK=`,Aax&| *K$`8bK鴽`K5`88b08KuA(8bc8x&8c|<脾KIA(8bK]`AXb0|#@@ b`@8bd, Ap`Ab , @Ky`b| @b , @88b08KA(88b8cx&| x$|@*KaA(8bKu`AXb0|#@@ b`A`8`8KK鯩`KPK鯝`K|` @K(~<@}<@KH:ap8apc86DKA(;ax``!{K$A({;{;, @oKDb,38|8c`@ oK(K 888bc8K=A(8bx&|96(<868cx$脿|8*KA(8bK `~<@AX|<@@ b`}<@A`K:Ap8apc860KA(:!xc``!qK#A(q:1:, @OKb,38(8c@ oKK8c8b8KA(8bx&|96(<868cx$脿|8*KA(8bK`~<@AX|<@@KbK`,@b@,@8KK `KB H"@PhpKTK`Kd| @Kp C tBrSsBrUsrPwdSetT>aA!|}&s !Q`A4 , @;`8ap`8~K/1`88ap8 WK$A(,#A@8 8^````!8cK$A(8 8^,#@~B", 8z8cz|cxc$|*A\s`A܈ , @b|}&aA!T>;;`;@8!8|xc$,$|*A pA b , @ xK `b| @ Xb , @ < 8;"08c#K%A(@8yH86x&x$|"|@*KA(c#K`Pb0|#@AX|#@@ b`bh"p0| @@88,>4Tx~@<,=@4bK]A((#@8wK1`,A ;`8ac$K5`,A H`8b@@H`H`,#A 4`w,>@ ,=A b,88(8c@ pw8bHo`w, A`,$@ ,>A ,A , A8 8b8c&8KYA(@HbH8b8c86x&x$|='|0*艿K A(8bK`BP~9@AX|9@@ b`h, @lbH`, @88bc&8x&|< KցA(8bK馕`AX|9@@ b`8b0c,#A\pAb , @8K颱`b| @b , @ 88b08KA(88b8cx&| x$|@*KՕA(8bK饩`0| @Ab0X|#@@ b`b0|#@A`8`:} 8@8!0|!AaN K顉`KK}`K| @K 8c&8b8KԩA(88b8cx&|<脿(KԁA(8bK餕`AX|9@@ K8c&8b8KAA(88b868cx&|<脢KA(8bK%`AX|9@@ b`K 8a8K#q`8bH|`H{`,#AP`w,>@ ,=Ab,88|8c`@w8bHk`w, A`,$@H,>A ,A, A88 8b8c&8KA(@HbH8b%868cx&y)$|=F|H*芿KұA(8bK`BP~9@AX|9@@ b`h, A8c&8b8KQA(88b868cx&|<脢K!A(8bK5`A X|9@@K8a88K!`8bVHz`8a86\Ke`8a88KU`88aԐKA(8c8x$| *K9`8Ki`,;Abd, A`p`Ab , @`b@, !Q,A,@hH` 08U8HI`8bx8LcH`H-`8`!x8!}aN 8`!xa8!N 8yA|KA(8@|zy@,@@H `8e 08H`88bx%cH=`Hu`88`8!}!AaN |ɮ, @cC8!}K8`8KEA(,#@A,(C# c(0~(K,@XH%`8q 08H`808bxcH]`H`8cC8!}K 8cC8!}K8}KA(8X@|zyA,$|AK,@Hy`8] 08H`88bxcH`H`Kp Arsecssfs_alloc||y`ab!Qx,A`d;Ahb@d(`y@|,@DH`8 08H)`88bxxcH`H`8ba8!}N {|#@A$`!c~{0`yA {|#@@;, ,@| ,X@@l| , A\b@,@H`8 08|HI`88bx *cH`H%`b,>0ccA@0K]A(cKQA(8!}aN (K!A(KbKb@,@K\b@Al,@H`8 08Hm`8d8bxcH`HQ`8b8!}N 8!N A rsecssfs_free;aA 0|!@;"x~(!Q,;A ``!|, ,@XA[H`88}He`(@8&DyF 8*H`H1`cc{0K}A({y@88!8`}!Aa(N 8&DyF 8*H}`H`K[H`88}H`(@K0~8!xa(8!N Arsecssfs_checkMemoryStateT`>b8(N @ rsecssfs_activateMemoryCheck`|}&aA!`a8!| aaA(8p!Ab 08c`!8c 8 C  (~ (,#Ab@,@\H`b 088cH`8bx8pcHM`H`08!}N 0px8!N ;8` 0;;`8888"Ke|zy@Db@~,@@Ha`b 08$8cH`8bx8pcH`H`,:@,=@,<@@P|8!} a!AaN cc 088K8!|} K 08c8K@|Kp 08c8KYK@ 08cC8KAK bKA(88` 088)8K|}y@\b@~,@H`b 08+8cH}`8bx8pcH)`Ha`K; ;::bKA(8c 0b`8h8pH-Y`:b 0`!8cCc|8HA(8cC8p|K]A(,# 0:@8`88>~8K|uy 0cC8CA8K:bKb@~,@H`b 08@8cHU`8bx8pcH`H9`Kl8,,/AAAx,@d;;~H,#A"y|@,8A ~K8` 08888|K|{yN@Pb@,@H`b 088cH}`8bx8pcH)`Ha`Kcc%K `8,8|ɮA" 0`!ccKA((# 08|@HcCKA(`ecccDKA(, 0cAccF`cg89pH1A(8~8p8||)KA(,# 08@8`88|8K8 0|xyA$~8K~;Kb@,@dH`b 088cH`8bx8pcH`H`K(8Kc`cf8h8pHAA(K8h`cccF8pHA(K8`8 0888K~|xy@Pb@,@H`b 088cHI`8bx8pcH`H-`K`KcCKA(`|yKA(8 08f|8`8-8K||yAP 0acF8H(`Hce| EN!A(Kb@~,@H`b 08h8cH]`8bx8pcH `HA`Kt, A,,A,Ap,@8b@,@K$Ha` 88bxcE 08cH `8H`Kb@,@KH`8bxcE 08cH`Hm`Kb@,@LH` 8bxcE 08?cHa`8H`K(b@,@PHU`b 08q8cH`8bxcE 08cHy`H`K;;K8;;K,A@8;Kx8;Kl8;K` C  hrsecssfs_trace`T>|aA`!!a`h8`px!AhpKmp`pA<,?A;,>AH 0b;@; W;h:{@!ar{F `A`~0,@0|i|8ax88B@<````!8ex| @A| @A88C 8ap| @88bA| 8@AXH%`,4@,88as88 |0H$`{d8sp} P8a8U>(|T>|+.@8`8;8x88K;Z;|:@A,=@D@8!0}!AaN  08]888x9$8`8(K@8!0}K;Z|:@@`K48as|ؠ88 H#`K8ap88H#`8as88H#`{d8ps} P8a8U>(|T>|+.@|K8ap88bH#Q`,4@hK<88ax8 8H#`ar~,@K` 08'8`88Kɓp@8!0}N @8!0}N A rsecssfs_hextrace!`e|x 08`8h88 ؐK-88e  xHU8!}N A`rsecssfs_APIFunctionEntry`;;;aA;`;@!aAb|}&N! , ANBH$,$" 0:A,D88`8K H80,5A(8S@88`8KH8x0K``v8x@K``r8xTK`8(6`t:D@ bHb8`8hKu8(2@ bHbE8`8KI8(4@ bHb8`8K, @8x0KyA(,#ALaxKA(88`8b8K`|axKeA(x8cHR`8xKA(,#ALaK1A(88`8b8K}`{aK A(8ccHR}`8x KA(,#ALaKA(88`8b8K!`zaKA(8cCHR!`8(<@ bHc8`8 K8(;@ bHce8`8TK8(:AcU8`8bK}H88`8KabHzy,A|cHzi,@LccHzY,@8 088(!18KM|zy@ 8; xp8H(=;; A 8\pAxH8Ax8ax89p||cgpH1`e,89^AP8(8;; 8`8 9={8 !p,)AFK܁H$FKqHhax\HX,:A\cC88QKe8c#8!}!AaN ,8AK88!c#}K Arsecssfs_getCHARforUTF8,%8@|)0@@pp@CaGAt|* @AL```! (AD 89'%|)0@@C|* @@8` N 8`N 88`N |* @A```! (Aܘ89'%|)0@@|' @@K89`#`A|' @At`!)( @@g9'#9'%|)0@@@|' @A,K'9'#9'%|)0@@ |' @AK8#|' @A``!(@8 99'%|)0@@C|* @AKĘ99'%|)0@@C|* @ApK%|)0@@dK @(RSecSSFsUtf8nToUcn|`8g 0``!a`;8 , ax8`AT`KMA(88e8`8 txK8!}N 8!K؄ Arsecssfs_FileClose`|aA`;@!;: 0!b;=a``!aKA(|vy;8ap@8,,AAH `,pDt@hpb?|t:K%A(`g8`~8 bbK=zUz.zH|P|e"H EA(KL:Apb?KA(`g8`~8 bbKzUz.zH|P|e"H A(K8?bKiA(`g8`8 DbK։,6;@xA\8xaK-xcC8!}!AaN cC8!}K,,A8bAX?KٕA(`g8`8 DbKյ,6;@x@0cC8!}K8?K=A(`g8`8 DbK]cC8!}K<8?bKA(`g8`8 bK cC8!}K88`?8 KcC8!}K A rsecssfs_FileOpen`8|aA!a8!A8axxKm8|~,@L;;b 0bB; ?:```!8ax8c(KܑA(,@;,,A8ap8,AH `xp:,bA8|tp(:dK!A(`g 08`~ib8 bbK9z`Uzc.zdH|P|e"H AA(K8b8mx(KֽA(`g8` 0cb8pK8;ax,#@a,#@a,#@L8!c}a!AaN 08 8Kmc8!}aK 088KEKt8KyK\;8xB@A H %A(,A|;A 8ax8 088c(K8,@(,&@x8` 0888$A8,x|g8` 09F8(Ka8;a,#Aax8c(KKl8a 88FKYA((#FA(Klb hlcp|2x|:x|#x|x|y@x, @l8a"8888K 8,A|~, @LK8a8H `88a:888K,A `~K8a8H `8axTU! A!xx@|ty*@,|Cxx|3x}@x|xH !A(`f8a 0828H}A(b 088,$84A8<8` 08898Ku;, @$K 08x8`88d(K98;a,#@KT|~,&@KD|88ahr K!c8 8FKAA(cH 5A(cK։A(8K A rsecssfs_lockSet|T>88!8appK},?`,AHap,#A$8Kyc8!}N c8!}N <`pApd(H A(,A<;p848` 08 9(K͑ap,#@h8!c}K8cOH A(apc(H yA(,@K Arsecssfs_lockRemove|;`~8!8appKx|},@T8xb 088apcKi 0x,|}@,&`8a8;@\8889c8` pK5x, AHp8\KUA((#\,A@aA;8up8` 08KxH`88n8` 08d pK˅xH ,#8 0@8`8KU888a8\8K8 098`8 pKxH|;8|p8`8АKxHP`HH8xapcKiap,#A@8Kc8!}N ,?@ap,#@c8!}K Arsecssfs_getKeyFromKeyfile|}&aA`a!a=;;`aA!!aȈa,#. AAx`8 08`8;X88KU|yyAcKh`88`80EK!W>c#8Kӱ=H``KǑA(`xx`d 0~P8`88;W88K|yy@8;`pH8xa8a9p|8x|8pK,A`;`{| p, A(8(8`8DKIHX`e88`8 FK%H488`8LEKc#8|PT>Kҍ|P=HA 8H`K]A(x`d|cP88`8 08 ;X8K|yyAA$: 8y bKg`HbKA(8xed||(P: 8a9qq8|8K%,A\;`{| q, A$F8(8`81KH`eF838`8 KH~Pc#8H `,A,8?`e;`8`8 VF>V>y V> 8|w: x$:d8`|(P`qT>bDH q`,A,8U`e;`8`8 8c#bbb'K,@\Vf>88c%8H `U88`8K c#b8Kϙ~=,<ALH(;`U88`8tKH;`,9AcDc#8K8cc8!|!A} a!AaN C0rsecssfs_getPayloadRecordDataFromApplicationData| ! T@.Tƀ|tT|;x}+x|x|8 | @@8`8!pN H\8!p}N Ah'rsecssfs_checkEncryptedPayloadIsCorrect|T>`~aAa=a\!;`;@; aaT>!, @,?@t8` 0c88;8K|yy@8;pap,#@8,9@8,:@L8!c}a!AaN 08cC8K c8!}aKc# 088KKh 088KK@c#cKa!`88`80KuW>c#8Ka88;#p,;AK8`8pc8pK}T{>,`@ 088`88@KpcKuA(Td>c8Kia8pKpp`A8 08%8`88hK8;pK88` 088*8KY|zyAccCK_`:,@a88u`d8| ```!88|0@C |2xW>|W>|8|+xcExb 8H `cCcKp`A@z |tTc@.TT|x|+x|x|(@488`8 cKA8;pK88`8`K; cC|b8cKə,?@\8`c888K|yyATcc#cK^M`a88;#pKX8c8pc8pKT{>8|pK8I8`8KAcCcK]`88v8cEb8H M`cCcKp`@`,@@T,@`@H8ax8@H `8a8x8@H Y`88`8h8K8;pK8o8`88KicCcK\`8,@88|8cEb8H i`cCcK9p`A8Kx8~8`8tK8;pKp8X8`8KcCcK\A`8,@88}8cEb8H `cCcKp`@K8g8`8tKM8;pK8A8`8tK!8;pK A 0rsecssfs_getPayloadApplicationDataFromRecordData|;`aA``!aa:T>; !q, a8@|;,9@<8!}!AaN 08 ]c#8K18!}!K8c|````!8c8|(@C cc|``!8c8|(@C |*y@ x, A8 08`88 8:KU(|yyA8c@D8KmA( 0|#@8 A$;8`8KK8  08`8Kc88Km8` 08 !8KW>8c#cK988at|H w`c888H `c88H  `,=@8`88H 1`8 ; 08`8 7;` @|0|2x@H|0}2x@4!|0|2x@ }&:x| 8@ }2x,8$A$ 08`8KK Kq8yz8Hcc$px@88|t|txтxтc9 9@K,`@p8`888b8 QK|h8,#AD@HPX`>h^p #(C0KH;K@c#c8H Q`KL A <rsecssfs_loopCallbackGetRecord;`|}&aA!a=;;`ap!aa0@p8`xc, @d|``!8c8|0@C c|```!88c|(@C |*yA~,?@@T|8!} a!AaN cc 08 8K 8!|} K 08 c8K@|Kha088K5A(08`H%A(,8Ah|K  0;8 8`8%8K58!|} Kp@, @9!p`~@9xHPXK,~`|A pKxx 08`88 8;V8K|{yb B`xN@p;K08`x :8VF>:`V>:V>tf\8V>x{ ; [A~i|48TB|!|48T`!~; g8 C 8{XK8{x;pKS)`8t8a|H q`c888H `b88H `x, @8`88H 1`c @8b0!;KA(8 (#8 8`A ;8&EKpKd8`E8&,Kccb8K9pK8cT>8H A`K< C rsecssfs_loopCallbackPutRecord;`|aA!<!`PA(0a8t`!a8KA(888`{8axK A(x(#|@8a\8}`| t!UT@.dA}Zx|2x8Kx})bx}kKy@UI|Cx| Kx,%}lSx| ;x}+Cx}Z[x|@YA@,8KiA((#a8@ěptKAA(Y~8|Pa880| 9p9!t^N!A(pat,#|c@<, A4a8KA(|#@A|Pa88|K5A(K8!}!AaN 8 08 b8`88@tK5}av8!!AaK8 09 [8`cf9$8pt'K}av8!!AaKP8 09@ P|Kx|Cx|x8`8t|8EcecKy}av8!!AaK8 08 G8`ce98 tK%}av8!!AaK9!ta89p~t8880| ^N!A(}av8!!AaK8 Arsecssfs_genericLooper;`} 0|aA! B8!a| 8x ```! |gҐx e8C 8ap 8|Ґ pK,x|{A,>@pap,#@8cc8!}!AaN 8Kȵcc8!}!AaK8xapcKap,#@K8x8ap8cKԹ;_px,|{@<8 8`,>8 8$@H8`X8$,K8 8`X8"\K;`x, AKPXKq8@8aH !`8a88@H`8a;!K=,x`{@8!8cK,,|{@d(a, @ xK(}08xKx@8 X8`8"\KxK Arsecssfs_getRecordAttempt`aA! | 08~$!1K; -;`_ ;>? 8`8%X: /: N, A<z```!KcK9`u<|t8`8%hbKy;{,@h8`8%e, @P,A0<KA8x'H gYA(8`<8%XK8 I<8`8%K 88~$bK8!}!AaN c8 "8`8$8K88~$8Ke8!}!AaN A RSecSSFsGetRecord|;8!a8appK9|~x,@P8x 088apcKЉpx,|~@, 8 9;8`8$A0"  K}x, AHt8g 88K,x|~@, Ap88 ;8`8 K xHl`Hd8xapcKΩ, A\8apc K΍ap,#AL8Kc8!}N ,?@, @ap,#@cK A$rsecssfs_checkForExistingBackupFiles($(A|, 0LDBAl,(A/%($A,%(AL(@|$(@@N 8`N AcT@.|`8T>|$@@8`N Äc8|$@@8`N 8|` P|`txтN @rsecssfs_looksLikeASN1b 0;`~adaA|!}&+ BkN`k8y, !Aa| 88!89|a}Ka`Gfb 0``!( |!y; b 0(9C ( N0|!ab 0(98c4|!ґ( (( K 08 8`;8HK~ , @ 0;@8 8`8dKpx@, AT8b 0cD8c4K98!|} !AaN {Kյ8b 0cD8c4KKbKA((#@A>(`z,9A0, A8`8NBab 08 H(A(|#@@D8 ; 0;@|f`8`8 4b8 KUpx@Kb8/K=A(,#A|#@A-8,9@88@($@<8 W 0;@8`8!pbcKpx@lK\Kp,xAH8|z, @$,?@ @8K(8cKK8xKApK{Kpx,@8ap8N1BKx,pA8|z`Kb 088x8gKx,@, @8 p 08`8!ԐKap 088x8"cKɅ,A88 p 0|z8`8"KpxK8 p8` 08"8Ke8a88@H `8a888@H`;A8aK,xAp`zKH8A (`8K|z,LPBA(, ApxK8 08`8"\K;@pxK|zpK~0KU8Tc>,#@D( @8 b 0;@8`c8"K5px@K( @P8 k 0;@8`8"8Kpx@Kp~KuA(@D(#@8 x 0;@8`8#TbcKpx@0K (#@8 0;@8`8#b8Kepx@K;@8 J 08`b8 K1px@K8KH, ANBKP8  0;@8`b88@Kpx@PK@ C PRSecSSFsPutRecord|`b8!| @Ap8 0`,#8A0Ka8 0c8KM8!}N c88 K)8!}N x8!N Arsecssfs_ProcessingInfoFree|8` 08 88 88!Ke|y88`8A\8@88 88K%8,#A< (088!}N c88 K8`8!}N ARSecSSFsPutRecordAPIGet||y!A,#@p ,#@,c 08 &8Ka8!}N 8 $ 08K=8 & 0c8K)8!}N Kq ,#A8 $ 08KKx8!N ARSecSSFsPutRecordAPIRelease|8` 08 88 788!KE.|y08`A\8@88 A88K8,#A< (088!}N c88 CK8`8!}N ARSecSSFsGetRecordAPIGet|!,#AH5-8!p}N 8!pN A0RSecSSFsGetRecordAPIRelease|8` 08888 {88!K,#(&A,8(, H8`8!}N ARSecSSFsConvertAPIGet|`b 08 8! ,#@ cK8!}N KY8 0c8K8!}N AtRSecSSFsConvertAPIRelease|}&aA`a:!``;; ;aAT>!!B 0, 889ahj B ȓaś{c `` `j||g|QfAx, @,~,8@@, @a,#@, @a,#@a,#@X8!:|} Aa!AaN 08Y8K8!:|} K 08V8KKd 08S8KK8c 08P8KK 08Lc8K@K 0:8`:88:88 K=|xy@; ~K8chKMA(|#@A88 0; 8`8K~KP:8a8t|H SQ`cӥ8bc88H `c88H A`,=@8`88H e`b 0C @AA|@|@|@|@|x,A48 0; 8`8K~KHyz8c<cc88px|t|txт\xтKe,A,`y@t('@9!a9KA`y,@y, @ d888`8b8K|~yN@ ; Kd`vb88;|\cfWF>:vW>8 W>~ ~``!; d8 C ;~8~ (0 (0K2`8a8t|H P`bc888H Q`b88H }`, @8`88H `bcA8AKuA((#A8E 0; 8`8K5KccT>8H `Kp(d8K 088`8K~KP8`b8b8K,#Ac`~cK11`0d8Kt|xK|cW>8H -`K Crsecssfs_loopCallbackConvert;|}&aA!`} 08!|  Bț8x ````! |f)Ґx d8C  N8~@|)ҐK }Kpx,A ;@|{,?@, @, @, @,:@pAP8 8~@cdK 0 *8! |} !AaN }KQ8 8~@cdKK8cCKA8 8~@cdK]Kz 8K-ApKXz8KApK8z8KApKz8xKApK;8apNB8KUx,A|{ApKKx,@N0NQ|+y@ D;@|+y@ ; :8p8`8Kxap888xcK),x@, @ 8`88ĐK1ap888xcK,A@8p|{8`8KApxK88`8Kap8xcKmapcKiA(,@-9AX8p8`8(Kiap888cK ,@, @8`88ĐKap888cK,A<8p|{8`8<KApxK88`8Kap8cKYapcKUA(,AP||8~hH A(;`8p8`8cKIApxKap888xcKx,@d, @TAap888cK,@, APap888c Kqp, A8 |{8`8KAp@ xK|aA`a<!;`8!Q 0| 9aX B`xd `!h |Ґhxd 9C ,>h |Ґhh@a,#@Ԉ, ,LFBA4cKA(`dcH`86a8K}a, @ ,#@<8!}!AaN H`8|4T~8!p}N A, isInitial|!aax0,#@$axHKiA(08,#A|H(KUA(axHKAA(08,#ATK1A(aHKA(8@,#ALK A(aHJA(@8!}N aHJA(8@,#@aHJA(@8!}N ARSecSSFsSetConfigurationbcN @ getRSecSSFsVersionb8N @%rsecssfs_disableEnvironmentEvaluation| 0!8`8088>88Khm,#8A$8 (H8`8!p}N AxRSecSSFsGenerateKeyAPIGet||y!A(,#@,#@p ,#@,c 08[8Kj8!}N 8Y 08Kj8[ 0c8Kj}8!}N 8V 08KjY ,#A8Y 08Kj=KKЕ,#@KTx8!N ARSecSSFsGenerateKeyAPIReleaseT?x| @A8 09A9 | 9@88B@B@T````!}c0Uk>}gX}eAy((}0y& 9)}?{U>}`}QT >8 C }c0Uk>}gX}eAy((}c0y& Ui>}'H}%QT >(|0T>| |A|08`T>| |Q@8`N 8`N 8`N @ HexEncodeBlob|`8aA 0!8~ (K{88,#AKkA(88`8;88Ke||y8;`@x8(8~ (cdKH;@KkuA(8cH`8xHt8axxK{`{,@D8`z8apH c`8888 9,A0;``e8`8 8 d;`,8`A &Klax,#AHgKj}A(`}8aKjmA(8`88;88Kc,#A 8`KyA(a8aH (A(`f88 ccH1A(8x8 88cHM`KiA((# @<8|e8`;`8 8 Kk ax,#AH88`8c,8@T8Kb,#A,8`|8c8H a`8,`eA,8`;`8 <Kj}ax,#A(H8aH م`8ac8H `88aH `cKhA(|e8a8#cH`8aH %`KhA(8Te>8aH ۅ`8ac8H q`88aH a`[ ax,#AXHL;`ax,#ADH88 ;`8 Kiqax,#AHax,#A 8K8(8~ (cdK8!p}AaN ApRSecSSFsGenerateKey`c|,#!q@h8,$AL(;( @h; 0|d*,#@ ;;|=@@D|d*,#A88kKc;(;8|=@@|d*,#@K` 08n8KcE,#@ ,#@8c 08v8Kc8!}N 08t8Kbc 08v8Kb8!}K 08q8Kb ,#Ap 08t8KbK,#@K@K8|#yAK A%RSecSSFsListRecordsAPIRelease@AF61_44|`}``!8aH `8ac8H e`88a8H Q`8 (>A| @@88} ||P8aT>H `8a8pH `p} |@atx||@0a||| @|@<|||`(||4T~ 8!}N ||`|||4T~K|K8p8aH U`p} |@KHW>8 8aH -`8 | @@K A/rsecssfs_checkEncryptedPayloadIsCorrect@AF62_23|`~(!c, ,@4@$, ,@@~0,#@ |3yAhf,#@D8 l 0`8K_8 n 0c8K_8!}N 8 j 08K_ Kc 08 n8K_q8!}N 8H`8 e 0~08K_9 |3yAKDcKbA(`dcH`8 ` 0~8K^(, AKKE(, @K Ap#RSecSSFsGetRecordAPIRelease@AF63_37x 8e8`N @(CTrcSetOutputMethodT?(0@f8`N H` @$CTrcSetContextInfoHook|8!A(a8 ,8!AHA(`d8 ,f| FN!A(8!}N ACTrcIPrintfOutputFuncT>H@|!q, axA ( @,&P@pax88HM` ( @, 8`HQc8!}N  8`H)c8!}N 88H8 @ CTrcLastComp|`@`Tc>T>H!q|48T,&@HxP;8 , A,, A ,@KUEA({.8|dj08`K!8H888 x.}"hjHj08hj0,$M@Hj4j8j@HH8`8!}8N j4j8j@HH8`8!}8K`P;8c8hK`iA(8`8!}N 8gK`9A(8`8!}N ,@HK1P88~PHbH8c HqK88`8!}K88`x8!N A0 CTrcINewCompTc>8K @ CTrcNewComp|`8/!qaxKVA(,#P`A08b`8 8H`8!}N 8 b`8xH`8!}N ACTrcSaveLocation|!a8`88!AHU8!p}N APDpTrcErrH8|,#;aA8j0 !aA(x.|A8 |# @@8P;@|PbX|.t|`;C`! ; ,$@8;|?@A8!}AaN },|@4@`d| DN!A(;|?@@K|K8{HK}|@K8!N `| @@K AT CTrcCallHookHT>|`!a, axA@,A8bxP8c8hK\A(8`8!}N 8,'P88@axK||y@$c8!}N 8;x.8`"j0j4j8j@Ky}jH<8}j0`8!}jHjH(jHjHjH N ax8|?@@` |P|.tx.||?@|x.@<8!|d}j0j4j8N }8!}}}K A CTrcTransHdl2`,#@8|!a@\,@4Km8 bHP8dc K-8K8`8!}N 8j0H|#(@@ x.|*|#(@A,@K88x8p8xpK5b@p,$@@,@|K8 P~ 8Ky8K-KL88`8!}K< A<CTrcThrSetTraceLevelbH8N @CTrcThrResetTrace@8|,#!q@`,@4K8 bHP8dc Km8K!8`8!}N 8j0H|#@@D |P|.t|x.|x.|#@@ BjHy@\,@K 8P} 8K8K8`8!}N ~x,#8A|#@A, @ @@9,(AP,@(K8P8PKY84cK KI8`8!}N f8`8!}K , A,#A4c|dyA(8c(#A``dK8`KH K , A`8@@ x.|"|> @@,b@c|A`dKHb@cdK0Kp`AK( A, CTrcGetParam``H|}&aA!!Q, a!AA<`888| ;j0| ~?@@ x.|?(@A ? @@p8@ATA8`@X x.||?0@@8`,#@Ad,@(Ka8dP8~PK8cKK8`p8!|} N |xP8|`.t|x.|2|fj@K8`8!|} !AaN ,@`K8 P~ 8K]8K8`p8!|} K0ad,@K9c;@ P8̓EK; b #K뭀,@Kc Pce8ГFKb #Ku,@KP c8̓EKb #KA@T x.|`|?@@@|P|.t|cx`.||`dj4KI8`8!|} K8`|K!8`8!|} K\@KKyp`AK CX CTrcSetParam`bH|aA``! !A, AX, ALT>`pA;{Z`,&@l,;Ab@,?@c,b@@x,@`@P,@H8`K8`8!}!AaN HyK`@K,@@K@KP8c8@K?A(,@p,:@@bH8c ,@L,8| 8dj4cB@(```!A8 8c cC A8 ;;@8cKB9A(,#8A48`|@{:|A,?K|{KcbKAA(,#8A:c|@K8`|@K; ;KT,:b8@;Cj0````!: ;Z c#K>A(Td>cKAiA(,#8A08`|@{:|AK0`{Kcc$KA!A(,#8zA8`|@K|@K;Cj0,@cc````! ;Z bK=A(Td>cK@A(,#8A08|@{:|AKp|KcbK@aA(c,#A:|@K|@K; ;K`8`8!}!AaN bH,K\b88;#P8cPHM<K;Kp A  CTrcSwitch,P@ 8e@N T>Hg @ CTrcActCompsH|@P8D !,<cA, AKQ8ap , A|8KU`ec8lK%, @4 K@A(8`8!p}N 8`8!p}K8K`ec8lKG=A(, A8`8!p}KKGA(8ap, AK48`PX`h8!pN AT CTrcPrintAct|9|9 |9@|HD @ CTrcPrintPgmHeader|``aA`a!a;aZ!1`8p88K,<b 8pt,ÀcA8` aaA$8Pc8, ATK,;aA$8P, A8,cfKa, A8P8D8X8@K׵a, A8P8pK׍a, AL8P8Kea, A 8P8K=&a, A8P8KHaP9FT0, ,1A`8A``8889 9)K,:A,a, A8PcF8K֑b, AK>A(`fPc88$K]a, Ad8P88K9b, A48`8!}!AaN aK A(`fPc88$KCAA(KP8PcF8KC%A(K8`A`8889 9)KBA(K8P8KBA(K48P8KBA(K8P8KBA(K8P8pKBA(Kt8P8D8X8@KBuA(K,`cf8,KB]A(KP8KBIA(K8`8!}!AaKKL A@CTrcPrintPgmHeaderExt2|9@|||Kl @CTrcPrintPgmHeaderExt|;8H88j0!a8p8|#@@ |P|.ty.|}(x.|#H@@Ka | @@88,? @Hx8|#@A, @ K:1A(8`8!}N Hixa8|#@AK,?AKKa | @@K` A CTrcFileClose|8!,#8 |@LFAKD=A(8!p}N 8!pN ADCTrcIFreeThrAdm|!q88p8K)xa8|#@A, A8`8!}N 88K%A(a8c.H AA(|c4T`~|`|xx8|K A CTrcFileTrunc||yb8`!AT8j0|?0@@H8jH|P|.t| x.x.|2|8@@p,>|d(*``,AHA4~c(#@ He 8!}N c(#@K8`K),>AK<bH8d0|?@@0 cc P, x.}2AD8xKY,>@c8!}Kt8c8!}KX8xK=A(,>A8c8!}K(,$bx8`d@px8c8!N 8dxp8!N ACTrcIFp|``8!q8pK}pat~8!}N AP CTrcTransHdl|``!KإbH88j0|?@@L |`P|f.tx.||?@|fxf.@(|d2j8|,@8j8Hj8K8`8!}N ACTrcChangeHdlIndent|``!KbH88j0|?@@Xc 8j8|P|.txc.||?@|x.@0px|1.K8`8!}N K8`8!}N ACTrcSetHdlIndent|`!Kb8H8cj8 8,@0| ``! ||p|| x 8c C KA8`8!}N A|CTrcChangeGlobalIndent|`!K-pb8Hx8cj8 8,@$|````! 8c C Kօ8`8!}N AxCTrcSetGlobalIndent|``!Keb8vHx(K8`8!}N AXDpTrcSetFileSizeHook|!KbH(Kec8!}N A8DpTrcGetFileSize|!Kub88H8(K8`8!p}N A@DpTrcRmFileSizeHook|`!aaxK;88P, axA`, A8p, A8, A8, A8, A8, A8, Al8, AT8 , A<8 , A$8 , A 8 , A8  , A80, A8@, A8P, A;`, A8; p, A8;0, A8;@, A8;P, A8;`, A8;p, A8;, A8;, A|8;, Ah8;, AT8;, A@8 ;, A,80;, A8@;, @ , @(K58`8!}N HiA(|dPXK8`8!}N 8;K;K;K;K|;Kt;Kl;Kd;K\;KT;pKL;`KD;PK<;@K4;0K,; K$8;K APDpTrcAddPattern|``a;;!aKQ8`8P,$A(;`,8A ;;8`H ;`88`,$AT>|@@ |*W>b8p, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8 , A$8|@T>@{$8T>|*b80, A$8|@T>@{$8T>|*b8@, A$8|@T>@{$8T>|*b8P, A$8|@T>@{$8T>|*b8`, A$8|@T>@{$8T>|*b8p, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8, A$8|@T>@{$8T>|*b8 , A$8|@T>@{$8T>|*b80, A$8|@T>@{$8T>|*b8@, A8|@T>@ {$|*Kcc8!}aN A\DpTrcGetPatterns|a!QaxKɽ;b8;;@;cXxyA(K"`;,A@(? ;{;AK8`8!}aN cK1AA(8, ccA(? ;{;@KhB@4`!, A88cC , A8K0 A4DpTrcRmPattern|!Kq8P,#AK0]A(8PX`,#AK0=A(8`hp,#AK0A(8px,#AK/A(8,#AK/A(8,#AK/A(8,#AK/A(8,#AK/}A(8,#AK/]A(8,#AK/=A(8,#AK/A(8,#AK.A(8,#AK.A(8 ,#AK.A(8 (0,#AK.A(808@,#AK.}A(8@HP,#AK.]A(8PX`,#AK.=A(8`hp,#AK.A(8px,#AK-A(8,#AK-A(8,#AK-A(8,#AK-A(8,#AK-}A(8,#AK-]A(8,#AK-=A(8,#AK-A(8,#AK,A(8,#AK,A(8 ,#AK,A(8 (0,#AK,A(808@,#AK,}A(8@HK 8`8!}N A4DpTrcRmAllPattern|`8a``!`8axK) `8ax;H(y`8pP8ax8Ha`8||yAcK `,?,@X8`A(@8!0}N 8`@8!0}aN c8K`,8`@ 88pH`||yAc8( @H}!A(c`{|8( @``!;d88( AH} A(,A,<A88`{|Ud8p, K,M/ m/k@`H`,?,@A8K8 K`,?|`4T~A8K{|@KAA8`@8!0}K{|UdKx8`88pH`||yAK0H|A(,AK8`@8!0}N ACTrcGetLoggingInfo8K< @CTrcFpbcN @ CTrcGetOutputFunc|!q88p8K)pv8`, A|8!}N AD CTrcCompLev|8!a8p8K˝tap,,LFBA\}KA(|~ya@hP8, A$K)8!}N P8K#A(8!}N cKA((#ADaP, 8@P8K#5A(8!}N 8acHz`8Pa, A(8KQ8!}N 8K"A(8!}N 8!}N Aperrno8H< @ DpTrcTime|aA`!!8p88xA(Ka;|ax;,,LFBA,,@8a8@8`K$A(8p|+yA, Aa|#Apea8a8BH,$@(H}]`88@s`8 8 x9 ;|*,;*-`z,d/@8 8` A;*0*,9 *-|*/a';@t"P,?8aA(8@cF8PH9aA(8J+,@c 8d| P8, c@8 9lHFY`,@P|P|cc||3yAf| FN!A(, A8@8!0}!AaN aKA(@8!0}!AK8KA(KcCHEA(8J+c%`fc|P8xHEe`,@\K c|H K8 8*,@KlcxA`KL@8!0}AaN @8!0|aN |#AdKdK"eA(<p,P`@\a9&B@8,'|}SA`$Aa,)|HAHd @|P||#`APDd Hay| |>tK&|# | P@||$`AfyH| |>tK@8!0}aN Ad DpITrcTime8K\ @DpTrcTimeNoThr88`N @DpITrcGetThrNo|!,#AT,@L8889||8|}cHh}#H,) AD8| A| A 8!pN ||P|c*H`8!p}N | }#P, @T@P9eaI8|9}&H| , @@(`!8}&P| |9, @hA8| @dK4 A DpCompSpace`|}&aA!`!88A(8xaK, Ab c|A xbHc,A axc| A P MA ,8aPx(@888 ;;*,;_*,|A8apH< 8 |dp| ,A@ 8 bH;_*-;*,8pr8z88Hsm`8|PZA0,,AxAea, AP8 F88PK], A8 8!|} AaN aKA( 8!|} AaN P8 F88PKYA(Kh8J+cC|P8H ,A888c|c4J+8cT}ac!|,9~PaLJBAB|3yAhccdf| FN!A(,=@(Ha, A P8K, AP,$A;P```!cH-pdAPa, AP8hK|+yA$ae| EN!A(;,$@8`KYA(H(, @xx, A(,$A8 |#@e(, @a8c.HA(,@dbHc(| @Pa|,$A|P8K|+yA$ae| EN!A( 8!|} !AaN P8KA(KH`8 |#@Hd`KP8hKA(KpaKA(KP8KA(Kccd8KA(K8H|z|Pc8 HaA(,#A0B`v@"```!88|Pc:b|%@|0@At@, Ad|3yADf| FN!A(;a|3y,| PA\8ap8Af| FN!A(8ac|3yAf| FN!A(8a8'K`d8a|3yAPf| FN!A(ca8 ceH A(|vy@Ћ!bH#K8KA(K8KA(Kp8KA(K,8KA(K8bH!bH#K|``!88|Pc;c|%@|0@A@, A|3yAf| FN!A(;a,#xPaAh|3yA8ap8f| FN!A(|3yAL8ac$f| FN!A(ac8 ceHA(|vy@ K|8ac$8KeA(aK8ap88KEA(Kt8K1A(KBbH#Ka, AP8 8\8PK9KP8 8\8PKA(K8J+8J,|P8H,A088cC|4j+88J,THj`KHa, A(P8 288PK, @@KpP8 288PKA(K|cCKZK@AK;;K aK﹈, Ka 8!}N C  DpITrc|!a8`88!AK8!p}N AP DpTrcNoThr``88K0 @DpTrcVar``88K @ DpTrcNoThrVar|!a8`88!AK8!p}N APDpTrcA7|!a8`88!AK8!p}N AP DpTrcNoThrA7``88K @ DpTrcVarA7``88Kp @DpTrcNoThrVarA7``88K0 @ DpTrcA7Fmt|!a8`88!AK8!p}N AP DpTrcNoTi|!a8`88!AKE8!p}N APDpTrcNoTiNoThr``88K @ DpTrcNoTiVar``88K @DpTrcNoTiNoThrVar|!a8`88!AKE8!p}N AP DpTrcNoTiA7|!a8`88!AK8!p}N APDpTrcNoTiNoThrA7``88Kp @DpTrcNoTiVarA7``88K0 @DpTrcNoTiNoThrVarA7|``!HmA(|#@,AL8@$8`8!}N ~8`8!}N 88`8!}K ADpTrcVSprintfU|``!HحA(|#@,AL8@$8`8!}N ~8`8!}N 88`8!}K A DpTrcVSprintf|``!qKA(`}cKA(, *A, ?A,%A, AT8```!, A88, *@``!8c, A8, *AK|=@Ah|%A ;, AL~| @cc88H%,@D;, A~| AK8`8!}N 8`8!}N cc88H%Tc>8!}N ADpTrcStringMatch|}&aA!``!8x8A( 8pa Kx, A|,@PH, Aap d|A ;(, @` NAD88 x;*,, A$8` ;]*/8*,}*-,@88z| 8 ```!8cC xZ|(PA;}J+|P@cCH`]`KA(Z,,A8A%a, AhP8 88PKM, @aKA( |8! } !AaN P8 88PKyA(Ka KA((#Aa, AXP8|P@|P($P@,x, A8` z;Z,@08z| 8 ``!8cC x@A|P|P8~|$@At($AH|3yA`cf| FN!A(,9@$a, AP8K5P,$A;PP```!cKmpdaAH, Ad8hKa |+yA e| EN!A(;,$@, Ad  |Kl8hKA(KP8KA(K<c`8K A(KcCP8fH)`a||PK8cCcKI`^|P|PKp|cCK]Z|P|PK@K8`P`z8 8H)i`aCJ+Ka, AP8 8\8PKK8P8 8\8PKA(KP8Q`8` @8f| FN!A(@8!0}N @8!0}N  (8!0N AD DpSLogErrHf8@HN @ CTrcHookRslgH!||A(8|+yA,e| EN!A(8!p}N 8!pN ATCTrcRslgw1param``|aAT>;!T>!Q`!~,#,*A@|;/#?,;A$A,\A,9@~;L,#A@H|#;@ ;K8`8!}!AaN KA(`zccKA(|@;;KDAK;c8, ADcc&``!Kpe8c@ ;cc&, ALK8`8!}!AaKD@ K,=@Ј8!|txт}K ADpTrcPatternMatch8`N @ CTrcSignal8pdN @ CTrcSetHidingN @ CTrcProcExitHePXN @DpTrcSetCriticalSectionHook`;;;aA!`H|b8d!A,@X;@;#j4````! ;9 ;,,AtyA@;Zc;|!|A|P8,|A|P,A||P,@~|;@Pcc8P8f , AKo8`8!p}N P8K!A(8`8!p}N AlCTrcSetContextInfoHook@AF119_2@A( L| N ||#y!``da!AAH88`p8pHQ`,|cA |#@A8`8!}N 8`x8!N A sprintf_sU16,$@ 8`N HP @ vsprintf_sU16|`~|#y!aa!AA8p8`8pcHE`,|cAD{|#@@8!}N 888!}|#.K{888!}|#.K8`8!N A snprintf_sU16,$@ 8`N H @vsnprintf_sU16|`|#y!a8!AAxcHA(,|cA@8|>@@|, A88`|8!}N 888`8!}|K8`px8!N A sprintf_sRFB,$@ 8`N H @ vsprintf_sRFB`|#y|!a8!AAhcHAA(,8@(8|!8!}N |c8|#@A8!|!}K8`px8!N A snprintf_sRFB,$@ 8`N H0 @vsnprintf_sRFB|``!HMA(|#@,@$88|!8!}H88@8!}N 8!|!}N Avsnprintf_sRFB@AF9_8|``!HA(,8A<|#@8@|,%A 8`|8!}N 888`8!}|K Avsprintf_sRFB@AF10_6|`~8````!q8ppcH-`|#@,@${88|#.8!}H{8@8!}N 88!}|#.N Avsnprintf_sU16@AF11_4|``d`8``!8ppHU`|#@,@8`8!}H@8!}N Alvsprintf_sU16@AF12_2,,$A$,%@88`N 8`N A ,&A4,$@ ,&@,%@K`8 8`N 8`N @t checkArgs|```!1aK5,@T8ap9H`8apHE``8apH`8!}N 8!}N A vvfprintfU16aK< @vvfprintf_sU16|!``8p88pK8!}N A8 vfprintfU16x``d8fXK @ vprintfU16!|a8!AK|c8!p}N AH printfU16!|a8!AK|c8!p}N AH fprintfU16|!``8p`d8`8pK98!}N A< vsprintfU16!|a8!AKq|c8!p}N AH sprintfU16|!`a`d8``8KQ8!p}N AD vsnprintfU16!|a8!AKQ|c8!p}N AH snprintfU16|`|a`a=!qHU`( c48T08!}N ApFormattedOutputCtor|!H`8!p}N A$FormattedOutputXtor8,$M 8|&(@9AH|&8@8@}x|.N 80,&A}x|.N `}x|.N N @!OutputStream_writeNullTermination|}&aA`!!c H=`;~;(#@ ;`{;@; :;, A``!|dHM:2, |Ac~H`.|}A|8C9"|@8apL1AHF` 8ap 8(x|2HH1`8(.AH98apHJ`c28apHMa``|,c.AH`,A\8apHF`,<@ |<@{@ |., @cH`,@|cK@Hc P J8! @|} !AaN cH `|c P J8! @|} K@K| @A,|#@A ;K;cK;|}KcH`,A8K|PcH`.|}K C FormattedOutput_parse|`;8%!H`|P,#A|t|c;8!}N A\FormattedOutput_findNextSpec8N @OutputStreamCtorN @OutputStreamXtor|t8xN @OutputStream_isFileOutputStream|!T>|, @HA|c8!p}N Hi|c8!p}N APOutputStream_writeSingleChar|`89!8pa8a8H `(#8`@ 88!}H8`8!}N A"OutputStream_writeSingleCharToFile8/|&@|0PAXx8,,A A,@ |+.88`N 8`N 88`N x|+.88`N @$OutputStream_writeSingleCharToString|T>,;|!Q,@|ax@H9 ca````!K9),A<axca|)@A8!}N 8!}N a@;c`!K,;Aac|=@A8!}K AOutputStream_writeMultipleChar|}&`}*%`!a, xA|ax@8>H`,A@cxcH`8!|} N 8`8!|} K|HI`@`~ax8>Hm`,@;}8K| COutputStream_writeString|```8!q8pH `|#@@$|"8!}H8`8!}N AxOutputStream_writeStringToFile``|c8(P8!q|%@A,(/@@|>@xfAh{@@|`2KW`c|c|8!}N c|`2{KV`K@ K{|`2KV`c|cK;@|K|{xc|`KVQ`8!|}KT AD OutputStream_writeStringToStringcN @OutputStream_getMaxLengthcN @OutputStream_getWrittenChars||p`!QAx`pe|f6p|cfpxc @`q`;ap;;pap```!HA(,;A<|=@@|;Kc8!}N 8`8!}K`cap`rx;`caqKP;apKD Aputc_unlockedU168`N @fputcU|``!qxH A(xKU`axHA(8!}N AXfputcU168`N @fputsU|!aa`HIA(aH`8p8`da9H,`pA,aH-A(8!}N aHA(8!}N AfputsU16``aA!|)!@p,'@H8`8!}!AaN 88`8!N ac;@;#:p:;((@:@:,,6/@``/T>xc x ,,@p:pT>`!H!A(,AP;|8@@w:KV;{(;AX,>A^|P|`K|P|`K,@ ,>Z@|P|`K8`8!}K@ `K@@<``K4/,@4`TѾpqT`>`f`gx x ,@K`TѾ@TѾpr`T`>pqK A hfwrite_unlockedU168`N @putsU|x!aa8~XHA(aH`88X`da98pK,|@08~XHmA(c8!}N 8b8p8X8p8c<9Kup||,@8~XH A(8`8!}N AputsU16!Q|ax`HeA(9axKaaHaA(}a8!N AlfwriteU16_impl8K\ @ fwriteU16K @ u16_fwriteU16K @ u16_fwriteUhA( L| N pA( L| N xA( L| N 8`N @strlenU`dp`AD`f8p,AA(``!88p,Ah@8PX`!8%8|}(:8}09Ay'y(y  A`U',*U(>A<,'A ,(@| P|t|`8cN | P|t|`8cN | P|t|`8cN | P|t|`8cN @ strlenU16x,`f`AT`~AB, ``AX88p`e,AA,``!888p,Ap@xT`@|,(A@} 88B@$``!8, A,8C , A`N |0P|t|`8cK8*PJX}hJ} Z8}kP9A4y y yk A8U ,+U>A,,A,(A`(%A98}hB@```!Jyl9}}8}_9y~U}A,,,{ Uk>A,?A,=Ap,+A$8hC yh}+J}iJ8ylx$}IH9Ujy A(,(Uh>Al,)AD,*A,(A|pAKp|0P|t|`8cK|0P|t|`8cK||0P|t|`8cK\8*PJX}hJ} Z8}kP9AK|8`N @ strnlenU16x,`f`AT`~A, AP88p`e,AA(`!888p,A@xAP`(B8y *HJ@}R} b8}H9Aly ,+y y A,+yD y yk A,,U A,+U A,,U .A`,+U>A@,,A$,(A9e`A}i````!8h9y}R}~b8},9Aly~,?{̂ yA@,,{D y~{ A,,UlU~A,?U.A,,Uk>A,>A,?A|,+A`C xx$|p8A8| 8B@ `!8, A(8C , A`N |c0P8cN |c0P8cN |c0P8cN |c0P8cN |c0P8cN |c0P8cN |c0P8cN |c0P8cN 8`N @ strnlenRFB8`N @strcatU`e8, A$```!88, @88`!88, @N @\ strcatU16|``!Kec|# @8Ax|,$A$```!8c8,$@8e888|#@@,`!e8|&@d88,A,A88!8`"}N 8`8!}N 8`"8!}N A strcat_sU16|``!K8|# @cA|*,$A(````!88c,$@88c88|$@@,`!8|&@8c8,A,A88!8`"}N 8`8!}N 8`"8!}N A strcat_sRFB8`N @strchrUx 8``!8|,%M 8c@8`N @4 strchrU168`N @strcmpU88c88c|#,A0@,``!f88,#|AA|P|N @\ strcmpU168`N @strcpyU`e|P|tT~88}q@09, A`88p`h,M ````!8A(88p9,@N 88XP````!8y }H:} R8| X9@88Ky ,)U yI AHU >,)A0,+A,*@N y"8N y"N 8N ````!88, @N @l strcpyU16x,`gA}PA@T~}t}q@9%, A88`hp)#,A4`!88A<88p,9@8`N x@hpAP8,$88,AA,`!8,$88,A@88`"KHPhX}R|B8}h@9Axx T Ay( T >AX,,``8A (,)A8Aa8|8B@p````!Rx|88}9xA0{ ,=TT>A,<A,?A,>A| 9)8C x$|R|*8|Bx }h898A4x,*y T A,(T >Ah,*A<,+A |bpAK\8`N x"8`gN x"8`N 8`gN `(&`88A`KHPhX}R|B8}h@9AK @, strcpy_sU16x,`gA}PAT~q@9, A88pH`hC,A@````!88A<88p,9@8`N xAh``b8(y KHk@Z}8}_9Aly,,{ yA|,,{D y y AH,?UA,,U A,?U.A,,U >A,?AT,,A089Aa%` } ```!8 9Zy}8}_9Aly,>{ yA,?{D y{ A,?UUAd,=U.A8,>U>A,?A,=A,>A8C px$|J|pAP8,$88,AXA,`!8,$88,A0@88`"K 8`N y"8`U>gN y"U>g8`N y"8`gN y"8`N y 8`gN y 8`N 8`gN @ strcpy_sRFB8`N @strcspnU8, A<8```!8|,'A@8, @`N @P strcspnU168`N @strdupU|!qaxKmx8KA(,#@8`8!}H(ax8K6]`}a8!N Ap strdupU168`N @strncatU8``,A$```!88c,@9#(%Ap,&A ,&A8x9F,(A,A(*@9}IB@X``!8c,'A,'A,'A,'Ap9C 8c,'ATx$TH|J(,*|"CA0,&A ,&AA8`g`N 8d`|`!8c8,&AC x|K8T(%AKa'(%AAK @ strncatU16|````!qK| P|#@A|< @@8,A$```!8c;,@8(<A},#A},#A8{8,%Aܠ,A(&@(8|B@X``!;,$A,$A,$A|,$Al8C ,$ATxc$W |(,'A0 , A , AA088`8!}N 8}````!8c8, AC {|K;W(<AK`(<AA|KpcK|$@A88`"8!}K\8`"8!}KH Ap strncat_sU16|````!qK| P|#@A|< @@8,A$```!8c;,@8(<A},#A},#A8{8c,%A܈,A(#@$8|iB@X``!;,$Ae,#Ae,#A|e,#Al8C ,$AT{dW|(,'A0, A , AA088`8!}N 8}````!8c8, AC |"K;W(<AK`(<AAKtcK|$@A88`"8!}K`8`"8!}KL Al strncat_sRFB8`N @strncmpU8(%A, |A\@X, |AD@@, |A,@(x`iD9f8c, |A`8@a'(+a}i@``!a9`8, AH| P@Ԡ, AH| P@, AH| P@|H, |PL3BAXC x$T|dJ(%|b@<8c8|``!8cD8, |L3BAC | P|N  |P|N  |P|N |P|N T(%@Kt9@(%@Kd @ strncmpU168`N @strncpyUp(8A08,A,A8,A̡DxC(`/*88A`jA88|9iB@p````!9J,$Ah8,$AT8,$A@8,$A9k8C 9J,$A y$8,&,|JA+8*,A8+*,A|M 8,&889M ``!8, A$8,%98@N 88($L 8|``!8C K|8P|t||(P($M 88($L K|8P|t||(P($@N M K(`gK`K @D strncpyU168,&| @@Ax|P|tAT~|p@8, Ap88p'`g#,A4`!8c8A888p,8@8`N xAP``i8(x HXhP}Z|B8}P9A4x,,y T A,(T>A,,A,(Apa(98cA8}B@p````!}Zx|b88hP9xA0{ ,>T T>Ad,=A@,,A,?A98C x$|`Z|8|:x |gP98hA4x,+x T A,'T >A,*A,+A|dJpAd888c,89, Al```!8A(88c9, ,A8K88`N 8`N x"88`N x"8`N 88`N |#yAK @ strncpy_sU168,&| @@Ax|PT~AT~,'@, 8At88p`g,A8``!8c8A888p,8@8`N xAl``hB8(x*HJ@}R|b8}H9Alx,+y xA,+yD xyk Ad,,TA4,+TA ,,T.A,+T>A,,Ax,+AX8c8Aa` |````!8e9k}Rx|b8H9Alx,?{̂ xA,,{D x{ A,,TTA|,>T.AT,?T>A$,,A,>A,?A8C px$|dB|pAh888c,89, AP````!8A(88c9, ,AK88`N 8`N x"8T>8`Kx"T>8`N x"88`N x"8`N x 88`N x 8`N 88`N |#yAKl @ strncpy_sRFB8`N @strpbrkU, AH8`d```!8|,'M @8c, @8`N 8`N @X strpbrkU168`N @strrchrU88x `!8(L& @``8c@`N 8cAK @H strrchrU168`N @strspnU8, Al, AX8c``|'A(```!8,(|@A @,(A8,&@`N 8`N @ strspnU168`N @strstrU, A,8`f8c| (,AA$`!88c,%|(A@蠤,%A8,&A|%0@8D|*8@`99c,*```!AG&,*|H@A|'aFaf99k,)|PAAT`f,'A 8c| 8A`8f,&@ 8`N |&A@`f,'AKN ,*AK8cK @L strstrU168`N @strtokUB(#!q|x@*a#K=xd|i"| "., @8`8!}N xaK,#8A$8}a8!Ka8Kja8!}K`iKxd|i"| "., AxK A strtokU168`N @ strtok_rU|!|jy`x@E}CSyAKxh|jB| B., APxK],#8A$88!}|jBN |jB 8!}N 8`8!}iN 88`8!N aCKaxh|jB| B., @l8`8!}iK A strtok_rU16|`|~y!ax@yAH-A(|, AtxcH5A(,#8A088!}cN c8!}N 8`8!}N 88`8!N cHeA(|, @<8`8!}K A( strtok_rRFBA( L| N A( L| N |`!H m`8Ha`8$HU`84HI`8@H`8clh8!}N ApOutputConversionCtor|`!H `8H`8$H`84H`8@H}`8lh8!}N AlOutputConversionXtorN @OutputConversion_setArgs|``}a!Q,-, +xA;A , ,#L3A;`8`|.8(@,%*A,%.AL/%j,%lA,%L,hL3OFӂA8(@8(@|8(@p/a,%iA,%%,A/%XL3OFӂOAH T>c8x8DHH`8`8!}aN 8}@`Hm`88!|c}K,s/%u/xL3OFӂOAKt{`8}4|H`{c|.K,t/%z8L3OFӂA(@pK88}$x|x|H`||;{c|.,%l/%jAK8}xH q`{c|.,%.AKLH -``|{c||.8(@K, 0LFBAK ApOutputConversion_parse|`~!axH %``8~$Hu``f8~@84xHy`8~@H`a,#AK9``8~@H0i`,A48~H `,8~@HA`l||Pp8~@H0%`,c@H q`, a@8>Kӵ`,aAl8@Kӝ`,8~@ATH)`T`>8~@, xApH`T`>8~@, XAXH`T`>~r, o@$8p8!}N ~p8!}N ~p8!8p}K8~@H`T`>, uA8~@Hm`T`>, xA8~@HU`T`>, XA8~@H`88-,@hlKdcH`,8@8`+l~hKK`,cAx 8@KХ`,8@A\H1`T`>8@, x80@axcK``{axc8xKu`C,[AcH`,A,=8@ApH`T`>axc, c@K`,AcH`,ax@$r8 cK!`,A8|8!} AaN |c8!|} K|{cc|KccK`,AK@cH`,LJBAaxr80cK]`,@KH`T`>8@, X80@@axcK``{axc8XK`C,[A, oA A K8ax80cK``z|{.KcH)`|,8 axLJBAcrK`,`~@K`axK`a8!}8`N C OutputConversion_output8N @OutputFlagsCtorN @OutputFlagsXtor8N @ %OutputFlags_switchOnLeftJustifiedFlag8N @ &OutputFlags_switchOnSignConversionFlag8N @ OutputFlags_switchOnSpaceFlag8 N @ 'OutputFlags_switchOnAlternativeFormFlag8N @ OutputFlags_switchOnZeroFlagcN @OutputFlags_isLeftJustifiedFlagcN @ OutputFlags_isSignConversionFlagc N @OutputFlags_isSpaceFlagcN @!OutputFlags_isAlternativeFormFlagcN @OutputFlags_isZeroFlag|!888ax`!8, +A/ ,-A, #AlA4`88,@ ,A|8!}N axK,A8`8,@KaxK}KaxK,A 8KaxKK, 0A,@paxK,A 8KaxKKaxK,AK|axK KpaxK,A 8KXaxKEKL ADOutputFlags_parse8@N @FieldWidthCtorN @FieldWidthXtor, @ 8`N 8H @FieldWidth_parseTd>8`8( L 8`N @FieldWidth_isDigit|!`ed`88T>Ky,9@l9 x$````!xh8|:9|||JT>K),x$A̐aC8!p}N 8`8!p}N AFieldWidth_atoic8|48TN @FieldWidth_isDefinedcN @FieldWidth_getValuecN @FieldWidth_isStaticN @FieldWidth_setArgumentPosition N @FieldWidth_setArgumentValue|`L"Bx|``|k".`!```!K!,8Al| *.L!, *@L~|x8|k*.,#AA`8!}N , `@K|*cK`f,@$L |gx|k*.,#A@KTL K AFieldWidth_parse@AF11_38N @ OutputPrecisionCtorN @OutputPrecisionXtor, @ 8`N 8H @OutputPrecision_parseTd>8`8( L 8`N @OutputPrecision_isDigit|!`ed`88T>Ky,9@l9 x$````!xh8|:9|||JT>K),x$A̐aC8!p}N 8`8!p}N AOutputPrecision_atoicN @OutputPrecision_getValue|`L"B`x|`h`|d.!```!K!,8Ax| B.L!, *@L~|x8|kB.,#AA`8!}N 8`| B., @K|BcK`f,@$L |gx|kB.,#A@KHL K AOutputPrecision_parse@AF7_38N @ LengthModifierCtorN @LengthModifierXtor|!/%j,%l8@,tAd,%zAHi,@8!p}N A8OutputConversionSpec_setSymbolTd>8`88((AN 8@,$a(@/$i,%@$,$sA,uA,$xLFAH/$AA,XL3LFA8`N @$OutputConversionSpec_isValidSymbol__cN @OutputConversionSpec_getSymbol8N @ +OutputConversionSpec_switchOnNegativeSign__cN @OutputConversionSpec_isNegativecN @&OutputConversionSpec_getConvertedValuecK @OutputConversionSpec_isValid|``aA`z`c!Q8x8(( @A\bxH8c| *| N axK1`,@L~888cCHA8!}N axK`,A~888cCKA8!N axK``e~8#A4cCH IA8!}N cCKA PH K,:8APg888}cfzA8!N 88d\8lH#`A8!}KaxKq`,@x~8,$A<cC8 8HA8!}N cCK-|8 8HKaxK)`,A|~8,$AcCKxg8 A8!N |cC|888HAA8!}N g8,$A4|cCH9A8!}N 8PK-``}xc;(>A|8zz,#A88PcK%`A8!}K8\8l8IH!`A8!}KdcKb-A(zKg8(>@;@|,AcH |}yA{;|(;A8zz,#ALcceKM`z88!}a|.AN 8\8l8/H `8!}AaKccKaAA(zKlc8K`|`4T~K8cKy`|}yAK axK!`,@L~8 88cCHA8!}N axK`,A~8 88cCKaxK`,@L~888cCH5A8!}N axKm`,A~888cCK,#%,AAAdAKH,:8A<8`8%8zA8!}N 8`8d\8lH`A8!}K"ALOutputConversionSpec_toString|= 6=@8aA=`a`}!a<`0=c=2`?`eaA;<4!?@y? Axp?C>E818h3!Q9 79*99Kb85=`gA9LdA=i>Gp9[fA9KhA8 j=@k=`mat8 l=ox8 n=@q|8 p=`s!8 r=u8 t=@wa>I8 v>K8 x>`M8z!>@O> Q>S=U=WW>8B8xD8F8Ha8tL8Pa8pT9Jؐ,8N8Xa<Y8ap9R8V+$8Z8;@A8a,%A`,% A,%Al;!|+|} P|yA4``!|+y;9}|:.} P|y8@y|".A, xA, XA,;@@,o@ ,ALZA8}|P,o@,@|`P,@t8dT|<,xAL||8,A(8}},#A|8c8,|xBx;#.@@xB($@080}|B@`!|.;}C |.x"c$xc|`K`C8!}px!Aa!AaN 8'8d\8lHm`8`8!}pK|KZA(}K;8,@Kx|@@;,K;@Kc#K`T`>K4x xT<|#y;!A<````!x x|*.;Z}CyT<8;9@;Z|*.AK;!;@x|xx$y|:| P}CyA@`!x;9}yy$|*.;Zx8}J| P|;y@x|".A(Kx`xT<|#y;!A8```!x`x|*.;Z}CyT<8;9@;Z|*.AK AOutputConversionSpec_itoa__|}&9@%,NBaA88!9.9 *`8!;P;x;!xAp@9@#8`Aq,8p9@L}1}%!@ `d}E898ap|},;|M|!cd|),F/ fL3AAcc,@Ap@pc# 8pAc|cK]A(|A,bЀ,@ 8b88l8cH`88||8|x(#A8,%Ac#cDcFH8{D|#.|9@@@cC0*|} 8! !AaN c#KWA(cC0*|} K8b8l8c\H-`8KtKVA(`eK4`~|zK ;KViA(|yy@b88l8c\H`;!xNK\bA,,(A@A(,<<..@88a8.|89|:KLA`8KEA(`}8`KN9A(`h8a88KaA(8aK>MA(; |d|a", @Hx8acKH @u16_internalErrorMsg|=..`}``8.!pK:A((#P8`@X98p|B8at8KA(8at8Ky08! }N 8p8atp8cK}A(8at8K%08! }N Au16_traceFopen;|;||}&aA!``waA!!8a8X}Paa؛aaaaaaaA(acKuA(8`.,8 8 ;AA;!˘a.@<8aK89A(|d8ae| EN!A(;"@T::.:: ````!:x8Xr`@H @u16_utf8conv_error|`8@``!8ap`K=`8ap;8K3u`8apЀ,A(b 8!8 }N K/A(8 8x|}8p|8ap8|1K?EA(8p8ap8K8 b 8!}N Au16_malloc_errorT>Ѐ,L HN @u16_array_shortЀ,M T>T>HN @ u16_unknownFormatStrp`M H8N @dbgAlignCheckStringU16|;`}a8f!, 8p;p@B@@````!8c 8 C `Z8"8#%C#E% x c$e$|p``! |h1Ґx d8C ;`9  |1Ґ8ap%dK,A(|`c|9pB@<```!8 9 C 8(8apG|8`88H ( (~IKc@8!0}a8N c (8!0N AdbgAlignCheckStringU16@AF21_20|``;`8Y!8apxpxXK.QA(8apK*A(|`8o |"(@9aA9 !A}9`|cx}v|c`8(#@89?``c&X@```!|(0@a @|) @/@L@9asW4cA4,9~0@W6@0@e@9 W W|2y{0,,<@~`@ky|,@HA c8c9),;@t@pa#!AaN ?AVp8c@=k,#9)U|}|Ac8cK9`;@A(a[, 9|g@H@P9K<,#A8t8`!AaKP9`;@AK,<;@T|<0@@E@cW[2,;@h9 W{[5,W2,+@ {d,K9`;@AhK@W8;k,<@x|;0@@@9 W2,;@E@9 W[2,;@%@WZ52{9 9`W;2W9,;{c@\x|<{ @$;@AK9`;@AKb8"9 K$ @ Utf8snToU2n8,#8A(%@@``!x$,'Ax$,(@$8c88|&(@A`N 9,)9F8ATT>TѾa+yI|((@Ta*`A$cC#a8c|&(@@Kp`N |*(@TѾATaFa`#8cK`N 8d`!8cx$, ADx$,$@ 8K, @ 8K8K @@ U2sToUtf8s,#A``(%@T8|`!8Tx$x%A`TѾ,)|6pT>@$``8cC |`PN `y``8cC KԘ8cC K8`N @ U2nToUtf8x,$88}%BA,#9@A9|P@`!|' @%H@A8@t9,&x$A,*@8c8Kx%AT8TѾTˣ>yLTaja`|' @ACc8cK8"8`N 8|' @ATѾTaKc`C8cK@A,*@t8c8K$8gN `N 8e8&@````!|%H@Aؠ8c8, @DA8x%x$,@8@8`K8A`K8gN x%x$,@K @ U2snToUtf8n|!|Kڑ`8!p}N A(nlsui_set_trace|!K5`8!p}N A$nlsui_set_trace_func|!|K1`8!p}N A(nlsui_internalErrorMsg|```!Ko`(#P8o@|x`8`8`P*8|i``!88C 9p8|8apK߭`8!}N ,#AK Anlsui_traceFopen|!|K`8!p}N A(nlsui_array_short|!|K`8!p}N A(nlsui_utf8conv_error|!|K`8!p}N A(nlsui_malloc_error (|8T!KA(,#A88TKA(8fK `,@8!}N HH;N @nlsui_cast_raw2uc!a`|x!AK|%@a@,}xaK8Va8!}N Ahnlsui_U2sToUtf8s_checked``|!Aax!AK8|@`}|#@Al@HaK8V8!c}N c8!}N axcK|?@A|c8!}K Anlsui_Utf8sToU2s_checked|,#|!AP`dB (8ap88)889 H9*P9JXK8apcH:A(8!}N 8`cH9A(8!}N A dlopenU16!,$B (|axAD8ap8888K9 09*9J)`8a8888K1`8`8!}!AaKc&b (8ap88 K=`8ap8888K`,@0K A|cleanup_getenv_table||dya!Q8ap@(8`KaA(|{y@8`8!}aN b (, @8!}aN ccK 9A(`xd8dKA(8ax|ycdApK 8|#@A X,>A|@ X`8d88KI X,c@Tx$)*x$f)*88!}aN (8 Q8d88KcKA(8`8!}aKx$ Xc!*x$f!*8Kl{$cKAA(`~ XdcK)A(,# X,dAA|@K8 Cb (888cKb X`dc,#@xd,#A8f8888K8`8!}N 8ap8p (88 8889K8`8!}N 8ap8888 )9 9*9JKU8ap8x8pH%A(,#AK8`8!N A strftimeU16|B (,#|!AL`d8ap8888 Z9 9*P9JXK8apcH%]A(8!}N 8`cH%9A(8!}N A accessU16|B (!,#`dA@8ap8888 m9 |9*P9JXK8apH$A(8!p}N 8`H$A(8!p}N AtchdirU16||y`xd!q|PA8ap($@8H$]A(,#Ac8pcK٩8|=@8"|@AD8`@ x8!}N cx8!}N c8p (c8 889pK8`x8!}N 8`x8!}N H#A(,#AK08`H#uA(|y8`@x8!}N {KA(|~ycAccKؑ|=@8|@Ax8"c@<K A(cK A(8`8!}N cK A(c8!}N cc (c8 889pKcK eA(cK YA(8`8!}N (8 8dp88KcK A(8`8!}N A getcwdU16|B (T>,#!AL`d8ap8888 9 d9*P9JXK8apcK}A(8!}N 8`cKYA(8!}N AchmodU16|B (T>,#!AL`d8ap8888 9 D9*P9JXK8apcK}A(8!}N 8`cKYA(8!}N AmkdirU16`,|}&aA!`y.;;aA!! (A@;~|z8|x$K A(,#A`r,@t@; ;::c`!KA(`txd8dK EA(w:8,#AK|#@A;9;|9@@u:K{$$bC|!*8!} Aa!AaN zc${$$8888 *ch|r*| *K,@$`!x;K A(;|=@A8`KA(|pcc888 "K,@```!x;K 9A(;|=@AK;; ;bW:```!;KqA(`uxd8dKA(w8,#A\KI|#@A ;:;|8@@K888w8 *chKwKA(Kcc888 "K),@;``!;KIA(;|=@AK8bC|!*Kcc888 K8`KiA(|p8~88 K܍8`KMA(|p;~K Cpnlsui_alloc_wcsarBase|c8KX @ nlsui_alloc_wcsar,#@ 8`N H @nlsui_alloc_envbcK @ nlsui_getenvironU,#@ 8`N Hp @nlsui_freeenvironU, M HTN @ strtoupperU16, M HN @strntoupperU16`;|`}!q``!~;`|p`,`@\,#{@@8@8;,<@c8!}N };,#AKH@`}K AstrcpytoupperU16, M HN @ strtolowerU16, M HN @strntolowerU16`;|`}!q``!~;`|p`,@@\,#[@@8 @8;,<@c8!}N };,#AKH!`}K AstrcpytolowerU16|# @@ 8`N H @ strcasecmpR|# @@ 8`N H @ strncasecmpR`b c|,=c!qh(@A\````!s,`Atc8, ALHTA(,@<;c;,=@c8!}N cKmA(~Kc,={A(;,=@lc8!}K8@K|cA```!p`,`@@,#{@$8A~;,#@KL~;,#A8KKA(~K Ax strtoupperR `"a`{c|,!ah( @,$A `}@@A4HSA(,@$;c,=A||;@@KpcKA({K,={Ac,=ADK8@K,$c}LFA `!p`,`@H,#{@08A$};,#A;{|;@AKȘ},#AKKA(}K A strntoupperR``cb ;|c!qh( A````!|;`}p`,`@\,#{@@8@8;,=@c8!}N ~;,#AKKA(~K````!,`sAc8, A@HPA(,c@,;;,<;;APKcKeA(,<;~;@c8!}K(,<{A K8@K AstrcpytoupperR`b c|,=c!qh(@A\````!s,@Atc8, ALHOA(,@<;c;,=@c8!}N cKUA(~Kc,=[A(;,=@lc8!}K8 @K|cA```!p`,@@@,#[@$8 A~;,#@KL~;,#A8KKA(~K Ax strtolowerR `"a`{c|,!ah( @,$A `}@@A4HMA(,@$;c,=A||;@@KpcKA({K,=[Ac,=ADK8 @K,$c}LFA `!p`,@@H,#[@08 A$};,#A;{|;@AKȘ},#AKKA(}K A strntolowerR``cb ;|c!qh( A````!|;`}p`,@@\,#[@@8 @8;,=@c8!}N ~;,#AKKA(~K````!,@sAc8, A@HKA(,c@,;;,<;;APKcKMA(,<;~;@c8!}K(,<[A K8 @K AstrcpytolowerR|+y`aA`{b |}&!aAl;Ncsh(@cc8AHJuA(;[N1B,@t8~p`APcHJEA(;~,~@4NB,<A`;|<@T(?@L```!@;ZN1{@`;{N;,<A|<@ |=@A|P|8!|Aa} N 8p`A(ccHI}A(,{@;{NBK;{|cKEA(Tc>KhcCs8A$HI5A(,@;ZN1BK(;ZKA(T|>K;~KA(Tc>K;[N1cKA(T|>KxcKA(T|>~KA(,<Tc>A;|<@(?@````!{;{KiA(T|>~;KUA(,<;Tc>A|<@|=@@|K8`ax8!N CstrncasecmpR@AF57_50``;b |}&cNN1!qh( @`!@;N@L;N1,<A |<A|P|8!|} N cp8@;|K A(T`>KHG A(,@;N1BK|cs8@;KA(T|>KDHFA(,@;NBK$```!KA(T|>};KmA(,<T`>A |<@;K CstrcasecmpR@AF58_49|``~x!qA`|c``!p`,@@h,#[@P8 AD|;,#A;|>@@c8!}N |,#AKHq`|Kc8!N AstrntolowerU16@AF59_47|``~c!````!p`,@@X,#[@<8 A0~;,#@c8!}N ~;,#AKH `~K AstrtolowerU16@AF60_46|``~x!qA`|c``!p`,`@h,#{@P8AD|;,#A;|>@@c8!}N |,#AKH,`|Kc8!N AstrntoupperU16@AF61_44|``~c!````!p`,`@X,#{@<8A0~;,#@c8!}N ~;,#AKH+`~K AstrtoupperU16@AF62_43``~c|,#!A$``!K1A(~;,#@cKA(8`8!}N Apnlsui_freeenvironU@AF63_428`e, A48, A$```!88, @|`d`8K, @Xnlsui_alloc_env@AF64_40|`||+ya`!aAȠcH `T~>H `,>T`>;Ap|>;`@d(=@\|;``!H `T~>;H `,>;{T`>A |>@|;@@|;K|P8!|}aN 8`8!N A strncasecmpU16@AF65_31|;8c;!qc``!H`T~>;H`,>T`>A|>@};K|P8!|}N AstrcasecmpU16@AF66_30| (`88889h!9?|9_a8apK8ap8d88pK`8ap8dK4``dx8ap88KA(Kùa8!}N Anlsui_cast_raw2uc@AF67_14 0A( L| N  8A( L| N  @A( L| N  HA( L| N  `A( L| N  hA( L| N  pA( L| N  xA( L| N ,0/A@,F8`LX A8`N ,9,a@A,fA8`N @D isxdigitU16, ,Al, @\A`, ,LF BAH,,AN 8`,@A(AA@$8`CN 8`AN 8`?N 8`=N ,D/LA<,F/HA(AA@8`KN 8`IN 8`GN 8`EN ,N/PA(AA@8`SN 8`QN 8`ON 8`MN ,Z/jA,T/\AN 8`?N 8`@N 8`AN 8`BN 8`CN 8`DN 8`EN 8`FN 8`GN 8`HN 8`IN 8`JN 8`KN 8`LN 8`MN 8`NN 8`ON 8ޠ,!o(Ab xH8c4X| *| N 8`!pN 8`!qN 8`!rN 8`!sN 8`!tN 8`!uN 8`!vN 8`!wN 8`!xN 8`!yN 8`!zN 8`!{N 8`!|N 8`!}N 8`!~N 8`!N A08(Adb xH8c4|c *|iN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8`!N 8`"N 8`#N 8`$N 8`%N 8`&N 8`'N 8`0N 8`1N 8`2N 8`3N 8`4N 8`5N 8`6N 8`7N 8`@N 8`AN 8`BN 8`CN 8`DN 8`EN 8`QN 8`SN 8`UN 8`WN 8``N 8`aN 8`bN 8`cN 8`dN 8`eN 8`fN 8`gN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`pN 8`qN 8`N 8`rN 8`sN 8`tN 8`uN 8`N 8`N 8`N 8`vN 8`wN 8`N 8`N 8`zN 8`{N 8`N 8`xN 8`yN 8`|N 8`}N 8`N 8J<8|2((Ab xH8c=| *| N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N AN 8`?N 8`@N 8`AN 8`BN 8`CN 8`DN 8`EN 8`FN 8`GN 8`HN 8`IN 8`JN 8`KN 8`LN 8`MN 8`NN 8`ON 8`PN 8`QN 8`RN 8`SN 8`TN 8`UN 8`VN A 88 8T8((I+Ab xH8cH|c *|iN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`xN 8`N 8`N 8`N 8`N 8`N 8` N 8` N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8`"N 8`$N 8`&N 8`(N 8`*N 8`,N 8`.N 8`IN 8`2N 8`4N 8`6N 8`9N 8`;N 8`=N 8`?N 8`AN 8`CN 8`EN 8`GN 8`JN 8`LN 8`NN 8`PN 8`RN 8`TN 8`VN 8`XN 8`ZN 8`\N 8`^N 8``N 8`bN 8`dN 8`fN 8`hN 8`jN 8`lN 8`nN 8`pN 8`rN 8`tN 8`vN 8`yN 8`{N 8`}N 8`SN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8` N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`"N 8`$N 8`&N 8`(N 8`*N 8`,N 8`.N 8`0N 8`2N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N A|b xH8c|c *|iN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N Ab xH8c0|c *|iN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8`!N 8`"N 8`#N 8`$N 8`%N 8`&N 8`'N 8`(N 8`)N 8`*N 8`+N 8`,N 8`-N 8`.N 8`/N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8` N 8` N 8` N 8` N 8`N 8`N 8``N 8`bN 8`dN 8`fN 8`hN 8`jN 8`lN 8`nN 8`pN 8`rN 8`tN 8`vN 8`xN 8`zN 8`|N 8`~N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N ,,EA\A@`N 8ސ,!(Ab xH8c| *| N 8`!`N 8`!aN 8`!bN 8`!cN 8`!dN 8`!eN 8`!fN 8`!gN 8`!hN 8`!iN 8`!jN 8`!kN 8`!lN 8`!mN 8`!nN 8`!oN A8(A4b xH8c|c *|iN 8`N 8`N 8`N 8`N 8`N 8` N 8` N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8`"N 8`$N 8`&N 8`(N 8`*N 8`,N 8`.N 8`0N 8`2N 8`4N 8`6N 8`8N 8`:N 8`N 8`@N 8`BN 8`DN 8`FN 8`HN 8`JN 8`LN 8`NN 8`PN 8`RN 8`TN 8`VN 8`XN 8`ZN 8`\N 8`^N 8``N 8`bN 8`dN 8`fN 8`hN 8`jN 8`lN 8`nN 8`pN 8`rN 8`tN 8`vN 8`xN 8`zN 8`|N 8`~N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8` N 8` N 8` N 8` N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`(N 8`)N 8`*N 8`+N 8`,N 8`-N 8`.N 8`/N 8`8N 8`9N 8`:N 8`;N 8`N 8`?N 8`HN 8`IN 8`JN 8`KN 8`LN 8`MN 8`YN 8`[N 8`]N 8`_N 8`hN 8`iN 8`jN 8`kN 8`lN 8`mN 8`nN 8`oN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 80<8|2((Ab xH8c'| *| N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N ATb xH8c(h| *| N 8`!N 8`"N 8`#N 8`$N 8`%N 8`&N 8`'N 8`(N 8`)N 8`*N 8`+N 8`,N 8`-N 8`.N 8`/N 8`0N 8`1N 8`2N 8`3N 8`4N 8`5N 8`6N 8`7N 8`8N 8`9N 8`:N @ toupperU16 A( L| N  A( L| N  A( L| N Tc>8p(L 8`#8N @$B8ToA7Tc>8p(L 8`#8N @$UcToA78bp|N @UcsToA7s_ErrCnt8bp8N @UcsToA7s_ErrReset88``!8, A8c8K8N @<A7sToUcs,|L 8c8| ``!88cC N @8A7nToUcn88``!8, (A(A88cK88`N 88`N @X UcsToA7sCheck,|@488c| ``!8(A8cC 8`N 8`N @L UcnToA7nCheckT>88#(````!88(/&A0A`K@`K̘`K8N @p UcsToA7sSubst,|L T>8(88#At|88B@,``!(A4`88C (A N N `88C K|88B@,``!(A4`88C (A N N `88C K @ UcnToA7nSubst8,L 8#||88B@,``!(A4`88C (A N N `88C K @UcnToA7n|;!qax,,ApAP,axA,HaxKMA(8!}N Ha8!}N axH8!}N HM,AK Alocaltime_cont8!b |A(8c,, @x |#yADd| DN!A(`db 8c,Hi8b8!p}cN 8b 8c,HA8b8!p}cK|8!pN A getPPContTime`;8b |H8@8,$!qHPX@L*B8`@0| (A`8|(L(B@$`8088H ,,AA8bc,,A@x88ap8`0|P|t||pH ,#@,88}88!}N 88}`8!}Kp8ap8`H },#@KK,8Ȑd@KX88"8}88!}KxK8`8ȐecH ,#88}8@`8!}Kb 8cAc08! }aN c8H8H8b(|;yA<8bhc,#A, 8g| 8GN!A(cc8HE8b(|;yA<8bhc,#A, 8g8| GN!A(c8HQ8H8b(|;yA8bhc,#A 8g8<| GN!A(Kb c(|c2|PKl8p8x H#y,b (0|"@c,@|P8acdHa`~K8 Ѐ(e ,$A ,A(>b 8cA0K(c8H 8LH 8b(|;yA<8bhc,#A, 8Lg| 8GN!A(b Ѐc,A8cc8LH u8b(|;yA<8bhc,#A, 8Lg8| GN!A(c8H8LH 8b(|;yA8bhc,#A 8Lg8<| GN!A(K|PKxx8acd|P|t||2|(PH`~88bȐ (, A ,A(>b 8cAKc8Hq8H I8b(|;yA<8bhc,#A, 8g| 8GN!A(c8H 8b(|;yA<8bhc,#A, 8g8| GN!A(c8H8H 8b(|;yA8bhc,#A 8g8<| GN!A(KccdHa08! }aKp b HH= 98p8x`g(8HH 8d0(`,A;h|,#A8 8Pg| GN!A(8b(`,A|,#A8 8tg| (0GN!A(8b(,AL|,#A@88,A8 8g| GN!A(KKx AContLoctLocaltimeCont_R|!H&uA(8!p}N A$ R_localtime|`,# `!@8 | Aa8a8KY,#A\ ,a8A8 8a8K),#A,|Aa,|@a<`ʠxdxMxgdxhM}%0Px &}h8Pxl&}*HP}kb})Z|}i"A9i |@P|(P|8P|*|*||"@x@H}icAxpH ! P8!@}N ` c}iAxK8 A` c}iAKaaAccH,@;8~H,@88a8K,#A8a88Ki,#AlȀa|@a|Ad88a8<``!K!,#88aA|A8<KЀĀa|@aL19Aa|At88a8`!K,#88aA|A8KЀĀa|@a|@cA}'@PxpH|cP8!@}N 8`P8!@}K8~```!;H,8}@K8~<`!;(!QA;}|`4,@(@(A,@K` 8bX89X `c8-K`8K=`8`8!}8N 88`8!}N ,AK9`bX88X `8.cK`K`}8!88`}K@@b@,@0K` `88~K U`bX88.0cKk`K-`8cH`,@HF)`,@hH`,@$8!8`}N aH$`8}a8!N axH$`8}ax8!N 88!}N 8cH`,A88!}K8PX8`cH5``g;¤8( `c8s899=-H^H`b@,@\K `8}8sK `|8-|Kj `K`8`8!}N 8`8!}K ANiInit3|,T`>!qA8P8`XcH ``g;8(" `c8e899)=T]H`b@,@`K`" `8e8iKm`" `8=|Kh`KM`8`8!}N 8`8!}N `88!K A NiInit2@|!a,@8b,A8PX8`cH``g;9b8(c `8989==\ pHu`,@dK`8}8K`~8¤8=,K`K`8`8!}N 8`8!}KH"}`8!}N K`bX8 `8|4,@xb@,@8`8!}N K)`bX8 `8@8P8`XH``g;¤8( `c8899=^(Hq`b@,@pKy`8}8K `bX(8cKcq`K`8`8!}K48cX8p8H`,@\88`9x8p888xH6`,@,8`}x8! N 8!}N 8P8`XHa``g;¤8( `c8899=8^(H1`b@,@0K9`8}8K`bX(8|cKb1`K`8`8!}K ANiServerHandle||y`!a@8P8`XHm``g;¤8(" `c8899)^0H=`b@,@`KE`" `88iK`bX" `08 cKa5`K`8`8!}N 8`8!}N cKS=A((# @L,>@8P8`XH}``g;¤8( `c8899=^0HM`b@,@pKU`8}8K`bX08cK`M`K`8`8!}K48cX8p8H`,@\88`9x8p888xH2`,@,8`}x8! N 8!}N 8P8`XH=``g;¤8( `c8899=8^0H `b@,@0K`8}8K`bX08|cK_ `K`8`8!}K ANiBufServerHandle||y`!aA,$A8`8`d|# @8p9x8`8p88x8H11`,A8!}N apH`8`x8!} N H1`ap88`9x8p888xH0`,A8!}Kt8PX8`cH1``g;¤8( `c86899=^8H`b@,@8K `8}86K`|88K]`K}`8`8!}N 8PX8`cH}``g;¤8( `c85899=^8HM`b@,@KU`8}85K`|88K\Q`K`8`8!}KL AxNiServerHandleForPort||y`!aA,$A8`8`d|# @8p9x8`8p88x8H.q`,A8!}N apH`8`x8!} N Hq`ap88`9x8p888xH-`,A8!}Kt8PX8`cHq``g;8(" `c8Y899)]@HA`b@,@@KI`" `8Y8iK`" `@8KZ=`K`8`8!}N 8PX8`cH``g;¤8( `c8X899=^@H`b@,@K`8}8XK`|@8KY`K`8`8!}KL ANiBufServerHandleForPort||#y`!QaA,%A8`8`d|# @8p9x8p888xaH+`,A8!}N apH}!`8`x8!} N H|`ap8a9x8p888xH+!`,A8!}Kt8PX8`cH``g;¤8( `c8|899=^HH}`b@,@8K`8}8|K`|H8KW`K`8`8!}N 8PX8`cH``g;¤8( `c8{899=^HH`b@,@K`8}8{Ka`|H8KV`KE`8`8!}KL A|NiServerHandleForAddr||#y`!QaA,%A8`8`d|# @8p9x8p888xaH(`,A8!}N apHza`8`x8!} N Hy`8apa9x8p888xH(a`,A8!}Kt8PX8`cH``g;8(" `c8899)]PH`b@,@@K`" `88iKQ`" `P8KT`K1`8`8!}N 8PX8`cH1``g;¤8( `c8899=^PH`b@,@K `8}8K`|P8KT`K}`8`8!}KL ANiBufServerHandleForAddr||#y`aT>!Aa@8P8`XcH``g;¤8( `c8899=^XH`b@,@K`8}8K`|X8KR`Ke`8`H,,'@8PX8`cHy``g;¤8( `c8899=^XHI`b@,@4KQ`8}8K`|X8KRM`K`8`H;|c{d$,A8PX8`cH``g;¤8( `c8899=:^XH`b@,@K`8}8K1`|X8;KQ`K`8`H,@8PX8`cH)``g;¤8( `c8899=;^XH`b@,@K`8}8K`|X8;KP`Ku`8`H`!aHh`Tf>,?A,,>@8P8`XHM``g;¤8(" `c8z899)^H`b@,@DK%`" `8z8iK`bX" `8cKC`Kލ`8`8!}N 88Xp8`9!!x8c9 9@H~`,@8`}8! K8P8`XH-``g;¤8( `c8y899=|^H`b@,@$K`8}8yK`bX8cKA`Ku`K ANiHandleForAddr|``T>`!aHe`Tf>,?A$,>@8P8`XH-``g;¤8( `c8899=^H~`b@,@`!aHc`Tf>,?A0,>@8P8`XH ``g;¤8(" `c8899)^H|`b@,@DK`" `88iKq`bX" `8cK>`KM`8`8!}N 88Xp8`9!!x8c9 9@Hz`,A ,@8!} K8P8`XH``g;¤8( `c8899=|^H{`b@,@ K`8}8KQ`bX8cK=`K1`K ANiBufHandleForAddr|``T>`!aHa`Tf>,?A(,>@8P8`XH``g;¤8( `c8899=^Hz`b@,@T>a !QA,$AD,?@8PX8`cH``g;¤8( `c8899=^Hl`b@,@8K`8}8KQ`|8K.`K5`8`8!}N 9 p89`||t?}xтa8x88Hj`,A ,A8!}N 8!} N 8PX8`cH``g;8(" `c8899)]Hk`b@,@Kȉ`" `88iK`" `8 K-}`K`8`8!}K8PX8`cH``g;¤8( `c8899=)p^Hj`b@,@PK`8}8Ki`|8)K,`KM`8`8!}K A NiHandleEx|`a>aAa]T>!`T>!AT>aHP`Tf>,?A@,=@8PX8`cH``g;¤8( `c8899=^Hi`b@,@8Kơ`8}8K1`|8K+`K`8`8!}!AaN 8888`p|t(xт88xccJHg]`,A ,@8!} Kp8PX8`cH``g;¤8( `c8899=|^Hhe`b@,@Km`8}8K`|8K*i`K`K A,NiHandleForAddrEx|`,|~!QA88bXT8`| @ 8b8{$|p|xEx.| Pc$pA} |@;$, @@}P@8c|d4,8TADb hc|@(c8!}N 8c88@89Hwe`,A@,@P|K` `88~Km`}(88:Xc"cK `KA`8`8!}N , @ (A$, @;c,?cA`K$, "@@h, @$p(A p, @ ;K;K;KXb `c|@ ;Kb hc|A@, @H(A;Kl8P8`XHu``g9B8(" `c8p899)JHeA`,b@Al,@KA`b `88cK`bX8c `8 cK')`K¡`8`8!}K`,ADK`bX88 `8 cK̕`KM`8`8!}K At NiGetHdlProto( `A\8xcH8X|*| N 8dTN 8d\N 8d`N 8dhN 8dtN 8d|N 8dN 8dN 8dN @lNiGetProtoName8bTN @NiIsIPv6Activated|c`|``XH( @ NiAcceptEx|`,aA``a`!1|zA8bXT8`|@8b8{@$|p|xEx.| Pc|c$pA |@,&A$, A$, "A, @$, A$, "@$, "Al`8bߘ, AH`|#@@~cH`,A`~,AXb@,@HK` `88}KÉ`(88:4ccK)`Ka`c8!}AaN ```!cH`,AKT8cd8H!1`,@a,= Aa@cH},<@ 8`KXacPHG`|8`K<8d88H`|`,A`8!}K 8PX8`cH}``g;¤8( `c8899=9x^H`M`b@,@8KU`8}8K`|89K"Q`K`8`8!}AaKhcCdcHQ`,@0,=A8b΀c},<A8K8PX8`cH}``g;¤8( `c8r899=9 ^H_M`b@,@8KU`8}8rK`|89LK!Q`K`8`8!}AK8P8`XH``g;8( `c8pAp899<]H^`,b@A`,@K`8|8pK5`bX8 cFcK `K`8`8!}AKH,A,KI`bX8 8cK `K`8`8!}AK A< NiAcceptEx2|`,a`T>|{`!QA(A8bXcTc8`g|8@8b8{d$|p|xEx.|8Pc|c"$pAȀ |@,, @ ,)@AL,$AL|C`a&* i| IN!A(|ca8!}N ,(@8PX8`cH``g;¤8( `c8899=8X^H\u`b@,@8K}`8}8K `|88Ky`K`8`8!}aN |`a%8H@1`|ca8!}N 8PX8`cH``g;¤8( `c8899=8 ^H[`b@,@LK`8}8K!`|880K`K`8`8!}aK8PX8`cH``g;8(" `c8899)8]HZ`b@,@K`" `88iKu`" `88K`KU`8`8!}aKd8P8`XHe``g;8( `c8ap899<]HZ1`,b@A`,@K1`8|8K`bX8 cfcK%`K`8`8!}aK,AK`bX8 8cK`KQ`8`8!}aK` APNiWrite|`,a`|{T>!QA8bXcTc8`i|H@8b8{g$|p}'xEx.|HPc|c:$pA`# | @T,$A,A,(@8PX8`cH``g;¤8( `c8899=8X^HXY`b@,@8Ka`8}8K`|88K]`K`8`8!}aN |`8H<`|ca8!}N 8PX8`cH``g;¤8( `c8899=8 ^HWq`b@,@PKy`8}8K `|880Ku`K`8`8!}aK8PX8`cH``g;¤8( `c8899=^HV`b@,@K`8}8Ka`|8K`KE`8`8!}aKp8P8`XHU``g;8( `c8ap899<]HV!`,b@A`,@K!`8|8K`bX8 cfcK`K`8`8!}aK,AK`bX8 8cK`KA`8`8!}aKl A NiRawWrite|`,aA``T>|z!AA(A8bXcTc8`g|8@8b8{D$|p|xEx.8Pc|{$pAd |@X,,>@ , @A,=A4|,$A\#`cc) i| IN!A(|c8!}AaN c``8cHQ`,@||88cc9H`,,@88@|8!}Kx``8!|}K`A``8!|}KD|c8!}AaK08PX8`cHE``g;¤8( `c8899=@^HS`b@,@8K`8}8K`|8hK`K`8`8!}AaK|8PX8`cH``g;¤8( `c8899=^HRa`b@,@Ki`8}8K`|8Ke`K`8`8!}AKL8PX8`cH``g;¤8( `c8 899=x^HQ`b@,@K`8}8 KQ`|8K`K5`8`8!}AK8P8`XHE``g;8( `c8 Ap899<]HQ`,b@A`,@,K`8|8 K`bX8 cFcK`K}`8`8!}AK,AK`bX8 8cKy`K1`8`8!}AK ANiRead|`,a`|{T>!QA8bXcTc8`i|H@8b8{g$|p}'xEx.|HPc|c:$pAp# | @d,,$@ , @A,(@8PX8`cHa``g;¤8( `c8B899=@^HO1`b@,@8K9`8}8BK`|8hK5`K`8`8!}aN |`8HLq`|ca8!}N 8PX8`cHy``g;¤8( `c8A899=^HNI`b@,@PKQ`8}8AK`|8KM`K`8`8!}aK8PX8`cH``g;8(" `c8@899)x]HM`b@,@K`" `8@8iK5`" `8K`K`8`8!}aKh8P8`XH%``g;8( `c8>ap899<]HL`,b@A`,@K`8|8>K`bX8 cfcK`K]`8`8!}aK,AK`bX8 8cKY`K`8`8!}aKd A NiRawRead|`,aT>|{T>!QA(A<8bXcTc8`e|(@$8b8{d$|p|xEx.|(Pc|c"$pA |@,'A ,'@ , @T,$AH|8(h| HN!A(|ca8!}N `~$, @,'@xb@,@HK` `8f8K`~(887cfcK-`Ke`8`a8!}N |8H`,@$a8!8`}N |ca8!}N $, "@,'@tb@,@hK!` `8u8K`~(887cfcKM`K`8`a8!}K |H`|ca8!}N |`H@`|ca8!}N 8PX8`cH1``g;¤8( `c8W899=7@^HI`b@,@8K `8}8WK`|87|K `K}`8`8!}aN 8P8`XH}``g;8( `c8Tap899<]HHI`,b@A`,@xKI`8|8TK`bX8 cfcK =`K`8`8!}aK8,AK`bX8 8cK`Ki`8`8!}aK AxNiPeekEx__FiUcT2T1|c8|8KP @NiPeek|c8|8K @ NiWriteOK|c8|8K @ NiRawPeek|c8|8K @ NiRawWriteOK|`,aT>|{!QA8bXT8`|8@8b8{`$|p|x Ex .|HP|h:$pA# | @$, @8PX8`cH``g;8(" `c8899)]HE`b@,@0K`" `88iK`" `8K`K`8`8!}aH$, "@8PX8`cH``g;¤8( `c8899=^HD`b@,@tK`8}8Ke`|8,K`KI`8`8!}aH<,%@88|9|Hp`a8!}N 8P8`XH!``g;8( `c8ap899<]HC`,b@A`,@K`8|8K}`bX8 cfcK`KY`8`8!}aHL,A0K`bX8 8cKU`K `8`8!}aN AD NiCheckEx|`,a|~!QA8bXT8`|0@8b8{$|p|xEx.|0Pc|c$pA` |@T,%A$, A$, "@8PX8`cH)``g;¤8( `c8899=^HA`b@,@8K`8}8K`|8,K`Ku`8`8!}aN |Hq`|c8!}N 8PX8`cHI``g;¤8( `c8899=^HA`b@,@XK!`8}8K`|8K`K`8`8!}aK 8PX8`cH``g;¤8( `c8899=6^H@q`b@,@Ky`8}8K `|87Ku`K`8`8!}aKx8P8`XH``g;8(b `c8p899;\H?`,b@A`,@K`8{8KY`bX8 ccK`K5`8`8!}aK,AKm`bX8 8cK1`K`8`8!}aKt ANiCheck2|`,a|~!QA 8bXT8`| @8b8{$|p|xEx.| Pc|c$pA؀ |@̈$, A$, "@8PX8`cH1``g;8(" `c8899)]H>`b@,@@K `" `88iK`" `8,K`Ku`8`8!}aN Hq`|c8!}N 8PX8`cHM``g;¤8( `c8899=^H=`b@,@PK%`8}8K`|8K!`K`8`8!}aK$8`8!}N 8P8`XH``g;8(b `c8p899;\H@8PX8`cH}``g;¤8( `c8899=5^ H:M`b@,@KU`8}8K`| 85KQ`K`8`8!}aH8|`*$, "@8PX8`cH``g;¤8( `c8899=^ H9`b@,@TK`8}8K!`| 8,K`K`8`8!}aH$, 4@h88`Hm`,AP,@$a8!8`}N |ca8!}N `$, @Ā@,@lP,@`8PX8`cHy``g;¤8( `c8 899=5^ H8I`b@,@KQ`8}8 K`| 86lKM`K`8`8!}aH܀T,@8PX8`cH``g;¤8( `c8899=5^ H7`b@,@`K`8}8K-`| 85PK`K`8`8!}aH(8`a8!}N 8P8`XH``g;8( `c8ap899<] H6`,b@A`,@K`8|8KY`bX 8 cfcK`K5`8`8!}aHL,A0Km`bX 8 8cK1`K`8`8!}aN A( NiHdlToSock|`,a|~!QA8bXT8`|(@8b8{$|p|xEx.|(Pc|$pÀe |@,$8`A$, 4AP$, A$, "AT,@8PX8`cH``g;¤8( `c81899=5^(H4`b@,@8K`8}81KU`|(85PK`K9`8`8!}aN T\8!N 8PX8`cH``g;¤8( `c8/899=^(H3`b@,@`K`8}8/K}`|(8,K`Ka`8`8!}aK(8PX8`cHm``g;¤8( `c8.899=^(H3=`b@,@KE`8}8.K`|(8KA`K`8`8!}aK8PX8`cH``g;¤8( `c8-899=4^(H2`b@,@K`8}8-K-`|(84K`K`8`8!}aK8PX8`cH``g;8(" `c8)899) 8](H1`b@,@hK`" `8)8iK`" `(8 `K`Ka`8`8!}aK(8P8`XHq``g;8(b `c8'p899;\(H1=`,b@A`,@K=`8{8'K`bX(8 ccK1`K`8`8!}aKp,ATK`bX(8 8cK`K]`8`8!}aK$ AD NiGetSiSocket|,a!QA,$A|{88XxEx.}(Q@8µ8 `88x p8D|@|6t}J9} ``!8, AX, AL, A@, A4, "A(, @ |A؀,|A8C 8PX8`cH}1``g;8( `c8]ap899<4l]0H.`b@,@!!A0,$A|,%,@ ,<@@A,@c `8X88/H,`,A4(8!'}!AaN c8XccHm`(8!'}!AaKcK1A(`{Tz>8T>KyA(|yy@8PX8`Hna``g;¤8 `|cp8(8899=H^PH %`,@@K}1`8}8K`bXP82HccK`K}`8`(8!'}!AaKcc$8He,@c#KA(KXK|`bX8c& `82hcPKa`K}`c#KmA(K8P8`XcHm-``g;¤8( `c8899=1^PH`,@8K| `8}8K`|P82 K`K|}`8`'(8!'}N 8PX8`cHly``g;¤8( `c8899=1x^PHI`b@,@K{Q`8}8K`|P81KM`K{`8`'(8!'}KH8PX8`cHk``g;¤8( `c8899=/(^PH`b@,@Kz`8}8K5`|P8/XKߡ`K{`8`'(8!'}K8PX8`cHk!``g;8(" `c8899)1(]PH`b@,@(Ky`" `88iK~`" `P81PK`Kze`8`'(8!'}K A NiRouteToTable||y`aAT>!!AA,$@8PX8`cHi``g;¤8( `c8 899=0`^pH`b@,@8Kx`8}8 K}I`|p80Kݵ`Ky-`8`8!}aN ;cKA(|#@A8PX8`cHi``g;¤8( `c8 899=0^pH`b@,@8Kw`8}8 K|y`|p80K`Kx]`8`8!}aN `zc `80 KΥA(,#A0`v|zP|\;#Pc|~8:T>Ko`c|T>8v;,$/A<,$A4````!;;98c,$/A ,$@(A |~~.8|";9T>Cc80 KA(|vy@Pc81$KA(|vy@8|~cK`8`8!}!AaN c81$KaA(,#AK8PX8`cHf``g;¤8( `c8 899=0^pH`b@,@HKu`8}8 KzY`|p808K`Kv=`8`8!}aK A  NiSecStr2||y`aA``!!A,%A,&AL( @8P8`XHe``g;¤8( `c8899=/^XHy`b@,@|z8|@Ap8@cKΕ`cc$:8K.`88T>Z~|, @h;7, @;98aT>8|AhcKyA(Tx>|8|@@b@,@DKr`8{8*Kwe`bX88/cXKx`Ks=`8`(8!(}!AaN `wc8@Ke`8cKǵ`c#KɡA(`ucKɑA(T~>||8|@@Xb@,@XKq`8{8:Kvy`bX88/cXKw`KrQ`K`v8|8/K̵`8c|K`8|yKA(:8|u,#A|yKA(||c|c8 |@@Xb@,@Kq`8{8KKu`bX88/cXKvM`Kq`KH|x80 8|K`|||~8c K,1`8`(8!(}Kc#KA(`wTv>~|z8|@A@c80 Ku`;_8c$K+`8;UT>9Kb@,@Kp`8{8Kt`bX88/cXKuA`Kpy`K|z8|@AHc8/K`8bcK+ `88yTd>@$K!qA,A8b,@ccHY``,@Hb@,A8Kk`bX8c `8/c`Kv`Kli`c8!}N Kc%,@$ccH``,@Kx8!}N 8PX8`cH\-``g;8(" `c8g899)]`H `b@,@@Kk`" `8g8iKo`" ``8K`Kkq`8`8!}N 8PX8`cH[q``g;¤8( `c8f899=)p^`H A`b@,@KjI`8}8fKn`|`8)KE`Kj`8`8!}KL Ad NiMyHostName||~y`aA`T>!A8b,@8a8@H`,@x88BX8a88899 @ThH`,A,@xb@,@DKi` `88Km`bX88.XchKn5`Kim`8`P8!@}N |cP8!@}N 8a8@K``{Td>88|c||08*W>K``88@T>|@|@h,=@,@,8`P8!@}aN Kg`bX8c `8.chKr`KhY`8`P8!@}aKc8.KuA(,#Ah8,AdKgm`bX8c `8.chKr%`Kg`8`P8!@}aK(8,AKg `bX8c `8.chKq`Kg}`8`P8!@}aK8P8`XHW``g;B `{cpax8(8899:.|]hH M`,@DKfY`8z8Kj`bXh8.ccgcKk`Kf`8`P8!@}AaN P8!@}N K]M,ALP8!@}K8P8`XcHV}``g;¤8( `c8899=)p^hHM`b@,@8KeU`8}8Ki`|h8)KQ`Ke`8`P8!@}N A NiGetOwnFQDN|`,#T>!qA,&@8µPX8`cHUY``g;8(" `c8899),]pH)`b@,@@Kd1`" `88iKh`" `p8,K%`Kd`8`8!}N 88HI`8!}N 8PX8`cHT}``g;¤8( `c8899=,^pHM`b@,@dKcU`8}8Kg`|p8-KQ`Kc`8`8!}K, ANiGetNodeAddrList|T>,#!qA,%@8PX8`cHS}``g;¤8( `c8899=,^xHM`b@,@8KbU`8}8Kf`|x8,KQ`Kb`8`8!}N H`8!}N 8PX8`cHR``g;¤8( `c8899=,8^xH`b@,@lKa`8}8Kf`|x8,hKƅ`Ka`8`8!}K4 ANiGetMacAddrList|}&`|#y!qA.#AKAA((#@@A `c88@KA(,@b@,@,8`8!} |N K`]`bX88DccKk`K``8`8!|} N Xc8c8Hj`8!|} N 8PX8`cHP``g;¤8( `c8899=^Ha`b@,@8K_i`8}8Kc`|8Ke`K_`8`8!|} N 8PX8`cHO``g;¤8( `c8899=|^H`b@,@TK^`8}8Kc=`|8Ké`K_!`8`8!|} KD8`8!}N C NiHostToAddr|}&`|+y!qA|{x,@.#AK-A((#@@A `c88@KA(,@b@,@08`|8!} N K]E`bX88DccKh`K]`8`8!|} KXccc8Hg`||dx|v|d8||K\8PX8`cHM``g;¤8( `c8899=^HU`b@,@8K\]`8}8K``|8KY`K\`8`8!|} KXcc8Hf`||dx|v|d88!||} N 8PX8`cHL``g;8(" `c8899))]HY`b@,@->@{`x,@,=AD, @,<A@L88bxcAc88BXa8cD899 Hہ`,@b@,@TKY` 8bX88 `8+cKc`8KYY`88`K}A(},#A, A|8`,@ 8x`!xf&8,%@(A8|2x&}:|9*88T>|@A,%A88`|8!} AaN 8bP88(8g9b" `9A89),c pHu`8`8!|} K```!x&xg&|:8|*T>})*8T>| @AK8P8`XHG``g;¤8(c `8Sx&9|8p9?H^H`b@,@LKV`88TK[=`bX8hx&||cKU`KW `8`8!|} Kd,@x&K|c8!|} K4b `c88@KYA(,@b@,@8`|KKU`bX88DccK``KVM`8`|K8PX8`cHF]``g;¤8( `c82899=+^H-`b@,@8KU5`8}82KY`|8+K1`KU`8`8!|} K8PX8`cHE``g;¤8( `c81899=+4^H`b@,@KT`8}81KY`|8+dK`KT`8`8!|} KT8PX8`cHE``g;¤8( `c80899=*^H`b@,@KS`8}80KXm`|8+K`KTQ`8`8!|} K8PX8`cHDY``g;¤8( `c8/899=)^H)`b@,@4KS1`8}8-KW`|8*hK-`KS`8`8!|} KcKUA((#@A@8PX8`cHC``g;¤8( `c8,899=^Hi`b@,@tKRq`8}8+KW`|8Km`KR`8`8!|} K<;@K C NiHostToAddr3||yab@!QA`8b, @8bxX8p88ccH\I`,@p8b8x08HH8PX8`cHB%``g9B8(" `c8w899)|JH`,A$a8!8`}N KP`" `8w8iKUm`8" `8K`KQI`8`a8!}N ,@|}KPq` `88|KT`~88)cKU`KP`p8b8x088b0c8,@ 8`H49"c8 `X889))H`8`8!}aN AHNiGetLoopbackAddr|T>,$X!q@8µP8`cH@``g;¤8( `c8899=)p^H`b@,@\KN`8}8KSm`|8)K`KOQ`8`8!}N 8`8!}K88cHau`8!}N A( NiAddrToHost2|T>,$X!q@8µP8`cH>``g;8(" `c8899))p]Hy`b@,@`KM`" `88iKR `" `8)Ku`KM`8`8!}N 8`8!}N 88cH``8!}N A$NiAddrToHostCanon2|!Tc>8Hm`8!p}N A,NiSetHostBufTimeout|!Tc>8Hm-`8!p}N A,NiSetHostBufTimeoutInvalid|!8Hn1`8!p}N A(NiGetHostBufTimeout|!8Hm`8!p}N A(NiGetHostBufTimeoutInvalid||y`!q@8P8`XH;``g;¤8( `c8899=^H`b@,@KJ`8}8KO5`bX8 cK`KK`8`8!}N cKA((# @,>@48P8`XH;``g;¤8( `c8899=^H`b@,@LKI`8}8KNi`bX8cK`KJI`8`H8P8`XH:i``g;¤8( `c8899=8^H9`b@,@KIA`8}8KM`bX8|cK9`KI`8`HX8cX8p8Ha`,@lapHҕ`~8`8!}N 8!}N 8`8!}N 8!}N A NiServToNo|`Tc>T>!qH}`,?Tc>X@8P8`cH8``g;¤8(" `c8 899)^H`b@,@`KG`" `8 8iKL`}" `8 K`KG`8`8!}N 8`8!}N ccc8Hb`8!}N AD NiNoToServ2||y`!axA cKA((#@A8PX8`cH7-``g;¤8( `c8 899=(^H`b@,@\KF`8}8 KJ`|8)K`KFy`8`8!}N 8`8!}Kcx8H9`8!}N |c8H `8!}N AtNiMyAddrVerify||y!axAcKQA((#@A8PX8`cH5``g;8(" `c8 899)(]He`b@,@`KDm`" `8 8iKH`" `8)Ka`KD`8`8!}N 8`8!}N c8x8H`8!}N A< NiMyAddrCheck|T>!1a8aHd`a,@48b8Јa8T8|d*(AT|iN a8!}N a8!}N a8!}N 8PX8`cH3``g9B8( `c8 Hp899<(\JH`b@,@@KB`8|8 IKG%`~88(cKG`KC`8`8!}N b@,@dKB%` `8 /8~KF`bX88(tccKGM`KB`8`8!}K8`8!}N A NiGetParam|T>;¤8T88!A8H(|(*A | N 8PX8`cH2``g^8(" `c8 op899)(\H`b@,A(8!8`}HK@`" `8 p8iKEE`}" `c8(\KE`KA!`8`8!}Hta8Hda8HPa8H`8}8 KC`|8,K`K>`8`8!}aN 88H%`|c8!}N 8PX8`cH.``g;¤8( `c8 899=^H`b@,@PK=`8}8 KB5`|8K`K>`8`8!}aK8`8!}N 8P8`XH.``g;8(b `c8 p899;\H`,b@A`,@K<`8{8 KAa`bX8 ccK`K==`8`8!}aK@,A$K`|8K`K:`8`8!}aK8`8!}N 8P8`XH*}``g;8(b `c8 p899;\HI`,b@A`,@K9I`8{8 K=`bX8 ccK=`K9`8`8!}aK@,A$K8`bX8 8cKC`K9i`8`8!}aK AXNiWritePending|`,||!AA,AH)m`T`>, Ax8bPXcH) ``g9"cB `8(88c9J(ZApAx)AH`8!}N 8`H`aHU``daK`,@8`H`;µPcK`,@(8`H`KyA(|ApKXcH(!``g9"cB `8(88c9J(ZApAx)AH`8!}K8!}N 8`cH}`8P8`Hi`8!}N ANiErrSet,ab@|!QA|,AK6%`bX8c `8(cK@`K6`8`8c8H`,Ax,@laxK5` `8 8~K:M`bX88(4ccxK:`K6!`a8!}N a8!}N 8`8c8H`,AKT8PX8`cH%``g;8( `c8 899<']H׽`,@8K4`8|8 K9Y`8'K`K5=`8!}aN ANiWait|X!|cHY-`8!p}N A,NiErrStr|!Tc>HQ`Tc>8!p}N A, NiNetServno|!Tc>H1`Tc>8!p}N A, NiHostServno|`,a``|{!AA8bXT8`| @8b8{`$|p|xEx.| P|*$pA |@8,>@8PX8`cH#Q``g;8(" `c8 899)]H!`b@,@(K2)`" `8 8iK6`" `8K`K2`8`8!}aH|`*$, @8PX8`cH"``g;¤8( `c8 899=^HY`b@,@`K1a`8}8 K5`|8K]`K1`8`8!}aH($, "@8PX8`cH!``g;¤8( `c8 899=^Hӥ`b@,@K0`8}8 K5=`|8,K`K1!`8`8!}aHt88T9Hq`,A$a8!|c}N aH`a8!~8`}N 8P8`XH ``g;8( `c8 ap899<]Hҍ`,b@A`,@K/`8|8 K4`bX8 cfcK`K/`8`8!}aHL,A0K/1`bX8 8cK9`K/`8`8!}aN AD NiHdlGetPeer|`,a`|{!QAp8bXT8`|(@X8b8{`$|p|xEx.|(Pc|c$pA( |@,$Al,>A$, A$, "@8PX8`cH``g;¤8( `c8 +899=^HЍ`b@,@8K-`8}8 +K2%`|8,K`K. `8`8!}aN @HcPH`a8!~8`}N 8PX8`cH``g;¤8( `c8 *899=^Hϕ`b@,@@K,`8}8 *K1-`|8K`K-`8`8!}aK8PX8`cH``g;¤8( `c8 &899=^H`b@,@K+`8}8 &K0`|8K`K,i`8`8!}aK`8PX8`cHu``g;¤8( `c8 %899=|^HE`b@,@K+M`8}8 %K/`|8KI`K+`8`8!}aK8P8`XH``g;8( `c8 #ap899<]H͝`,b@A`,@@K*`8|8 #K/-`bX8 cfcK`K+ `8`8!}aK,AK*A`bX8 8cK5`K*`8`8!}aK ANiHdlGetSavedPeer|`,a```|{!QA8bXT8`| @8b8{`$|p|xEx.| P|*$pAx |@l,=A8*$, @,'8A8P,A,c88P89H=`|`,@,>A8@,A,c88@c89H`,@8aHI`a8!}8`}N a8!}N `a8!}N $, "@<,>Ahp~,'xaA\8aKL8c88Tc9H`,|`Aa`8!}Kh8PX8`cHU``g;8(" `c8 B899)]H%`b@,@@K'-`" `8 B8iK+`" `8K!`K'`8`8!}aN 8P8`XH``g;8( `c8 @ap899<]He`,b@A`,@xK&e`8|8 @K*`bX8 cfcKY`K&`8`8!}aK8,AK& `bX8 8cK0`K&`8`8!}aK A NiHdlGetName|`,T>|~!aAX8bXT8`|(@@8b8{$|p|xEx.|(Pc|c$pA |A@8P8`XH``g9B8( `c8 ~p899<JHǹ`,b@A,@hK$`8|8 ~K)I`bX88 ccK`K%!`8`8!}N 8`8!}K,AK$)`bX88 8cK.`K$`8`8!}K8Hk`|c8!}N ANiHdlSetBlockmode|`,|~!aAX8bXT8`| @@8b8{$|p|xEx.| Pc|c$pA |AD8P8`XH``g;8(" `c8 p899)\ Hŝ`,b@A,@lK"`b `8 8cK')`bX `c 8 cK`K#`8`8!}N 8`8!}K,AK" `bX `8 8 cK,`K"`8`8!}Kc%8!N ANiHdlGetBlockmode|`,a|~!QA8bXT8`| @8b8{$|p|xEx.| Pc|c$pAЀ |@Ĉ$, A$, "@8PX8`cH``g;¤8( `c8 899=^(HÁ`b@,@8K `8}8 K%`|(8,K`K `8`8!}aN H `|c8!}N 8PX8`cH``g;¤8( `c8 899=^(H¥`b@,@PK`8}8 K$=`|(8K`K !`8`8!}aK$8`8!}N 8P8`XH ``g;8(b `c8 p899;\(H`,b@A`,@K`8{8 K#i`bX(8 ccK`KE`8`8!}aKH,A,K}`bX(8 8cK)A`K`8`8!}aK AHNiHdlGetStatus|`,|~!aAX8bXT8`|@@88{$|p|`xEx.|g0P|$pA |AD8P8`XHU``g9B8(" `c8 p899)J0H!`,b@A,@lK!`b `8 8cK!`bX8c `8 c0K `K`8`8!}N 8`8!}N ,AK`bX88 `8 c0K'M`K`8`8!}K8&8`8!|1N A NiHdlSetTrace|`,a|~!QAX8bXT8`| @@8b8{$|p|xEx.| Pc|c$pA |A<8P8`XH M``g;8(b `c8 p899;\8H`,b@A,@hK`8{8 K`bX88 ccK `K`8`8!}aN 8`8!}aK,AK`bX88 8cK%M`K`8`8!}aKc&8!N A NiHdlGetTrace|8b@!8p8pH %`8!}N A4 NiSetTraceAll|8b@!8p8pH`8!}N A4NiClearTraceAll|`,|~!aAX8bXT8`| @@8b8{$|p|xEx.| Pc|c$pA |A$8P8`XH ``g9B8(" `c8 p899)J@Ha`,b@Ap,@LKa`b `8 8cK`bX8c `8 c@K}I`K`8!}N ,AK`bX88 `8 c@K"`Ki`8!}N 88H `8!}N A NiHdlDump|`,aT>|~!QA`8bXT8`|0@H8b8{$|p|xEx.|0Pc|c$pA |@ ,$@8PX8`cH}``g;¤8( `c8 899=^HHM`b@,@\KU`8}8 K`|H8K{Q`K`8`8!}N 8`8!}aN H`|c8!}N 8P8`XH``g;8(b `c8 p899;\HHM`,b@A`,@TKM`8{8 K`bXH8 ccKzA`K`8`8!}aK,AK`bXH8 8cK`Km`8`8!}aK A NiHdlDump2|8b(!8H`8!p}N A, NiDumpNiHdls||+ya!A@8P8`XcH``g;8(" `c8 899)]PH`b@,@`K`" `8 8iK)`" `P8 Kx`K `8`8!}N 8`8!}aN |8cH,@T;b8a8T8|d*(A4|iN 8`Аa8!}N 8PX8`cHy``g[P8( `c8 x89p9<%HA`b@,@ KI`8|8 K`~P8%cK}`K`8`8!}aK̀8`Аa8!}K 8`Аa8!}N 8!}N A NiGetHdlParam|`~,aA`|z!AA(A|8bXT8`| @d8b8{@$|p|xEx. P||$pA4 |@(,?Ax$, "AĈ$, AL,$A@8cg| GN!A(,@T, A , 2A8PX8`H)``g;8(b `c8 HAx89p9;%\XH`b@,@DK`8{8 IK`~(X8%cGcK%`K]`8`8!}AaN 8cCHA8!8`}N 8`A8!}N |cA8!}N 8PX8`cH``g;¤8( `c8 +899=^XH`b@,@K`8}8 +K1`|X8,Ks`K`8`8!}AK8PX8`cH!``g;¤8( `c8 '899=%h^XH`b@,@HK `8}8 'K`|X8%Kr`Km`8`8!}AK8P8`XH}``g;8( `c8 %Ap899<]XHI`,b@A`,@K I`8|8 %K`bXX8 cFcKr=`K `8`8!}AKX,A,%aA`|!1A88`8Ęa((@XAT8bxH8c|0*| N 88H98!}N 8PX8`cH)``g;Bb `c8(px88 x99;%Z`H`b@,@@K`8{8 yK `~`8%ccK )`Ka`8`8!}AaN 88H5K88H8!}N 8PX8`cH``g;¤8( `c8 [899=^`H`b@,@PK`8}8 [K i`|`8 Kk`KM`8`8!}AK8`8!}N A NiSetHdlParam|`~,aA`|z!AA(A8bXT8`| @8b8{@$|p|xEx. P||$pA |@x,?A$, "A $, AL,$A@8c g| GN!A(,@, A, 2A, 3Ax, =@, @, @8b@,@HK` `8 8}K `~(88'|cFchKi`Ke`cHHY`&b@, @,@PK` 88b `8'h"~(cKA`8K`8`A8!}N ,AK`~(8" `8'chK`K`K8PX8`cH``g;¤8( `c8 899=&^hHy`b@,@8K`8}8 K`|h8'8Kh}`K`8`8!}AaN 8PX8`cH``g;¤8( `c8 899=&|^hH`b@,@|K`8}8 KU`|h8&Kg`K9`8`8!}AKD8PX8`HI``g;8(b `c8 Ax89p9;%\hH `b@,@K`8{8 K`~(h8%cGcKE`K}`8`8!}AK8A8!8`}Kl, A8PX8`cHY``g;¤8( `c8 899=&^hH)`b@,@K1`8}8 K`|h8&@Kf-`K`8`8!}AKcCH8`A8!}K|cA8!}N 8PX8`cHa``g;¤8( `c8 899=^hH1`b@,@K9`8}8 K`|h8,Ke5`K`8`8!}AK8PX8`cH``g;8(" `c8 899)%h]hH`b@,@HK`" `8 8iK`" `h8%Kd`K`8`8!}AK8P8`XH ``g;8( `c8 Ap899<]hH`,b@A`,@K`8|8 Ki`bXh8 cFcKc`KE`8`8!}AKP,A4K}`bXh8 8cK A`K`8`8!}AK ANiSetHdlParamEx|`,aT>||!QA`8bXT8`|(@H8b8{$|p|xEx.|(Pc|c$pAc |@ L!HL"Bb@@ 8P8`XH5``g9B8( `c8p899=JH`,Ad,@K`8}8K`bX88 ccKa`Km`8`8!}aH,AK`bX88 8cKe`K`8`8!}aH88{$|p|`xEx.|g0P$, @8PX8`cH``g;¤8( `c8899=^H`,@K`8}8Ke`|8K``KI`8`8!}aH$, "@8PX8`cHI``g;8( `c8899<]H`,@8K%`8|8K`8,K`!`K`8`8!}aN 8cd|,ALK`(( `8cA88V8%4cK]`K`8`8!}aN ANiSetSingleRead|`|#yaA!T>!!@8P8`XcH``g;8(" `c8 899)`]xHy`b@,@K`" `8 8iK `" `x8K^u`K`8`8!}H,#@(@8PX8`cH``g;¤8( `c8 '899=^xH`b@,@(K`8}8 'KM`|x8K]`K1`8`8!}H8cbK]`8`8!}H, @(@(@8PX8`cH``g;¤8( `c8 3899=^xH`b@,@,K`8}8 3KQ`|x8K\`K5`8`8!}H cb ` ?8K1`8`8!}H(.X@8P8`cH``g;¤8( `c8 A899<4^xH`b@,@8K`8|8 AK]`}x8lK[`KA`8`8!}N 8ccbHa`,AĠH`T}>H`T|>H`T{>H`Tz>H`Ty> H}`Tx> Hm`Tw>H]` `T`>bhcI8*p~axKy`8`8!}!AaN A  NiAddrToStr|T>T>!axK,A8PX8`cH``g;¤8( `c8 g899=$^H`b@,@\K`8}8 gK!`|8% KY`K`8}8!}N 8}8!}Kax8!}N A NiAddrToStr2|}&aA|y`!`T>!AA,$A,%AL(\A8`8, @p```!8T>*@L|, A|T0,%@(`!8T>|(0(@T0,%A;@4(@,8 |`!|*|00q@8C 8(@<8T> |```!}*U>|0,&@8C x`$c|cT>c.;`;[`xK-,@ " `c8KMU`cKIA(, @(@A,8|}@P8cEKqA(8`|8!} !AaN H`d8apc8px |Ka,A|K,8|@`8ceKA(K\cc8K,@HK@8!|} AaN ;Kx;K,8| K8PX8`cH``g;¤8( `c8 z899=@^Hq`b@,@8Ky`8}8 zK `|8xKUu`K`8`8!}N 8PX8`cH``g;¤8( `c8 y899=`^H`b@,@K`8}8 yKU`|8KT`K9`8`8!}KL8PX8`cHE``g;¤8( `c8 x899=^H`b@,@K`8}8 xK`|8KT`K`8`8!}K8P8`XcHߝ``g;8(" `c8 w899)|]Hm`b@,@4Ku`" `8 w8iK`" `8KSi`K`8`8!}K CNiAddrMaskToStr|a````!A`88HI,@, @8PX8`cH]``g;8( `c8 ap899,Ax,Ap, @8`p{da|T8|PA8 Te|0|)8T(@88` 8|````!|8cT>|!C ::, :@l:8:!:8`., :@,6Ab#:8.KCA(|ctb28:1!xb#8:KCA(,#aA0``!8ca:8:KCUA(,#@a|(@ z|d8`!88cT>|(A, A b#88HA(`r-5, .Ah, xA`, *AX@, @A ,U@|0@A~Q,A|A, :@(@,zC Hq`z8T>|~#.a:#K8PX8`cH9``g~px;bc8(88T99:[H`b@,AK `~8ccK`K`K, @(A`,6A,Az&8|A8(@48`T>8 |``!|8cx|#.C zC Ho`z|~#.,<Ax|48T@,@ 8`Kcc88\KU,AK` 8bX88c8cbcK`8K]`8`K\8PX8`wcHu``g8(px;c88t99:L\HA`b@,AKI`~8lcbK `K`K8PX8`cH``g~px;bc8(88l99:[H`b@,A`K8PX8`cH}``g~px;bc8(88c99:[HE`b@,AKD8PX8`cH``g~px;bc8(8899:[H`b@,AK`~8 ccK`Ka`K`8PX8`cHԁ``g~px;bc8(!88J99: 4[HE`b@,AKM`~8 Xccb(K `K`K8PX8`cH``g~px;bc8(88B99:[H`b@,@K\b#88 H{mA(,#A| @@@ b H:,c~A$, A|=;{` ==zz((@L:".8|b#T>8.K8T>,2A(@4, *@(8A:||~1:|5@A:`, AP8PX8`cHq``g~|px;bc8(88899:[H9`b@,AK\8PX8`cH ``g;8(pc88 99: |\H`b@,AK`~8 cK`Ka`K`(@<(@88`88||```!8, 0,1A0, xA,@A,8|ݘ: |(0|x|8cC Kt8PX8`cH``g;8(pc8899: |\H`b@,@K8PX8`cHС``g;|p|cax8(88"99:\He`b@,AKm`~8 ccgK1`K`K |ޘ8|08c|3x|C KX8PX8`cH``g;|p|cax~]8(88,9\9: H`b@,ATKީ`~8 ccgcKi`K!`K b#88 Hw1A(|| @@|r,A,A |~Kt8PX8`cH``g|pA;b|cx8(88 99: 4[H`b@,AtK`~8 XccbHK`KA`K@8PX8`cHa``g;|p|cax8(88 99:\H%`b@,AK,~֪V>A|yxd$| A8(@T8` |`!|8T>8c|!C K$8PX8`wcH͝``g8(px;c88 99:L\Hi`b@,@,K8PX8`cH9``g~px;bc8(88 99:[H`b@,AKb#K3yA(Tr>bPKbK8w8PX8`cH̭``g8(px;c88 99:L\H~y`b@,A,K8(A48PX8`cHA``g~px;bc8(88 99:[H~ `b@,AK(@8K8PX8`cH``g~px;bc8(88 99:[H}`b@,@K<8PX8`cH]``g~px;bc8(88 o99:[H}%`b@,AK$8PX8`cH``g;8(pc88 \99:! ]H|`b@,AxK`|8!0cK`KM`KL:K8PX8`cHe``g;8(pc88 299:\H|5`b@,@DK8PX8`cH``g8(px;c88 +99:L\H{`b@,AK8PX8`cHɡ``gpx;bc8(88 99:[H{i`b@,AKq`~8ccK5`K`K8PX8`cH ``g;¤8( `c8 899=`^Hz`b@,@K`8}8 Ku`|8K<`KY`KX8P8`XcHy``g;¤8( `c8 899=|^HzI`b@,@KQ`8}8 K`|8K899=^Hpa`b@,@Ki`8}8>K`|8K2e`K`8`8!}KL8PX8`cH``g;¤8( `c8=899="^Ho`b@,@K`8}8=KQ`|8"K1`K5`8`8!}K8PX8`cHA``g;¤8( `c8<899="l^Ho`b@,@4K`8}8!qA(@8PX8`cH``g;¤8( `c8p899=l^Hk`b@,@8K`8}8pKͅ`|8K-`Ki`8`8!}N ` ``8K A(8`8!}N 8PX8`cH=``g;¤8( `c8o899=^Hk `b@,@XK`8}8oK̥`|8@K-`Kȉ`8`8!}K A NiServToStr||#yT`>!qA(@8PX8`cHA``g;8(" `c8899)l]Hj`b@,@@K`b `88cK˥` `8K, `KDž`b `8!8c}N c ``8K)A(c8!}N 8PX8`cHU``g;8(" `c8899)]Hi%`b@,@TK-`b `88cKʹ` `8@K+!`Kƙ`b `8!8c}K A NiServToStr2|!8pKd,A@,@daKe` `88K`bX88cKʑ`K`8`08! }N 8`08! }N a8Kc,@\;ap;| @<8````!88apT>(@d||d| A|apT0T0|# @8````!;|0|0(@Tc0T0|# A8ap88.8K 8a88.8Kb@{$||,@ 08! c}N K`bX888 `c8cKΑ`KI`c08! }N @,@paKq` `88K`bX88cKȝ`K`8`08! }K$ ANiGuessDistance|`x~'aATz>c!QK*A(,#A;,:`A x;`!{ }{`&|Hq`;,@|<@Ac[,;A,``!{ x&|"H`;|>@AcK*A(c8!}AaN yAK8PX8`cH``g;b" `c8(p8899)H[Hdq`b@,@lKy`" `88iK`}" `c8hK)%`K`8`8!}AaK 8`8!}AaK ANiGetMaxSockets|`,|~!aAX8bXT8`| @@8b8{$|p|xEx.| Pc|c$pA |A@8P8`XH``g9B8( `c8/p899<JHb`,b@A,@hK`8|8/Km`bX88 ccK$`KE`8`8!}N 8`8!}K,AKM`bX88 8cK `K`8`8!}Kc$8!N ANiHdlGetConStat|`,a|~!QA8bXT8`| @8b8{$|p|xEx.| Pc|c$pAȀ |@$, A$, "@8PX8`cH``g;8(" `c8C899)]H``b@,@@K`" `8C8iKU`" `8,K"`K5`8`8!}aN c8!N 8PX8`cH``g;¤8( `c8B899=^H_`b@,@PK`8}8BK`|8K!`Ki`8`8!}aK48`8!}N 8P8`XHU``g;8(b `c8>p899;\H_!`,b@A`,@K!`8{8>K`bX8 ccK!`K`8`8!}aKX,AN ANiHdlGetStartTime||yX!a@8P8`cH``g;¤8( `c8899=^HQy`b@,@\K`8}8K`|8K}`K`8`8!}N 8`8!}K88c8ap8pHi`,@ 8b p hcTcap@ 8Xap\ap8THu`,pA88|8`H1`c8!}N 8`8HH`p8`8!} N Xb 8p\ap8TH`,pA8|8`H`KX8!}N A\ NiDgHdlCreate|`,a8````!AA8bXcTc8`e|(@8b8{d$|p|xEx.|(Pc"}$pcA |@,>@8PX8`cH``g;8(" `c8899)] HN`b@,@K`" `88iK`" ` 8K}`K`8`8!}aHЈ}$,#HA}$,#GA8PX8`cH``g;¤8( `c8899=$^ HM`b@,@HK`8}8KQ`| 8K`K5`8`8!}aHb h8X pcT@|AH |(A8PX8`cH ``g;¤8( `c8899=,^ HL`b@,@hK`8}8Kq`| 8pK`KU`8`8!}aH0\b c|A8PX8`cHM``g;¤8( `c8899=^ HL`b@,@K%`8}8K`| 8K!`K`8`8!}aHt~|#AH2M```8c8H`,@LaH2Y`a8!~8`}N 8P8`XH9``g;8( `c8ap899<] HK`,b@A`,@K`8|8K`bX 8 cfcK `Kq`8`8!}aHL,A0K`bX 8 8cKm`K%`8`8!}aN a8!}N AL NiDgHdlBind3|``aA`z8b@,!!]caA8bXT8`| @8b8{$|p|xEx. Pc|{$pAc |@;@,>@8PX8`cH``g;¤8( `c8899=^(HH`b@,@8K`8}8K`|(8 K `Ki`8`8!}AaN cK A((# @0$, HA$, G@b h8X pcT@P|@\b c|@ ,?A, @c@cX88H`,Ah@,@aK` `88Ka`|(88tccc(K`K1`Kc888Hu`8!}AaKcKA((#@bXA8P8`cdH``g;¤8( `c8899=^(HF`b@,@ K`8}8Km`{(8K`KQ`Kc8cg88HQ`,At@,@aKm` `88~K`|(88Hccc(K`K`K`8PX8`cH``g;¤8( `c8899=^(HE`b@,@K`8}8KQ`|(8K`K5`K8PX8`cHU``g;¤8( `c8899=,^(HE%`b@,@pK-`8}8K`|(8pK)`K`K8|(@hK8PX8`cH``g;¤8( `c8899=$^(HD`b@,@K`8}8K`|(8K`K`K8PX8`cH!``g;¤8( `c8899=8^(HC`b@,@!QH(`Te>,A 8XT8`|0@88{`$|p|xEx.|0P|$pAĀ |@,>@8PX8`cH``g;8(" `c8899)|]0HA`b@,@@K`" `88iK1`" `08K`K`8`8!}aH`}d$, HA$, GA8PX8`cH``g;¤8( `c8899=$^0H@`b@,@lK`8}8Ka`|08K`KE`8`8!}aH4b h8X pcT@|AH |0A8PX8`cH``g;¤8( `c8899=,^0H?`b@,@K`8}8K`|08pK`Ke`8`8!}aHT\b c|A8PX8`cH]``g;¤8( `c8899=^0H?-`b@,@K5`8}8K`|08K1`K`8`8!}aHcc88H`,A(a8!|c}N 8c8G0H`8`a8!@HP}N 8P8`XH%``g;8( `c8ap899<]0H=`,b@A`,@K`8|8K`bX08 cfcK`K]`8`8!}aHL,A0K`bX08 8cKY`K`8`8!}aN A`NiDgHdlConnect|`,aA``T>|z!!A8bXT8`|@8b8{@$|p|xEx.|(Pcc$pAT |@H,$A$, HA$, G@b h8X pcT@|@\b c|@<$, G@|```!8{Tc88H]`,A,@,>A b@&,,@@P,@H(88Pa8{@%8@T8 `ap8x["9HHU`8`8!}AaN ["88 `apx9HH`K9b `9@O8b8ce8T9x99 A9@ 8pH`|c8!}AaK`8PX8`cHU``g;¤8( `c8H899=p^8H:%`b@,@8K-`8}8HK`|88K)`K`8`8!}AaK8PX8`cH``g;¤8( `c8F899=^8H9q`b@,@Ky`8}8FK `|88Ku`K`8`8!}AKL8PX8`cH``g;¤8( `c8E899=,^8H8`b@,@K`8}8EKa`|88pK`KE`8`8!}AK|0@TK\8PX8`cHE``g;¤8( `c8D899=$^8H8`b@,@(K`8}8CK`|88K`K`8`8!}AK8PX8`cH``g;¤8( `c8A899=^8H7m`b@,@Ku`8}8AK`|88Kq`K`8`8!}AKH8P8`XH``g;8( `c8=Ap899<]8H6`,b@A`,@K`8|8=KU`bX88 cFcK`K1`8`8!}AK,AtKi`bX88 8cK-`K`8`8!}AKD A NiDgHdlSend|``aA`{`!aT>!T>H=`Tf>,zA$8XT8`|@ 88{@$|p|xEx.|(P|$pA܀ |@,>A,,=A`{dC$, HA$, G@8Tb h8X pcT@|@\b c|A8PX8`cH``g;¤8( `c8899=^@H4u`b@,@8K}`8}8K `|@8Ky`K`8`P8!@}!AaN 9cCc8H`,A@,@L|K` `88~Kq`z(88$cc@K`KI`8`P8!@}!AaKXa``!8zTcc%889!9AHQ`,A,@,<A b@&,,@@P,@H(8ba#@@Tc `ap88xZ"89HH`8`P8!@}!AaKxZ"c8 `88apx9HHy`8`P8!@}!K9b `9@8b8cE8T9x99!A9A @pHu`|cP8!@}!AaK8PX8`cH``g;¤8( `c8~899=,^@H1`b@,@HK`8}8~K`|@8pK`K`K|8@hK`8PX8`cH``g;¤8( `c8}899=$^@H0`b@,@K`8}8|K}`|@8K`Ka`Kp8PX8`cH~``g;¤8( `c8z899=^@H0Q`b@,@KY`8}8zK`|@8KU`K`K8PX8`cH}``g;8(" `c8y899)|]@H/`b@,@K`" `8y8iKQ`" `@8K`K1`K@8P8`XH}U``g;¤8( `c8uAp899=^@H/!`,b@AL,@K!`8}8uK`bX@8 cFcK`K`K,AK`bX@8 8cK`KU`Kd AX NiDgHdlSendTo|`,aA``!aT>!|yA8bXT8`|@8b8{ $|p|xEx.| PcC$pA |@x,&AȈ$, HA$, G@b h8X pcT@|@(\b c|@` ````!8zT ce889l9!9AHq`,A, @؈&b@, @,@LK` 88bc& `80Hz(cK`8K}`8`p8!`}!AaN ,AK`z(8c& `80cHKY`K`K,@,<A ,>@@`,=@,@z&,#@,@cC88T8899!9ApH`z&,,@@H,@@(8b#H@P8a `Z"88p89TH`8`p8!`}!AaKZ"8a8 `88p9THI`8`p8!`}!KcC88T8899!9ApH`aH`}KcC88T8899!9ApH`a,=~@K9b `9@8b8cE8T9x99 A9@ HpH`|cp8!`}!AaKx8PX8`cHw``g;¤8( `c8899=^HH)`b@,@8K`8}8K]`|H8K`KA`8`p8!`}!AaK8PX8`cHwA``g;¤8( `c8899=,^HH)`b@,@K`8}8K`|H8pK`K`8`p8!`}!KL|(@TK,8PX8`cHv``g;¤8( `c8899=$^HH(]`b@,@Ke`8}8K`|H8Ka`K`8`p8!`}!K8PX8`cHu``g;¤8( `c8899=^HH'`b@,@(K`8}8KM`|H8K`K1`8`p8!`}!K8P8`XHuA``g;8( `c8!p899<]HH' `,b@A`,@xK `8|8K`bXH8 c&cK`Ky`8`p8!`}!K8,AK`bXH8 8cKu`K-`8`p8!`}!K ANiDgHdlRecvFrom|`,a|~!QA8bXT8`| @8b8{$|p|xEx.| Pc|c$pA |@$, HA$, G@ h8X pT@| @\ | A8PX8`cHs1``g;¤8( `c8899=^PH%`b@,@8K `8}8K`|P8K`K}`8`8!}aN 88Hwe`|c8!}N 8PX8`cHrM``g;¤8( `c8899=,^PH$`b@,@TK%`8}8K`|P8pK!`K`8`8!}aK|0@TKX8PX8`cHq``g;8(" `c8899)$]PH#i`b@,@Kq`" `88iK`" `P8Ke`K`8`8!}aK`8P8`XHp``g;8(b `c8p899;\PH"`,b@A`,@K`8{8KI`bXP8 ccK`K%`8`8!}aK,AK]`bXP8 8cK!`K`8`8!}aK\ A( NiDgHdlClose|`,a|~!QA$8bXT8`|(@ 8b8{$|p|xEx.|(Pc|c$pA܀ |@Ј$, A$, "Ah h8X pT@8|(@\ |(@,$A, @ (@ T6, AȈ, A8PX8`cHn``g;¤8( `c8.899=^XH e`b@,@8K}m`8}8.K`|X8Ki`K}`8`8!}aN 88H`|c8!}N 8PX8`cHm``g;¤8( `c8-899=8^XH`b@,@TK|`8}8-K`|X8dK`K|`8`8!}aK8PX8`cHm ``g;¤8( `c8,899=^XH`b@,@K{`8}8,Kq`|X8K`K|U`8`8!}aKt8PX8`cHla``g;¤8( `c8+899=,^XH1`b@,@K{9`8}8+K`|X8pK5`K{`8`8!}aK|8@TK8PX8`cHk``g;¤8( `c8*899=^XH}`b@,@PKz`8}8*K`|X8,K߁`Kz`8`8!}aK8PX8`cHk``g;¤8( `c8)899=^XH`b@,@Ky`8}8)K~m`|X8K`KzQ`8`8!}aKp8P8`XHja``g;8(b `c8%p899;\XH-`,b@A`,@Ky-`8{8%K}`bXX8 ccK!`Ky`8`8!}aK,AKx`bXX8 8cK`KyM`8`8!}aKl AT"NiDgHdlJoinGroup__FiP11NI_NODEADDR|`,a|~!QA,8bXT8`|(@8b8{$|p|xEx.|(Pc|c$pA䀣 |@؈$, A$, "Ah h8X pT@8|(@\ |(@,$A, @ (@ T6, AȈ, A8PX8`cHg``g;¤8( `c8E899=^`H`b@,@8Kv`8}8EK{]`|`8K`KwA`8`8!}aN 88H)`|c8!}N 8PX8`cHg``g;¤8( `c8D899=8^`H`b@,@TKu`8}8DKzy`|`8dK`Kv]`8`8!}aK8PX8`cHfi``g;¤8( `c8C899=^`H9`b@,@KuA`8}8CKy`|`8K=`Ku`8`8!}aKt8PX8`cHe``g;¤8( `c8B899=,^`H`b@,@Kt`8}8BKy)`|`8pKٕ`Ku `8`8!}aK|8@TK8PX8`cHe ``g;¤8( `c8A899=^`H`b@,@PKs`8}8AKxu`|`8,K`KtY`8`8!}aK8PX8`cHde``g;8(" `c8@899)]`H5`b@,@Ks=`" `8@8iKw`" ``8K1`Ks`8`8!}aKh8P8`XHc``g;8(b `c8<p899;\`H`,b@A`,@Kr`8{8 `!!, 8@p,|}A8bXT8`| @8b8{$|p|xEx. Pc;\$|ЮpA|{ |A8PbX8`cdHE``g9B8(pc8899>JH`,b@At,@@KT`8~8KY%`{88 cK`KU`8`8!}AaN ,AKT%`{88 8K^`KT`K80P8H`,|`@0~`|(A|{Ю,#GA|{Ю,#HA `K<||8H}`|c8!}AaK8PbX8`cdHD``g9B8(pc8899>JH`,b@AKX8,|}AK ANiSetSO_ReuseAddr|`,a|~T>!1A8bXcTc8`e|(@8b8{$|p|xEx.|(Pc|c"$pA |@|$,$A `, 88@<08XH`|c8!}N 0X88HН`|c8!}N 8PX8`cHBE``g;8(" `c8<899)]H`b@,@hKQ`" `8<8iKU`" `8K`KQ`8`8!}aN 8`8!}N 8P8`XHAi``g;8(b `c88p899;\H5`,b@A`,@XKP5`8{88KT`bX8 ccK)`KP`8`8!}aK,AKO`bX8 8cKZ`KPU`8`8!}aK A NiSetSO_KeepAlive|`,a|~T>!1A8bXcTc8`e|(@8b8{$|p|xEx.|(Pc|c"$pA |@$,$A `88, 8@<08H͉`|c8!}N 088HM`|c8!}N 8PX8`cH>``g;¤8( `c8T899=^H`b@,@`KM`8}8TKR]`|8K`KNA`8`8!}aN 8`8!}N 8P8`XH>``g;8(b `c8Pp899;\H`,b@A`,@TKL`8{8PKQy`bX8 ccK`KMU`8`8!}aK,AKL`bX8 8cKWQ`KM `8`8!}aK ANiSetSO_Linger|`,a|~!1A8bXT8`| @p8b8{$|p|xEx.| Pc|c$pA@ |@4$, @8PX8`cH!1A8bXcTc8`e|(@8b8{$|p|xEx.|(Pc|c"$pA |@|$,$A `, 88@<@8HH`|c8!}N @H88H`|c8!}N 8PX8`cH/``g;8(" `c8899)]HU`b@,@hK>]`" `88iKB`" `8KQ`K>`8`8!}aN 8`8!}N 8P8`XH.``g;8(b `c8p899;\Hu`,b@A`,@XK=u`8{8KB`bX8 ccKi`K=`8`8!}aK,AK=`bX8 8cKG`K=`8`8!}aK A NiSetTCP_NoDelay|`~,aA`|!AA8bXT8`|(@8b8{$|p|xEx.|(Pc|c$pAȀc |@L!@A88{$|p|`xEx.|g0P$, A$, "Ah,:@8PbX8`cdH,``g;¤8( `c8899=d^Ha`,@8K;m`8}8K?`{8Ki`K;`8`8!}AaN 8};`|cc8h989`H`,A |z`|,@PK:`b `88{K?I`~(88ccGccK?`K;`,AD,@8`8!}K(C8!}AaK8PX8`H*``g9B8(" `c8px899)JH`8`8!}AaK8c88cKA,A,`z@~&,#@x,@LK9q` 8bcc `8 |~(cKD!`8K9`8`8!}AaK,AK8` 88bc `c8 ~(cKC`8K9Y`8`8!}AK`},`|@LK8`b `88{K=`~(88DccGcK=`K8`,,A;@,@cc\KAK,@܀|&, @p,@LK7` 8bc `8ȓ}~(cKB`8K8M`8`8!}Kd,AK7`~(8c `8cKB9`K7`8`8!}K8PX8`H'``g;b8(B `c8%x89p9:l[H`,@DK6`8z8&K;]`~(8ccK;`K75`8`8!}AaKT8PbX8`cdH'5``g;¤8( `c8899=^H`,@K6`8}8K:`{8,K `K6`K8PbX8`cdH&``g;¤8( `c8899=^Hu`,@LK5`8}8K:`{8K}`K5`K8P8`XH&``g9B8(" `c8p899)JH`,AX,@K4`b `88cK9u`bX8c `8 cK`K5I`Kh,A`K4`bX88 `8 cK?Q`K5 `K(L"BKH ALNiGetPeerVersion|`,a|~!QAX8bXT8`| @@8b8{$|p|xEx.| Pc|c$pAc |A<8P8`XH$m``g;8(b `c8<p899;\H9`,b@A,@hK39`8{8@ 8!8`}N aH`~8`8!}K8`8!}N 8PX8`cH!``g;¤8( `c8U899= $^H}`b@,@K0`8}8UK5`|8 TK`K0`8`8!}KLb pc|@(@8PX8`cH ``g;¤8( `c8X899= ^Hҽ`b@,@K/`8}8XK4U`|8 K`K09`8`8!}Kb `c|@(l@8PX8`cH -``g;¤8( `c8[899= ^H`b@,@K/`8}8[K3`|8$K`K/y`8`8!}K8PX8`H``g9B8(" `c8^89p9)XJHQ`8`8!}N 8PX8`cH``g;¤8( `c8R899= ^H`b@,@K-`8}8RK2`|8 0K`K.e`8`8!}K8PX8`cHq``g;¤8( `c8Q899= ^HA`b@,@HK-I`8}8QK1`|8 KE`K-`8`8!}K8P8`XcH``g;8(" `c8P899) 8]Hϙ`b@,@K,`" `8P8iK1-`" `8 `K`K- `8`8!}K` A NiConvSiAddr||y`aaT>!A,$A,(A( l@8PX8`cH``g;¤8( `c8899= ^Hm`b@,@8K+u`8}8K0`|8 0Kq`K+`8``8!P}aN 8a?8!88l9Hɑ`,Ad8PXa8`cH``g;8( `c8899? |]Hy`b@,@DK*`88K/`b ` p8 hc||( A88A`;A`{b x 8c|| A8;A`a88a HQ`8 ccgc`jc! K/ `K*A`8``8!P}aKX8`c!p8899AH7]`,@,>@$`8!P8`}N aH`~8``8!P}K8PX8`cH``g;¤8( `c8899= ^H˙`b@,@dK(`8}8K-1`|8 K`K)`8``8!P}aK,8µP8`XcH!``g;¤8( `c8899= 8^H`b@,@K'`8}8K,`|8 `K`K(m`8``8!P}aK At NiConvSiAddr2||y`ab@!QA,$@8PX8`cH``g;8( `c8899< ]H`,@8K&`8|8K+`8 K`K'e`8`8!}aN cK~ A((#Al,@axK&q` `88K*`bX88 cxK+`K&`8`8!}aKp,@ `c8 @Ka`,@Ȉ}8( @(cK}A(,A<8Q|@p,@K%`8~8K*A`bX8 d=cc89QcK`K&`8`8!}aK8`a8!}N 8 cK~`,@}8( @LcK}A(,A<8Q|@,@K$`8~8K)e`bX8 d=cc89QcK`K%5`8`8!}aK8 cK}`,@}8( Ad,@K$A`8~8K(`bX8 cccK5`K$`8`8!}aKHcK|A(,A(@8`| A<`| @h,@K#`8~8K(9`bX8<8 cc``cK`K$`8`8!}aK,AK#9`bX88 ccK-`K#`8`8!}aKLK"` 8bXc8 `c8 4cK-`8K#M`K8PX8`cHm``g;8(" `c8899) p]H=`,@K"I`" `88iK&`" `8 K=`K"`8`8!}aKP A NiTestPfParam||y`!AA$,$@8PX8`cH]``g;¤8( `c8899= ^H-`b@,@8K!5`8}8K%`|8 K1`K!`8`8!}N cKxQA((#@Al,@aK ` `88K%A`bX88 cK%`K!`8`8!}Kp,@ `c8 @Ky`,@̈}8( @(cKx9A(,A<8Q|@tb@,@K`8~8+K$`bX8 d=cc89QcK`K Q`8`8!}KTc>K8!}N 8 cKx`,@̈}8( @HcKwYA(,A<8Q|@tb@,@K`8~8@K#`bX8 d=cc89QcK`Kq`8`8!}KTc>Km8!}N 8 cKw`,@X}8( Ahb@,@XKU`8~8PK"`bX8 cccKI`K`8`8!}KcKvA(,A(@8`| A<`| @xb@,@K`8~8[K"I`bX8<8 cc``cK`K`8`8!}Kl8ax8appHE%`8!}N b@,AK`bX88 ccK'`K`8`8!}KK` 8bXc8 `c8 4cK'u`8K%`K,8PX8`cH E``g;¤8( `c8899= p^H`b@,@ K`8}8K `|8 K`K`8`8!}K A NiSetPfParam,#A(8 (8`N H @0 NiTcInitParam|`,|~!aAX8bXT8`|(@@8b8{$|p|xEx.|(Pc|c$pA |A@8P8`XH ``g9B8( `c8p899<J H]`,b@A,@hK]`8|8K`bX88 cc KM`K`8`8!}N 8`8!}K,AK`bX88 8c K$`KE`8`8!}KH`|c8!}N A NiTcAddHdl|`,|~!aAX8bXT8`| @@8b8{$|p|xEx.| Pc|c$pA |AD8P8`XH ``g;8(" `c8p899)\(H]`,b@A,@lK]`b `88cK`bX `c(8 cK}I`K`8`8!}N 8`8!}K,AK`bX `8(8 cK"`KA`8`8!}KH*A`|c8!}N A NiTcDelHdl|!H`8!p}N A$ NiTcCheck8P8`|Xc!qH``g;" `c8(8t899) ]He`b@,A8`8!}HPKY`" `8t8iK`" `8 HK{M`K`8`8!}N ANiTcInitParam@AF161_157```;|aAT>!A,@<, APb@,@@K!`b h88{`K`|8`8hKU`K`8b`cH|`y@`@,@PK`b h88{`KQ`bX8`8chKy`K)`8b`cH, A8«`||"H|,&A8«`H|9.88«`,%8|!.fHA``8 h| 88 hcH`g|(Px &c|(P|xFx.|eP|8d ``! h|18cC T888`T~8|* $PdP,#A 8`PKzmA(8`;`8,:~0&(c%:@88@Ph@&d, @,@XK` 8`cC~h("H%`g8aKU`8K`8`8!}AaN ,AK)`8`cC(h"H`g8aK`K`K,:@@88b@@PXchdpK,:@,88@T@HK8PX8`H=`g9B`8(Apc8`8$99=4JhH`b@,@@K`8}`8%K`|8`8LcFhKv `K`8`8!}AaK8PX8`H`g9B`;«X8(c h898`9?JhpHQ`b@,@KY`8`8K`|8`8hKuM`K`8`8!}AK@K`,A@a,@DK` h88`Km`|8`8lhK`KI`aA8!}N A#NiICreateHandle__FPP5NITABUcPP4FILE|8h`|~8!q((A8b`xH8c| *| N A8b`xH8cH| *| N 8b8!cN 8b8!cN 8b8!cN 8b8!cN 8b8!cN 8b 8!cN 8b(8!cN 8b08!cN 8b88!cN 8b@8!cN 8bH8!cN 8bP8!cN b h8!8c$N b h8!8cPN b h8!8cpN b h8!8cN b h8!8cN b h8!8cN b h8!8cN b h8!8cN b h8!8c N b h8!8c, "@x, 6Ad@8, GA$, H@b h8c N b h8c N b h8c N , 4A, 5@b h8c N b h8c N b h8c N ,@<,A(,A@b h8c N b h8c N b h8c N , A(, A@db h8c N b h8c pN b h8c hN @NiIStateText__FUc|`T>a;$!qc&, 4,A(@ b@{@,@XK ` 88b` h88p"(cK`8K I`{&,$, A$, A$, A$, @D@,@TK Y` 88b` h8p"(BRcK`8K `$T>, @xh, @\@,A8````!8@H>`,A,@8@P,Ah,>@L``!8P88l8Hs`,A,@, @```!8PH> `,A:, @$, A$8b8 h8`8@$eH|Px| |6t&|||*||"8, |A8«`|).fH|, A8c|).8`eHeH|8P,#A,$A08!d}aN `8!}dPaKАKp,@LK` h88~`K `bX8`8H"cpKk`KY`8`8!}aK\cHUK`c8p8P88899 9@He8aKjA(,@b,A,@K1` h88~`K `(8`88"cpKm`K`K9b` h9@8N8c8@99 A9@9`x ppH`}KcH`K$T>, A,$A(ce| EN!A(~, AT,A4```!8TH:`,A,@,8T8htlxK9b` h9@8b8c8T99 A9@9`x ppH`}KcHIKLcH``}K4,A`Ke`(8`" hBR8cpK`K`K $, "@@\,@K ` 88b` h8p"(BcK`8Ki`K,AK`(8`" hB8cpKm`K%`Kt@\,@hKm` 88b` h8p"(VcK`8K`K,AK`(8`" hV8cpK `K`K@X,@K` 88b` h8lp"(cK }`8K-`K|,AtKy`(8`" h8lcpK 5`K`K<,AK9`(8`" h88cpK `K`{&,Kdb@{KX AXNiICloseHandle__FP5NITABUcT2,)`|}&aA!`aT>``;aAaR:!:x`o8!Q 0! 8<@ }Hy``u~4bH``sbHu`(5@ h: ,(3@ h:d ,(#@ b h8c ,`r8(Ap:`xH8|*| N 8bȘ8Ƞ,c cTex |xT(@8@`9T`8(|8a<|#x8|v~8T>K `.6-9@p@l8bX,@\8bP<9A< ( ,$c@` @8(Apxc'9K`K 8bȘ98c8a |`|x|v~ 8T>A$, A$, "A$, @\808a<8cK-`( ,,A(A (,@b h:C 08 D@8 8 @8K (:!8@88@88H `8aH$P8a8`K`(|8 b8Hu`808a<88Ky`KL98bȘ(TA ( @,,8A$88a<8cK1`KH88a<8 h8K `K$988a<8K `K98Ș8¿8a<8TK`K98bȘ8ȠdTx`xE@8(A,(A$(A(A(A (@; x`pxK@8(A,(A$(A(A(A (@; ,8A$, A$, "A$, @D8 8a<8cK` 8a<8 hc8K`K(;a88@888@88H `8a8H!ɢP8a88`K`(|8 b8H=`8 8a<888KA` 8a<8 hc8K!`Kd(;a88@888@88H 9`8a8H!-P8a88`K=`(|8 c8H`8 8a<888K`.=Ab `c|Ab hc daf;d8ad8K`|8@8@8KI`8adH }8ad8K``{PH`Te>|{ h8LK A(8ad8KY`Ab `c|A hc8 KQ `}a`!8a88l8Ha`,A,@8cc8899!p9@H,@c8K`|8a8@8K5`cHic8K}``{aH~`Te>|{ h8LK A(c8KE` 8a<8 hc8K~`Kc h8 ,KO` 8a<8 hc8K~`K8dK 8bȘ( TA (@9(8@;a88@88Hy`8aHmP8a8`K}`(|8 b8H`808a<88K}`K988a<8K`K98Ș8¿8a<8TK`K98Ș8¿8a<8TK`K98Ș8¿8a<8TKa`KX98Ș8(8a<8TK5`8«X8a< h8KA(K :d`pca%899!9@H,@;dd, @8a8d8@8K`8adH8ad8K``srH|M`Te>|s h8LKA(8ad8K`K` CH9NiISystemError__FisPC5NITABPC7SI_SOCKT1PCcPCUcPCUsN26T1Uc`T>b h|a`U>c!|@p,)A b Hc i ,*Aa,#A 88`P8!@}aN b pc|@ ,)Ae iKb `c|@,)A8b΀c i,*A 8 ,<Ah`cKFU`,>@PKH=A(,#@@{,=a@;``!8a88l8H[`T`>,A, @Lcpcd88899 9@KAP8!@}aK9b` h8dc;c899 8 `9@x pK9|cP8!@}aK\;```!8a88l8H^`T`>,AK8PX8`KI`g;`8( hc8np8`99<]H`b@,@HK`8|`8oK`"(8 cKI`K`8`P8!@}aK` ALBNiISolveSockAddr__FPC5NITABPC7SI_SOCKPCUcUsUcT5P11NI_NODEADDRPUsPc`~;`|`!, A8c@88H-,AL`x`.xc$|P8e|.,%@,888!|.~}N 88!}~N px8!N ANiIAlDecCounter__FP5NITAB||y!qA;:, AD,%A,#A;@:,@c8!N K`bX8`" h8cKy`K1`c8!}N 8b`;@X:,@c8!K|8PX8`cK`g;`8(" hc8'V8`99)(]H`b@,@`K`" h8'V8i`Km`" h8PKP`KM`8`8!}N 8`8!}N ANiITcDelHdl__FP5NITAB``|aAT>;!!,A ;`Bz,#@$"y,#@x|A 4;B`z|A``8bΐ``!c8Hl`,A,@8" `y|A$(0```!c8H]`,A,|c@|@H0````!c8Hc`,A,|c@h80```!c8H]a`,A,|c@|@H0````!c8Hc`,A,|c@H~ x|@y|A:@H8``!c8Hb`,A|d,A ,@Tt0P8x`!c8HbQ`,A|d,A ,@X`!c8Hb`,A|`,,A0@4_"c8 h:x8889H &b@, @,@K` 8,; h8(cA8"|(@9$|(@h9Dx8KA`8K`8` 8!}!AaN 9D|(A9DK h|(@ 9$K\ p9$ |(AH9$K@,AlK`(,; h8cA8"|(@h9$|(@89Dx8K5`K`8` 8!}K 9D|(A9DK h|(@ 9$K p9$ |(Ax9$Kp`b h8:x8#c!pc9 `9 9@8 `xKKb h8x`8#cpc9 @9 9@8 `xKKb h8x`8#cpc9 <9 9@8 `xKmKl |@,;0P8```!c8H^`,A,|c@`||A```!c8H^Q`,A,|cAtb hx8B8#pcc9 9 P9@8 `xKyK0858#b hcxc9 p9 @9@8 `xK5K,8PX8`Kԝ`gZx8( h c8Hp8`99<Hm`b@,@XKu`8|`8IK`(,;8cA8"x8$> K`K`cH`8 8!8`}!AaN 9@b hx88#cpc9 9 A9@9k`axKKx9@b hx88!cpc9 9 A9@9k`axKK9@b hx88#cpc9 (9 A9@9k`axKaKX9@sb hx88!cpc9 (9 A9@9k`axKK9@ab hx88(pcc99 A9@9k`axKK8PX8`K9`g;`8(b hc8Dp8`99;4\xH`b@,@K `8{`8EK`(x8T9cK5`Km`K````!~ 8cH!`,A,A@|},@Ku`b h838c`K`b `(c|@ b h;cb x;B`c:x|@b h;8~8Hm` hc%cccg8`jcbK5`Km`b h899@cx8pcc99 A9@8 `xK8` 8!}!AaN b h;c|A `;Kb hc|@b h;cKb p h;d c|A`;cK;B`b h899@c8ccxpK;`K A  |"NiIInitSocket__FP5NITABP7SI_SOCKUc|`T>aT>T>`8!aa8ax!8AKA(8b `wXc|@,>@T\,=a@T;``!8a88l8HH`T`>,A, 8 A9b` h8 ;cc899 9@ 9l`axpKۭ8X8a 8lK9`b@|@,8!8`}aN K` 8x8 ~(cK`8Ki`8`8!}aKc8Tp88899 9@KKP;``!8a88l8HK`T`>,AKPHf` hTe>8a 8KA(K,<8@; @\(8 8@88H`8a HP8a 8lK!`(|8 c8H`K8 8@8K`8a H8a 8lK``~PHeE` hTe>|~8LKA(8a 8lK`K$ A%NiITracePeerAddr__FPC5NITABUcN22iPCce|8`|~8h!q((A 8b` hxH8c|(*| N Ap8b`xH8c | *| N b h8!8cN b h8!8cN b h8!8cN b h8!8cN b h8!8cN b h8!8c N b h8!8c N b h8!8c (N b h8!8c 8N b h8!8c DN b h8!8c TN b h8!8c \N b h8!8c lN b h8!8c xN b h8!8c N b h8!8c N b h8!8c N b h8!8c N b h8!8c N b h8!8c N b h8!8c N b h8!8c N b h8!8c N 8d 8!N 8d 8!N 8d 08!N 8d H8!N 8d X8!N 8d l8!N 8d 8!N 8d 8!N 8d 8!N 8d 8!N 8d 8!N 8d 8!N 8d 8!N 8d 8!N 8d 8!N b@,@HK1` 88b`c h8HK`8Kו`8bX8!}cN A8NiIErrorName__FiPP4FILE!8.|axK1QA(,#@08:axK19A(,#8`.A8!}N 8`:8!}N AdNiIGetAddrPortSep__FPCc!q|aKQ88papqaK0`8!}N A@NiIAddAddrPortSep__FPc```;`|aA!`aT>!, @8c(Heb hc|@, @$(@8` yHc8.88Kڑ`8PX8`Ky`g]8(b hc88`99;pHwQ`b@,@ KY`8{`8K`(89; `"cpA9; T88Km`Kԥ`Hb pc|@b H| @@c| @@pb@,@`Kӵ`B h88z`KA`(89 `"cpA9 T8K8`K`|8{8`Hb `c|@TcCH\`Te>h8a8KA(cc8H`8l8`p8!`}H8PX8`Ké`g]8(b hc8p8`99;Huy`b@,@HKҁ`8{`8K`"(8 cK׭`K`8`p8!`}!AaN AT;NiIMakeSockAddr__FPC5NITABPC7SI_SOCKPC11NI_NODEADDRUsPUcPUi|8`@<`88!qpr,r|0A\<`8|@AKE`8` h8K `K`8!}N AK`8` h8K`Ky`8!}N ALKе`8` hc8PKu`K-`8!}N 8!N ADNiITraceByteOrder__FPP4FILE|``aA`T>!T>U>U9>aX!88a!AȰ8ؙ!AKAA(8c9AcccgcH9!8pK],@@b `c|AH\,@aK%` h88~`Kӱ`(8`8cKQ`Kω`HP,9At8a88@8Kԥ`8aK8a8lK~``~aHX]`8 hTe>|~8LKA(8a8lK~`H(8a88@88Hm`8aKa8a8lK~q`(88 |c8H`|AK` 88(cKؽ`8Km`8`p8!`}!AaN b `c|@|@x8`p8!`}K A5NiITraceSockAddr__FPC5NITABPC7SI_SOCKPCUcUsUcN25iPCce|``a`T>`8!a8aX!`8`AhKYA(8,?A,<8p@`c8@88cHߙ`,>@b@|A`KY` 8p8Г}K`8K`8`8!}aN 8`8!}aK8apK,<Ad8ap8`K|``~HUq`8p hTe>|8LKA(8ap8`K{`b@|AtK8ap8`K{`8p8 |c8cH`Kc8.8K`,>,AA8apK)K4AK,pK A4NiITraceNodeAddr__FPC11NI_NODEADDRPCUsUcPP4FILEiPCce|``~ h,",6!a; ,/x@`,4/GAH@ ,HA @ `; &b@, @,@pK!` 8b hcx8~("cK`8Kʁ`$8!}N $8!N ,AKɕ`~( hcx"8cKQ`K `$8!}K`; K,5@`; K@`; K`; K,AT,,A<@`; pKA&b@, @0K`; K`; hKt/@`; K`@`; KP@L`; K@ A(NiISetStat__FP5NITAB7NI_STATPCcXb `c|P|4T~N @NiISendHdlPossible__FPC5NITAB|a`aA`}a!``T>T>X8!!K,@;p,v@ p8 hTA`D,=A@TD| @`T| A x8X8PK,A@|~,@LK` h8 r8}`KY`8`8Xcc(cK`K-`88K9c8!}!AaN {fccH),AD,8|{@,A;(Ab@,@PK` h8 8}`Ky`8`8$Xcfc(cK`KI`88KUcc8!}!K88K!8c`bcFc8cKU8!}!K88Kcc8!}!K88H ;`,A\@,@L|~Kĭ` h8 8}`K9`8$cc(cK`K`@,A0``! 8e@H `,A,@P,A8````! 8ePH`,A,@L,:@8H``8K-8`8!}!KT8 b h9^|cp8 8P99 9@8 `xK88K8`8!}!K8 b h9N|cp8 8@99 9@8 `xKM88K8`8!}!Kd x8H8@K},A@|~,@LK}` h8 d8}`K `8`8Xcc(cKǥ`K`88Kc8!}!KK8`HT`>, @b `TK` D@b hD@b pDWe|,%@0b p8 hdTcA`D@08`HTx>,=AD, @0(@} ,#A , @ (A ,%@8,8@0<`8b `|*|txтTK8P8`XKp`g8 Ht;` hc88(x8`99<$]xHca`b@,@LKi`8|`8 IK`8$4bccc(cKő`K`88K8`8!}!K8!}!AaN A  +NiIListen__FPC11NI_NODEADDRPUsiUcUiPP5NITABT`>b8`, c,M @N 8`N @0NiIUseUDSocket__FUc``|aAT>!aA!xp$!, @|@;@,Ad,<A;`cc| @;B`0c; 'cxP ha888 ,H=),@b`|(@, @ :~P,,A`A|6A |6@, @8c6~@:` :C9`!{q bHG`8T>a|0,@c8T>|#@c#@`pV>cc88H?,A,@D&t, @,@;{|;@Ah8T>|A$, @P,Ac8Pc8H?I,Ad,=A8PHq`8@P,@0K` h88|`K`(8`8!cK!`K`,&,@@P,@H_"$( h, A8@89"`ac8p9")K8`p8!`}px!Aa!AaN 8KP8 ,A8 @K`@KX,Kb@,K8PX8`K`g"Z8(c8`p!x8997!LH]`b@,@K`8w`8K`("aHD`T{>88cHH)`8!ccapc'cciccK`K`8`p8!`}px!KKI`(a$HC`Tf>8! b#bK`K`K,AK`:a(HC`Tf>8! bb%Kġ`b cKQ`KK@@K8cK: Kc88 ,H8mK`ccc8H;,ATp8!`}aN ;K$, A$, GA$, H@ ;TKp8PX8`K`g;`8( h$?"c88`9p!x9<",]H[`b@,@DK`8|`8K`$(8"L"cK`K`8`p8!`}N A%NiIBind__FP5NITABPC11NI_NODEADDRPUsUc|`|`T>p!QA%|?@܈&b@, @,@`K` 8 h8 $%|(", cA8 ,8`8#0K%`8K`8`8!}N ,AK` 8 h8 $%|(", cAK|$T>, @D@,A4````!8|@cH6y`,A,@P,A(`!8|PcH6I`,A,@&b@%, @,@K1` 8 h8 $%|(", cA8 ,8`8#0K`8K}`8`8!}K,AK`|(%" h, 8 $cA8 ,8`8#0KY`K`8`8!}K<9b` h9@m8^8&c8P9`x99 A9@ 0pKi|c8!}N 9b` h9@`8N8&c8@9`x99 A9@ 0pK|c8!}N $T>, A```!8|TcH49`,A,A9b` h9@b8&8c9`x8T9A9 9@ 0pK]|c8!}N 8PX8`K`g;«`8( h"c8tp8`99= D^0HVu`b@,@@K}`8}`8uK `"|(8 d0cK`K`8`8!}N ANiIBlockMode__FP5NITABUcT2|``aA`T>`T>!8T9c8cK),@b@,@8T88H9`8P@H,PA,A , Aa,@Xb@,@HK` h8 >8~`K`(8`88cK-`Ke`9b` h8 P8 abc8TA99!9A8 `xkapK,@08`P8!@}AaN |cP8!@}AaK,`@b@&,,@@8,@0(8b`#@D8@ h_"889XK8`P8!@}AaKT_"8@8 h89XK8`P8!@}AKc`8H,@8`P8!@}Kb@&,,@@T,@L8b`@`cb h"8T8x899 9@8 pKߵ8`P8!@}AaKd"c8Tb h88x99 9@8 pKY8`P8!@}AK9B`eb hc"8T8c899 9k( apx9@KK A.NiIConnectSocket__FP5NITABPC11NI_NODEADDRUsiUc``T>;x|aA!T>;@|!, A,A8`KA(`z8Tc$H<``x, A,A8`KaA(8<bP8dM|TѾ|| @@Xb@,@HK` h8 8|`Ku`(8hc&cK`KM`,/ / ,AA4A0@,@&,,@@@,@8(8`8P8@%@8 h_"8!p9K-,;@x$, 4Al,@LK ` h8 8~`K`(8`8$"cK1`Ki`8`c84K8`P8!@}!AaN _"88 h!p9KaK4P98@c8T8K9"`b h8 9b9_Pc8,c8T9 9!9k`axpKU,@8`P8!@}K<|cP8!@}!AaK(b@&,,@@<,@4(8`8P8@%@8 h_"89Ka,;@,\b x8`c|@4c85K8`P8!@}!AaKc8GKa8`P8!@}K_"88 h9KKp A#NiICheckPendConnection__FP5NITABiUc|a`~aA`T>!`a```!8K,@ ;B`, A :8bߘ, @ ,A{@T,A, @T`85K8``8!P}!AaN `88Ku,aA`b@,@PK5` h8 p8~`K`8$c(cKa`K`K<K4,Ab p8 hTA` X@X@XW|, @$TA`Xb x8\8TK%a,"@A,@HK%` h8 8~`K`8Xc(cKQ`K`88Ka`8!P}!AaN , AȈz, ,A@P(@, A, A;(@, AL, A@;, @<(@08`@(@ 8| @t8c8KՐa,A,@HK` h8 A8~`KE`8"pc(cK`K`88K)a`8!P}Kfcc8KMaT`>,@$, &,@,@x, A,Ax,@8`84K)a`8!P}K$`88KUa`8!P}K``!88l88cTH`,A,@8Tg&,#@L"b h8`8x98 (p9 9@K, AK'"`8b h89x!9 8 (p9@Kԁ, AK, AKc88.8KI`c88.8K1`,@XK=` h8 68v`K`8) 89"c(cK !`K`K8| @lK8`@Kb@K|88Kِa,A$,@K` h8 8x`K)`8$c(cK`K`K8bxcKT{>cH,`Th>8a( h8`c8(cgK,`8bP808(8`8 9p9<(9A(cHE`b@,@tK`8|`8 KY`Z8`(K=T{>c(Hω`8(cETh>cgc8(K`K`8``8!P}!AaN 8|4T~KT`>, @4c(H`T`>, @ `8 xX\8TKa,Ab@,@HK` h8 8~`K%`8Xc(cK`K`88K a`8!P}!AaN b, AHfcc8K a,A8cTH֑`8TK88K͐a,Ab@,@K`" h8 8y`K`8$c(cK`K`KLce8cH`T`>, @Ac8hKe,@ 8~889pT\~9CP9#@8TKh, @`, A08d@(Hu`p`@~Hap`A~88TK),AĀ|,@HK-` h8 8}`K`~8Xcc(cKY`K`~88Kc 8!|} !Aa!AaN ~88K,AX,@L|}KU`b h8 8{`K`~8$cc(cK`K`&, @~8&~86KM~, &A , A,,@@t,@l"?";9@A9@p8T8b h89ax!9 9{'apKE~ `X| @`|#yA~d| DN!A(,A|,@HK ` h838}`K`~8(Lcc(cK5`Km`~88Kyc 8!|} K8` 8!|} K8cT88l8H`,@T~"&, A;8T889x9 c8(pKKȀ,@|}K`8{`8'K`~8((cc(cK-`Ke`Kt8@K~&K~88KY8` 8!|} Kc8@HmM`,@~88@88c@K)`,@0~88K8` 8!|} KLK `~ h888'c(cK`Ky`~88KKap8aHu` |} ap8!K8` 8!|} Kb h8 8|c8 pc99 8 `9@xK|c 8!|} !AaN &|, @T,@K`8b 8'("cK`b #K1`AK,AKy`b 8'("cK5`b #K`AKH`~,A,@DK` h8 8}`K`(8', @K$`~,A,@K` h8 h8}`K`(8'aA"?@!, @(bH;BP!z|xP,A; a;,:|A<`b88cM|TѾ`!8bx, @H:8ac$b88H``sTr>8bx, @,A~t, @p8T>(A,7A\b@,@LK` h8R8u`K`(8`~8%8c K`K`,2A$;«`,@\b@,@LK!` h8\8}`K`( 8&8c'bcKI`K`bb h8f> 8*c!p899 9@8 `xK,@P08! 8`}Aa!AaN |c08! }AaK,>,AA(z|x@|`9@x|`9@b@,@TK` h8~8~`KU`(8`8&lc'!c K`K!`8`08! }AaK8@,b@&, @@p,@K%` 88b`c hb8&$ (cK`8K`8`08! }AK`,ADK` 88b`c hb8&$ (cKe`8K`8`08! }AK@x,@LKI` 88b`c h8&L (cK`8K`8`08! }AaKt,AK` 88b`c h8&L (cK`8K5`8`08! }AK8P,K b@&, @K V>K8`KuA(~P8bx||@@Xb@,@HK `b h8G8c`K`(~9xbb h8hgK`Ki`K8`KA(`tK``!8ac$b88H-`Tr>,A`t, @(8T>(AK; K8aH `8@8H `P,A$|Ac `8P8H `~,;Ab@;Bx" h<`b8M8u|TѾ``!, @4:c888b99!H e``uTt>, @,A~,4@,>,A$AP,A 8P8H `T`>, A8@8H `T`>, Ab@8,@K` h88~`K`(8`8&c K1`Ki`8`08! }AKHb@&, @Kh9b` h9@88)c89`x99 A9@  pK|c08! }!AaN 8`K9A(~P||@@`{,@TK`8y`8Ki`(~8hbcK`KA`K8`KA(`wK````!c888b99!H `Tt>,AK A "NiIPeekListen__FP5NITABiPP7SI_SOCK`8b`|`!, Ad8@8p8H{,ALp8``~, `@Xxe.@H{$8|(P|*|)*f~8`p8!`}N x`.xe$|eP, ,/ /ALAA@AX,@LK ` h88}`K`(8`8$ccK1`Ki`KP,@8`p8!`}KD8@88.8Kq`,AK}`(8`8 h8%cK9`K`8`p8!`}Kؠ8` |&A@,A`8@88.8K`,A, @,;P@,A;@||`!cccEHq`,A,`{@<&b@, @,@KY` 88`cd(HɱacCHE`g"(> h9$ Aca8 aeK`8K`8`8!}AaN ,AK`(8`ceH acCHɡ`g"(> h9$ Acac8 aK1`K`KdcHȹacCHM`g8a h88 K`9B`8"9`cc8#cc99 a 9@9~`axpK}%|c8!}AaK$T>, A ;TK8PX8`KoU`g;`8( h"c8"cp8`99< D]H!!`b@,@@K~)`8|`8"dK`"(8 dcK]`K~`8`8!}N A8+NiISetSockOpt__FP5NITABiT2PC10SI_OPT_VALPCc|`(%a``T>8@!AA`9`8K,@Āb `c|A````!c8cfH`,A,A,@,=A9B`b h898`8cc99! cj9k`axpKz,@,8`8!}aN |c8!}aK9b` h8;8cc99!cj 9l`axpKzE,@Kd, @4``!c88lcfH`,A,@8`8!}K$9b` h9@88cc9`x99 A9@ pKy8`8!}aKȠcc8899 9@8pK,A@,@LaKz` h8}8~`K]`(8`8cK`K{5`8`a8!}N 8aHeA(,@X,AH8bP98(;«`b h889 x9"8`9K c9k apH3 `b@,@PKy`b h88k`K~a`(b h8"8 cK~`Kz1`8`8!}aKa8!}N A<4NiIBindSocket__FP5NITABP7SI_SOCKPC11NI_NODEADDRPUsUc|}&KI`a``aAT>!xp`h`T>aXAP!H@808!c"$p, 4A$; 9pA$, 5AĈ$, 6A,:,/:A A@ԋxt.8@,7@;tVF>y8@VÄ>zbV>{|x| :A ,7AMBB:` h<C:@` ރx"@CCôCÔD\tD`TDd4Dh$,0A ,@(,, A8,A0,@ 4,0A P(8`|@@ u4@ %, A ,@ x, @ T8}:| PȀ~|````!8T888H```,A(A4xH8|d*|iN :xta|"|(@@~:Bl8|d~xBjt`MBB. AȀt, @&b@, |28@,@dKu` 8p~8`9"߀cf hWx8F _(})*jK`8Kv5`8`8!|08} @!HAPaX`hpx!AaK,AKu!`(~pcf8`9B߀ hWx8F c}*H*K`Ku}`KH|@@Ԉ&|PxqT>,$@X,@ tK`Kt`(~8CcfxcKU`Ku `xtK,AKtQ`b ~;8Ccf(xcK~`b CKt`xtK@P~88|&xt,#| PtqT>@P,AtKs`(8C~cfcvK~i`Kt!`xtK0,A(Kse`b ;8C~cf(vcK~`b CKs`xtK8PX8`Kc`g"U8(c8`p8G994DH`,@TKr`8t`8HKwM`(x8D,"t|:|cKw`Ks`8`K9@9`b`bpc8T99 Aa9@8`xKp,@8`|cK%, @Au8;988T>(@aHH LBA`AXAPAHA@x|@TtxâT|PT"|f:Tl|"T2|f*|P,@ ,@\Kqa`8t`8xKu`(bH``g88DlbccfKvy`Kq`,AxtMA`Kx.#&,#@@`,@PKp`8b 8Fcf(x cK{y`8b Kq%`8`K,AKpm`(x8Fcf cK{)`Kp`8`K@t,@Kp%`8b 8߀{H$~8Fapcf(}G@*vcKz`8b Kpm`8`K8,APHm`T`>px~a8Ecfab 8Kx=`b CKm`|(@X T>Km1`8b ~8EHa(cKw`b CKm`xK(@ T>K(@ T>K(@ T>K|( @  T>Kh8PX8`K]e`g"U8 c8(px8`8994ExH)`,@LKl5`8t`8Kp`?"(8Eab9 cKq]`Kl`8`K` 9f|@9K he|@ :K p:f|@: Ku0;980T>aXX L@A`AXAPAHA@x|@TtxâT|PT"|f:Tl|"T2|f*|P,@,@(@8KKj`(bH y``g08EcbcfKu`KkQ`K:````!8Tb88|H`|`,AK@cbeH,AH,@KP84,@x.#K,AKh`b :8C ~U&(xvcKs`b CKiA`K@|P|`||c 8|T>K,AKhm`(8FtcKs5`Kh`x.#KX|@At8PX8`KX`g;`~b hvc8(p8`8ix99;B]H `b@,@LKg`8{`8jKlY`"(8Bcv?xcKl`Kh)`8`8!|hp} x!AaN 8PX8`KX `g;`8(" h"c8|Ap8`9x9)Bp]H `b@,@pKf`" h8}8i`Kke`(" hcF"8BcKl`Kg9`8`K8tb~;xK88a0Xa8c h98 $T<9K1K |8Ka,A,@8`|c8!}AaN "C NiIWrite__FP5NITABPCUcUiiUcPUi``8bx|aAT>T>!;`|!1?", A,A8`KuA(`{8TccEH%``x8bx, A,A8`K5A(8<b8xP8dM|TѾe||@@\b@,@LKd` h88|`KiE`(8x8hcFcKɡ`Ke`,A8(@, ,/AXA AhHL&b@, @x,@ Kd!` 8b8r8`(| cA8w hc&cH8\Kn`8Kde`8`H,AKc` 8b8`(|=c@8 hc&8rcH8\KnE`8Kc`8`H hc&8wcH8\Kn`8Kc`8`8!}!AaHPb8`|=@8a h8rcF8KxIA(p89@bc8+c8T99 A9@8`xK`|c8!}!AaH8a h8wcF8KwA(p89@bc8+c8T99 A9@8`xK`e|c8!}!AaH8&b@, @t,@Ka` 8b8r8`(| cA8w hc&c8KlU`8Kb`H,AKaQ`(8`c|=@, hc&8rc8Kk`Ka`H< hc&8wc8Kk`Ka`H&b@, @p,@K`` 8b8r8`(| cA8w hc&8KkU`8Ka`H,AK`Q` 8b8`(|=c@0 hc&8r8Kj`8K``H, hc&8w8Kj`8K`q`8`8!}!AaN A NiIPeek__FP5NITABUci|}&K`aT>`aAT>!xpahA`!XPH@8!c"$ (!0, 4A0. @<,=Ah8;@MAclhM)JB; h<C:`MHC:@8:`:@`ރBjBlCD\÷D`×DdwDh$,/A ,@@̈%, A ,@,:Al8q}P```!8TacE88H`,A`y( A ( A ,@ a,#A :A th|@A hl|@@8monp|ctT@.TglT|#x|3x|d+xh(@ht&, @4,@PK]9`b ~8Jcf(?jcKg`b cK]`h,A,=Ap_ld, @X,:Ad?h,9@XMJRBM)JB@d&,$|*8c@,@`K\y`b ~ b8߀cf8LWx(}'H*cKg`8b K\`8` 8!|@H} P!XA`ahpx!AaK,AK[`(~ b9"߀cf8LWxc})P*KfY`K\`KL&,#A@l,@T,A@`,@PK[5`b  hcf8LГ(l cKe`8b K[`8`K,AKZ`(lcf h 8LcKe`K[I`8`K@\,@KZ`b  hcf8M(cKeA`8b KZ`8`K(,APKZ5`( hcf8McKd`KZ`8`K@|,@KY`b ~0cf8߀ h{$p8M,(}G@*jcKd`8b KZ-`8`Kh,AKYu`(~0cf9B߀ h{$jp8M,c}JX*Kd`KY`8`K@\,@(KY `b  hcf8Mp(cKc`8b KYm`8`K,AKX`( hcf8MpcKcq`KY)`8`Kd?hK(@ 8`KL8`KD;8@88@8K^%`8aKY8a8lKm``}PH`Te>|} h8LKmA(8a8lK5`88c8T89H 58PX8`KH`gUj8`c9>Jp8(89Hu`,@lKW`8~`8 K\`(j"aH`Tj>8J0cccch9!K\`KW`8`K,A KW `(~8J?jcfcKa`KWy`hK@|ha&|P,$ht|@A@L,AKV`(~8K0jcfcKa=`KV`_lKp,AdKV=`b ~8K0cfC(jcK``b cKV`_lK@,@l8PX8`KF`ghUc8(" h|28Iapx|8`99)KHi`8`KdKUy`(~ hcfj8KlcK`-`KU`8PX8`KF K\,A@KU`8b ~ hcf8Kl(jcK_`8b KUq`8PX8`KEK@|Pl&T>,#@L,AKT`(~8KcfclK_A`KT`_lKt,AlKTA`b ~8KcfC(lcK^`b cKT`_lK8PX8`KD`g8( hU?lc8l8`9p!xj9=L H`,@xKS`8}`8mKX`?"(8L@ljcKX`KS`8`K(MJRB;@|hlKH8b h9 8` 8pc8T8`8 `9!9 x9@KQ58|cKb,@X,@LKR` h88}`KW1`(H8L|VacKW`KS`c#b h858c!pb8T99 8 `9@xKP}8,A|cK%, @ @&t, @,@KQ` U8`($HY``g8Dc#cEcfK\}`b cKR-`,A@;@cM(C@ K_l?hK,A@K,AKQA`(U8`$H``g8Dc#cEcfK[`KQ`,A@Kxu<8a LBAAAAA|TtxâT|PT"|f:Tl|"T2|f*|P,Aht,A KPa`(U8`$H``g<8Dlc#cEcfK[ `KP`,A@K,@KO`8w`8KT`(U8`$Hu``g<8Dlc#cEcfKU`KPM`,A<@8K (}|P|y||c8|T>Kpc8K,A4,@4KKGA(p`AKGA(8||!|P,A|@@hT>,AKN`b H8C )U&C(ljcKY`b cKOY`@DKx|`||c 8|T>K,A(KN`(b8FtcKYI`KO`K8PX8`K?!`g;`8(" hc8x8`99)JD]H`b@,@HKM`" h8y8i`KR`(" h"8JXcKS)`KNa`8` 8!|Aa} N _l,:@,h, @;@`MA_lK,=A?hMAK|8K},Al,@,8!8`}aN |c8!}aN "CNiIRead__FP5NITABPUcUiiUcPUi``|a`{`U>!``!c88lcH`,A,A,<@,@x8«`b h8@98` 8ce99@8 `&x!pc9 KJA|cP8!@}aN 8«`8b h8@|489ceUcp99 9@8 `xKI|cP8!@}aK8`P8!@}K`ccc!p889cKY,A@,@paKJ` h8K8`KOq`{(8`8cKP`KKI`8`P8!@}aK8`P8!@}aK8`P8!@}aK| Al6NiIGetSockName__FP5NITABP7SI_SOCKP11NI_NODEADDRPUsPcUc``|a`{`U>!``!c88lcH`,A,A,<@,@x8«`b h8p98` 8ce99@8 `&x!pc9 KG|cP8!@}aN 8«`8b h8p|489ceUcp99 9@8 `xKG|cP8!@}aK8`P8!@}K`ccc!p889cKVE,A@,@paKH%` h8{8`KL`{(8`8cKMQ`KH`8`P8!@}aK8`P8!@}aK8`P8!@}aK| Al6NiIGetPeerName__FP5NITABP7SI_SOCKP11NI_NODEADDRPUsPcUc``b@|}&aA!.`T>|a!,A D@AL;Bx"X<`b8 h8cM:b`|TѾ`!, @:ccs8cg989!T>H ``vTt>, @P,A~,4A,@b@,@PKF` 88«`bX h8Ic8KP`8KFa`,?A@b@,@HKE` 8bX8` h8IcKPU`8KF`8,@Xb ;  h`!8acHʉ`p`ADb@,@4KE `8|8IؐKM`;KE`a8ca|Ab@,@@KD` 8bX h8IܐcK`8KE`,>AHb@,@HKD]` 8bX8` h8IcKO`8KD`8,@X ;`" h;```!8acH9`p`A@b@,@0KC`}8Iؓ|K`KD5`a8ca|Ab@,@@KCe` 8bX h8IܐcK`8KC`9B`b h89cC8)8899  9@9k`axpKAA8`0*8! |} a!AaN ,=A , @t,<Ab@,@ 8`K|KBQ` 8bXcf8` h8J(cKM`8KB`8`K,8`0*8! |} K$8`KA(~P||@@b@,@KA`8x`8KFE`y~8hcfK`KB!`KH8`KA(`uK;B````!ccz8cg989!T>H`Tt>,A|zKKA`B 8bXcf8` h8IxcKK`8KAq`b@,AK@`B 88b`"X h8Iy8KKe`8KA`,?b@,A@`8,@P```!8acHʼn`p`Ab@,@܀a8ca|Ab@,@t,>A(@8,@P```!8acH `p`Ab@,@da8ca|Ab@,AK?a`8y8IܐK`8K?`AKK?)`8y8IؐKm`8K?`KlK>`8y8`8IKI`8K?a`KAK>`8y8`8JKIq`8K?!`AKK>q`8y8IܐK`8K>`b@,KTK>1`8y8IؐKu`8K>`KK=`8y8`8IKH`8K>i`KlAK=`8y8`8IKHy`8K>)`b@,KAK=m`B 8bX8` h8I`cKH!`8K=`b@,ApK` C  NiISelect__FP10SI_FD_MASKT1iPUi`@|}&aA!.`T>T>|a!,aA@ac8H]; A4X h<`b8M8{|TѾ`!8bx, @:accE88HÉ``uTs>8bx, @@,A~, @$8T>(A,9AX,@LK;` h88x`K@`bX8`&8%8cK@`K;`,3A;`,@X,@LK;)` h88~`K?`bX8&cHcK@Q`K;`b h89@b8*p8899 A9@8 `xK88` 8!|} a!AaN ,=A , @p,;A,@ 8`KK:` 8bXcF8` h8IcKD`8K:q`8`K0ac8H8` 8!|} KW9>K8`KA(~P8bx||@@~,@K9]`8w`8K=`x~8x8hcFKM`K9`KT8`KMA(`tK `!accE88H`Ts>,A`t, @<8T>(AKK8`" 8bXcF8` h8IxcKCi`8K9`K(A$K8i`" 8bX8` h8I`cKC`8K8`K C NiIPoll__FP10SI_POLL_FDUiiPUi|@!T>T>|(A`H8!p}N 8!pN ADDumpPFDS__FP10SI_POLL_FDUii|``a$!A, 4@h&b@, @,@LK7` 88b` h8H("(cKA`8K7q`,/,AA@bH`!8TcdH`,A,A,@$@,@Ȉ&,#@,@K6U` 8bP(|cAH|A8-X|AhH|AX8-8` h"8H(K@`8K6m`8`a8!}N 8wK8rK,AK5`(Pc|AH|A8-X|AXH|AH8` h8-"8H(K?`K5`8`a8!}KH8` h8w"8H(K?`K5q`8`a8!}K8rKTK4`bX8`ch9 " hV_b8Hc(K?Q`K5 `K9b` h8;b8c8T99 9@ (9l`axpK2u|ca8!}N b@K|8PX8`K$`g;`8( hc8ap8`99 @A8`8!}N 8}88K';xEx.|P|2|>@@K| A NiCloseAll|}&`T> h`~,%`8!Q; 4@0c. A, A `|Tf>|, Ac`H]`,A@|},@pK0`8`8K5I`~(8`8Gcc8K5`K1!`c8!|} N c8!|} KԈ&b@, @p,@LK0` 88b`8G@c8~("cK:`8K0u`8`8!|} KT,AK/`~(8`8G@c"c8K:e`K0`8`8!|} K9pc```8Ka,@&b@, @tKa,Ab@,@`K/`8`8K3`~(8`8G|c8K41`K/i`a8!|} KHa|8!} K,Ab@,@$}p|a|KK.U`~(8`8G`rc8K9`K.`p}|a|Kpb@,@PK; <.=8 ,#@,@PK,M` 88b` h8G@(cK6`8K,`,$@ 8`8!}aN ,AK+`(8` h8Gc@K6y`K,1`K8PX8`KQ`g;`8(" h"_c8@8`9pAx9)A]@H`,@LK+!`" h8A8i`K/`(" h"@8AcK0I`K+`8`8!}aK8PX8`K`g;`8( h"c8#p8`99A(pA$,'@ch8!N ct8!N , AL8p88p(h| HN!A(ap8!}N ,'@ch8!N ANiIPending__FP5NITABUcT2`aAЋC%|,:!1AH`,A```!8T888H}`,A(AL;`x` x$8|*| N b@, ,@@;,:@c88Klu,@0c8!}AaN H`8`8!}AaKVc8 h_"=P8889@PpKEeKT@ ;KLK#` 8b hP8@("VcK.]`8K$ `;Kb@,@ ;K8b`b88"VcPcH```cpx88 h889@cicKD;Kxb@,@ ;K`Pb88"VcH)```capx88 h889AccKD ;Kb@,@ ;KK"I` 8b hP8A@("VcK,`8K"`;Kb@,@ ;K|K!`(8` h8AhcPK,`K"Y`;KD88Ki,@|K ANiIHdlGetStatus__FP5NITAB|,#@8!`x x x xxxʃx|J|B|R|ZA88`(AHh8x.($|Jx@9'8`,x|8x$}88@8` 8!}N `88\K,`,AK =`bX8`8 h8@|@A8` 8!}aN cHcT>|@A`8` 8!}KKI`bX h8`8?cK' `K`, ApK`b@c,@K8PX8`cK `g[`8( hc88`99>?H`b@,@8K`8~`8K -`}`8?K`K`8`a 8!}N 8PX8`cK `g[`8( hc88`99>8H`b@,@K`8~`8K`}`88K`Ke`8`a 8!}KT A NiClearTraceForPeer`@|T}>!,@8b`8| @@\8h`!`x 9({.y@.|2|y 8| @x&Fx%EA88!}N hxc.8p8\|`88cxK%`,@8b`8| @@K@KY`bX h8p8?cK$`K`K A8NiIRemoveTraceForPeerEntry__FUi|,#!qA,$A\,&A88`, Ax9;`h8``!|(@@|H@A8`8!N 8PX8`cK`g9B`8( hc88`99=?TJhH`b@,@JhH`b@,@K `" h88i`K`8`" h8? hK{`Kq`8`8!}KH8PX8`cK}`g9B`8( hc88`99=>JhHQ`b@,@KY`8}`8K`8`8>hK{Q`K`8`8!}K ANiGetTraceForPeerList`}T>aA``;`@|!``T>T>!A,%@( Ax, @,#@X,$@|$A8| @8PbX8`cdK`g_p8( hc88`99<=H`,@8K`8|`8Ky`{p8>Ky`K]`8`8!}!AaN {.{HcPccK|MA(,#`@8P8`Xc%K-`g_p{B hc#8(ap8`899:H`,@@K `8z`8 K`|p83tcfK{`Ku`8`8!}!AaKcdH`_ ? ,@TK` 8bXp h8>Pc ? K)`8K`8`8!}!AaK|8PbX8`cdK`g_p8( hc88`99<=XH`,@ K`8|`8KM`{p8=Kw`K1`K8PbX8`cdKQ`g_p8( hc88`99<!QA8bXcTc8`e|(@8b8{d$|p|xEx.|(Pc"}$pcA |@;}$,#AĈ}$,#"A, A, A , @L~, @;``, @8PX8`cK`g_8( hc8[8`99=8hH`b@,@8K `8}`8\K`|88K-`K e`8`8!}aN 8}@88H|`,A@x.`x$|`P8|d,#@ 8~8`K8`8!}aK8PX8`cK`g;«`8( hc8O8`99=9^H`b@,@8K `8}`8MKQ`|8:Kp`K 5`8`8!}aK8PX8`cK5`g;«`8( hc8L8`99=;,^H `b@,@K `8}`8LK`|8;`Kp `K `8`8!}aKP8PX8`cK`g;`8(" hc8K8`99):]He`b@,@K m`" h8K8i`K`" h8:Koa`K `8`8!}aK8P8`XK`g;`8( hc8Gap8`99<;]H`,b@A`,@0K `8|`8GKI`bX8;cfcKn`K %`8`8!}aK,AK ]`bX8;8cK!`K `8`8!}aK ANiAlChangeType||+yT>!q@$;`,A;`|88`!{ x .x $} HP|@, A4#|@*| H@@|@*| @@A;C ,*AL;A|`@888|`!|@@9U>y.y H}IP|fP,#@ }'R.},)A<,A(C @,b@,A@,@8cpx8!N K`bX hc8cKQ`K `@8c8!}N AXK-`bX h8cK`K`8`8!}K8`px8!N `}C K8x@p8!N 99@8|fP,#@K|b@,AK4p8!N ,*AD8|@@Tb@,@`K!` h88}`K `bX8cKk`K`88!}K8p8!N ,*AKX8;`,AK Ad%NiIAlFindEntry__FPC11NI_NODEADDRUcPUc||y`T>T>!a@8P8`XK`g;«`8( hc88`99=8^H`b@,@K`8}`8K M`bX88cKi`K-`8`HcXH1u`T`>, @8P8`XK1`g;«`8( hc88`99=9^H`b@,@K `8}`8K`bX89DcKi`K}`8`H,=A,=A,=A8P8`XK`g;«`8( hc88`99=9^HY`b@,@8hH`b@,@L}I!=T>L}I3.8|@@A8!|!A} aN 88;b`````!x.x$[`cg} Px&8}j*}B0,=A} @*88}]J}I*+}(!T>|8@AK@8b`xKeA(,#}@tKeA(;~KeA(8PX8`cKi`g9b`8( hc88`99=K x|pH-`b@,@K5`8}`8K`8«`8x|Kd`K`8`8!|} KPKdA(88PX8`cK`g9b`8( hc88`99=K pHY`b@,@Ka`8}`8K`~8«`8Kd`K`8`8!|} K8PX8`cK`g9B`8( hc88`99=8JH`b@,@A(xA```!$, ALcx| _N!A(y@8!}N b@,@K` h88`K`bX838cKQ`K`8!}N 8!N A NiIWalkNitab__FPFP5NITABPCv_vPCv|8b h!87@K8!p}N A,NiITstWalk__Fv`b@|!q,x@`K` 8b h874("cxK`8K9`8!}N 8!N ANiITstWalkFunc__FP5NITABPCv,$M &N @NiIHdlResetTrace__FP5NITABPCv|``aA`T>!;`;@:::a8!1c$,#@ܘB,AR,A,8a" h8 86XK`8@Hu`f8@H`g8PH`h8a8 86`K`$, @@,A(c88@889K,AP,A4c;A88P889K|`4T~|Z8$, 5A,$, 6A $, GA$, 5A$, 6@,#@"80K`KA(`g$K(;8 D`i@`(:@;Y(6Ab,59y HA9y&:y T,#A:y,79 \A98ah886tc99ApxaAaaK~-`,>@b@,@8hKŁ`K8`8!}aK:H`|ct8xK8c8T889K=,@Р, @ :K:\8a8\8.8K`8a\K8a\84K``xaH|`8LTe>|xK-A(8a\84K`KP;a(8a8(8.8K]`8a(K8a(84K``xaH|`8LTe>|xKA(8a(84Kq`K$, "@p8h;a(8(8.8K`8a(K8a(84K-``xxH{`8LTe>|xKIA(8a(84K`KH8c8T889K,@$, @ ;aK;a(8a8(8.8KA`8a(Ku8a(84K``xaHz`8LTe>|xKA(8a(84KU`K8a8 " h8LKz`8@HM`f8@H`g8a8 86lKz`KR8a8 " h8LKz`8@H`f8PHu`g8a8 86lKza`K$, "@PB8a" h8 8LKz5`8@H`f8@H`g8a8 86lKz `K@V8a8 " h8LKy`8TH]`f8TH`g8a8 86lKy`K A NiIHdlDump__FP5NITABPcUib x hc|A$ 8d Ȁ|(@N 8d N 8d N @@NiITypeText__FP7SI_SOCKb h hc|A8b pc|A `8d ܀|(M 8d N 8d N 8d `N @TNiIFamilyText__FP7SI_SOCK|!88K8!p}N A(NiIHdlDump3__FP5NITABPCv|;`T>8.8!K`|`4T@8Xd8!}H88!}N AdNiAddrToStrStatic;8|}&aA!`}; NB!, Adb@,@HK` h88~`K`bX8`83PcKR `K`8b(8K8aH`,@;«X{`E{c.|cPKTyA(,#A,@488`8$``!8c|!8~|A@;`,@x8`cd8H``zKTA(bh,#{@8P8`bXcdK`g\Z" hc8(Ap8`8999H`,@`,@<<,A$KA`bX84cK `K`K,@K `8w`8K`bX84D cKA`Ky`KK`bX h83cK`KA`~KT8P8`XcK]`g;`8(b hc8x Ex.8`|XP99;\|pH`b@,@PK!`8{`8K`83txEx.||0P|KK`K}`;@K`9b` h888!899 9@8 `xkapK|cPJ!8!@|} N C  $ NiIInit__FUi;|!q, @T;b h8c2K8=A(,#AaxK:A(,,AAb@,@dK`b h8Z8c`K=`bX8`x h82cK`K`8!}N 8!}N 88!}N 8!}N b h8c3,K7EA((#@8!}Kt88!}N 8!N ANiISetIPProtoUsage__Fv|;!QHE`KH`8aHm`;`,@0H `h~KI A(88b8Hc,#Al@,AK`bX8µ8 h82cK`KI`8b8cKHA(88b88X}`KHyA(8 H8!8@ 8΀9}$P%&X'N KH A(88b88XKt9@b h88p8899 A9@9k`axK `K A NiIExit__Fv8`N @NiIThrInit__FvN @ NiIThrExit8`d8`N @NiISetConnectAcl__FUc||ya!QA8b,@t8cHR!`,@H, A<;b`88{T8|c *(A|iN 88`a}8!N 88`}a8!K88`}a8!K8PX8`cK΍`g[8( hc8 p8`99<2H]`b@,@.H~`b@,@K`8~`8K`}8/K@`Ke`8`8!}aKh8K1`8`a8!}Kh8PX8`cKE`g[8( hc88`99>.HH~`b@,@K%`8~`8Kߵ`}8.K@!`Kۙ`8`8!}aK88`} a8!K8},{(aT>x`B,8`Kh8}{a8`K<8H`a8!8`}K8H`a8!8`}K88`}a8!K88`}a8!K88`}a8!Kh88bxa}8`K<88bΐa}8`K8!}N KЙ`,@K8PX8`cK`g;«`8( hc8~8`99=*^H{`b@,@Kح`8}`8~K=`|8+ K=`K!`8`8!}aKL A` NiGetParamEx|y|aA!!A88b,@8cHK`,@, A\;"`88yT8|c *(A|iN @, @~|t,8x@,8`! }8!N K=`bX h(8 dc@8 `8+K`Kץ`K8PX8`cK`gY8( hc8 38`99=+LHy`,@8K֩`8}`8 2K9`|8+K;`K`8` 8!}!AaN @, @p~,@! 8`}KK `bX hР8,dcK`Kօ`8`! }Kx8PX8`cKƕ`gY8( hc8 A8`99=+Hxm`,@Ky`8}`8 @K `|8,$K:u`K`8` 8!}!KЈ@, @\, @8,@KK`bX hР8,|cK߹`Kq`Kd8PX8`cKő`gY8( hc8 K8`99=+Hwi`,@Ku`8}`8 JK`|8,$K9q`K`8` 8!}!K̈, @, ,AA8PX8`cK`gY8( hc8 p8`99<- Hv`b@,@AԀ,@K1` h8 8~`Kֽ`bX8-DccKa`Kҙ`K8PX8`cK¹`g8( hYc8 p8`99=Ht`,@,Hs`b@,@pK`8~`8 pKq`}8,K5`KU`8` 8!}!K8, A8PX8`cKU`gY8( hc8 8`99>-`Hs-`b@,@K5`8~`8 K`}8-K51`KЩ`8` 8!}!KH%`,@! 8!8`}Kp! 8!|N 8PX8`Ku`gY8(" hc8!zp8`99)-HrE`8`! 8!}N @, @$~, ,@PAKK ` 8bX h8-cK`8Ku`Kh@K` 8bX h&8.cKy`8K)`K8PX8`cKI`gY8( hc8 8`99=-`Hq!`,@K-`8}`8 Kҽ`|8-K3)`KΡ`8` 8!}!K@, @~,@! 8`}KXKͩ`bX h, 8 dc@8 `8 h, @88.(KA`K`8`! }K8PX8`cK `gY8( hc8!8`99=+LHo`,@|K`8}`8!K}`|8+K1`Ka`8` 8!}!KD@, @8,=@8PX8`cKQ`gY8( hc8!28`99=.Ho)`,@K5`8}`8!1K`|8/K11`K̩`8` 8!}!KcK#]A(,iA8PX8`cKayK#)A(8(B h8i|ecp8`8!<9x9:/@cjHnU`,@Ka`8z`8!=K`cK"A(|f8c8/tc8ic9 p9@Ki`Kˡ`8` 8!}!Kbhc8cK U`aȀ,@8`! 8!}KXKʥ`bX h8/cKe`K`8`! 8!}K8PX8`cK)`gY8( hc8!08`99=.HHm`,@K `8}`8!/KΝ`|8.K/ `Kʁ`8` 8!}!Kd(@8 b@,@8`! }K8Kɉ`bX h"8/cKI`K`8`! }K, @, @xb@,@DK` 8bX h8/cK`8KɅ`8,(8`! 8!}KlT>y,pTc>xd (A(dA ,$@p@,@Ky` 8bX h*.80c K%`8K`,@HKb@,@@K ` 8bX h*.800c Kҹ`8Ki`8`! 8!}K\8PX8`cKu`gY8( hc8 8`99>-`HjM`b@,@KU`8~`8 K`}8-K,Q`K`8` 8!}!K@, @|8y,@Kt88.8K̩`,AKƵ`bX h880cKu`K-`K 8PX8`cKM`gY8( hc8!N8`99=0THi%`,@K1`8}`8!MK`|80K+-`Kƥ`8` 8!}!KH`8`! 8!}Kt, A8PX8`cK}`gY8( hc8 8`99>0HhU`b@,@K]`8~`8 K`}814K*Y`K`8` 8!}!KH-`8`! 8!}K@, @~,@! 8`}K`Kı`bX h, 8 dc@8 `81tKa`K`8`! }K 8PX8`cK)`gY8( hc8!h8`99=+LHg`,@K `8}`8!gKȝ`|8+K) `Kā`8` 8!}!Kd@, @l~|t,8x@K,KÍ`bX h, 8 c@8 81K=`K`K8PX8`cK`gY8( hc8 U8`99=+LHe`,@K`8}`8 TKlj`|8+K'`Km`8` 8!}!KP@, @l~|t,8x@KKy`bX h, 8 `c@8 d81K)`K`K8PX8`cK`gY8( hc8 c8`99=+LHd`,@tK`8}`8 bKu`|8+K&`KY`8` 8!}!K<@, @;x~, ,@PAKKe` 8bX h81ܐcK`8K`K@K` 8bX h82cK`8K`Kt8PX8`cK`gY8( hc8 8`99=-`Hcy`,@K`8}`8 K`|8-K%`K`8` 8!}!K܈, A8PX8`cK`gY8( hc8 8`99>-`Hb`b@,@hK`8~`8 Ki`}8-K$`KM`8` 8!}!K08H`,@b@,@8`! }KKQ`bX hЀ82$cK`K`8`! }K缈, A8PX8`cK`gY8( hc8 8`99>-`Ha`b@,@, @$;P@,A;@||```!cccH,`,A`|,@,8`8!}aN cHacH}`g8a h88 KB!`9B`8"D9`c8!cec99 a 9@9~`axpKU|c8!}aK\$T>, A ;TK8PX8`K`g;«`8( h"c8"0p8`99= D^HZQ`b@,@dKY`8}`8"1K`"{(8 dcK`K`8`a8!}N 8`a8!}N AL'NiIGetSockOpt__FP5NITABiT2P10SI_OPT_VAL0x@ h8 | |(088h M @ 8h N A@ 8 H8 `N @hNiIGetSockLevel__Fi8|A(|A|AP|A`|AX|Ad|AH|A,|A|A|A|A|A"H h 9'(9G||@ (~08g ALA@`9CaCN A@`9#@,A(c8p8.8K`,@(c8!}N K`~,< h8@<8`8*8pK`Ki`c8!}K8`8*8p8 Ku`K-`c8!}KdK`,A8!Tc>}N 8PX8`cK`g;`8(" hc8"8`99)*h]HT`b@,@`K`" h8"8i`Ky`" h8*K`KY`8`8!}N 8`8!}N A0 NiLocalCheck|y`|aA`T>!!!A4b@,@c8X88H`,A@a,@LK` h8"8~`KE`bX8`8)ccK`K`a8!}N ,<@<, @0(@a,#A, @(A88a98888K ,@,<@b@,@Ta88Ky,>Aa~8`8!}N Ku`bX h8)cK=`K`K88aX98cK,Ad8`~8a8.8K`b@,@|K` h8#88}`Ky`X8`8aEK=T{>aH8q`Ti>cCp8*cc8chc K`K`a88K),A,A8c8!}!AaN 8bP8P8(8#D9"` h9c8`c)HP`;8!c}Ka88KK`8a8XcK,@|b@,@@a88K9a88K)a88K,>AKKI`bX h8)cK`K`K|~`}8a88.8K`b@,@|K` h8#W8|`Ky`X8`8aeDK=Ty>aH6q`Ti>ccp8*4cEc8c(c K`K`a88K)a88K,@8bP8P8(9"` h8#`9c8`c)HN`;8!c}K8a8a8.8K`b@,@PK` h8#8~`KY`bX8`8)c8cK`K)`a8!}N 8bP8P8(8#9"` h9c8`c)HN `8`8!}N K`bX hc8)hcK`K}`K8a@;@8@H`,A@`~,@PK` h8"8`K-`bX8`8)HccK`K`c8!}K A&NiIMyAddrVerify__FPCciP11NI_NODEADDRUc|!T>T>T>U>U'>UH>T >H`,At@ax,@PK` h8#8f`K=`bX8` h8#xc K`K`ax8!}N 8`8!}N A NiHSBufInit|X;`8@888P!H`,A ,@8P8!}N 8X8P8@Ke`8P8!}N A NiAddrToHost|}&aA`T>!`8`!`9p88TK҉,A|@a,@HK` h8#8~`KU`(8`8#@c0K`K-`aP!8!@}N Xb hc|@ x(9b HcAc `c9t;Al8T`88lKѩ,A@a,@HK` h8$8~`Ku`(8`8#@c0K`KM`aP8!@}!AaN .>Ac|8AaptaHHb.>A`8p8`8xax8c8K$,@a@؀,@&,#@P,@Ha88.8K`c#88.8Ku`K`&;, 8A8  h8 (cA8 8`8#d890K`K`PJa8!@|} Ha88.8K`c#88.8K`,@XK` h8$28~`KY`(8 cA8 8`8#890K`K!`PJa8!@|} !AaN C-NiIDgHdlGroupAdm__FP5NITABPC11NI_NODEADDRT2Uc||yab@!A, A8PX8`cKu`g;`8( hc8$8`99<"]8HFI`,@8KU`8|`8$K`88"KQ`K`8`8!}aN 8`8K A(,#@8P8`XcK`g;` h88c8(8`8$99<p]8HEy`,@8a|8#K충A(cc&,#@,@hK` 88b`8c(H*`T`>8#|ccK`8KE`8`8!}aK|,AKq` 88b`8c(H*`T`>8#|ccK`8K`8`8!}aKp8PX8`cK`g;`8(" hc8$8`99)\]8HB`,@K`" h8$8i`K-`" h88K`K `KD A NiWakeupOpen|`X!aaxc8Kq,@8 h} pT@Xb 8\}8TK,A|b@,@LK` h8&8~`K `}8`8Xcc(cK`K`}88Kc8!}N }x8K,A@|,@|K` h8& 8~`Ke`}8`8"pcc(cK`K9`}88KEc8!}N }88Kc8!}N }8`8HK҅8`8!}N Xb 8\}8TK,AKH8!}N A\*NiIWakeupBind__FPC11NI_NODEADDRPUsPP5NITAB||yaA!a@8P8`XcK!`g;«`8( hc8$8`99=\^@H>`b@,@K`8}`8$K`|@8K`Kq`8`8!}H|`y@8PX8`cKq`g;«`8( hc8$8`99=^@H>E`b@,@8KM`8}`8$K`|@8KI`K`8`8!}N c \&| Ax@,@hK` h8$8~`KU`bX808`c@H$("VZ^K`K`c88K`~;@@,=C0,@@,@K!` 8X8`d@cH#` hceT`>c|8 K`8Ke`KA(H,AlK` 8X8`d@cH#9` hceT`>c|8 K9`8K`K=A(_8!}AH@,@K ` 8X8`d@cH"` hceT`>c|8 (K`8KQ`_8!}AH,AhK` 8X8`d@cH"` hceT`>c|8 (K`8K`_8!}AaN A NiWakeupClose|,#!q@8P8`XcKm`g;`8(" hc8$8`99)]HH:A`b@,@`KI`" h8$8i`K`" hH80K=`K`8`8!}N 8`8!}N c8!c"N ANiWakeupGetNiHdl|!,#Ac08!pN H,a8!p}N A4NiWakeupGetCntNo|`,#!q@8µP8`XcK`g;`8(" hc8%8`99)]XH8`b@,@`K`" h8%8i`K1`" hX80K`K`8`8!}N 8`8!}N c8p889HU|c8!}N A$NiWakeupCollect|}&aA|+yN`~!`aT>8!T>A\b c|Ahb@,@XKE`B h8&8z`K`bX8`80^$>"VZ^cK!`K`,;@@b h;cc8K.-,@````!8~Tcc%889l9!9AH`,A,@~&,,@@T,@L8b`!@"cap8T8x89!9 9@K(@,, v@ ,?NBA8K8`PJ|8!@} !AaN c8Tapx"88!99 9@KUK`9b` h8&;b8c8T99 9@ 9l`axpK|cPJ8!@|} KH,@,@(8`PJ|K b,?A8c8K,1,@`!8~Tcc%889l9!9AH`,A,@ b@&,,@@\,@T8b`@pcb hx8T8"899 9@8 pK8,<A8`JP|K>"c8Tb h88x!99 9@8 pKKc8K*,@````!8~Tcc%889l9!9AH`,A,@b@&,,@@(,@ 8b`@Dcb hx8T8"899 9@8 pKK>"c8Tb h88x!99 9@8 pKyK C0&NiIWakeupReceive__FP5NITABUcPUiPUcUiT3|,#`T>!ax@8P8`XcK`g;«`8( hc8%&8`99=^`H1`b@,@\K`8}`8%&KI`|`80K`K-`8`8!}N 8`8!}Kc88xKm8!|c}N A,NiWakeupCollect2|!,$@8`8!pN H A8!p}N A4NiWakeupAttach|`XT>8!aaxcKw,@8 h} pT@Xb 8\}8TK,A|b@,@LK` h8&58~`Ki`}8`8Xcc(cK`K=`}88KIc8!}N }xc88Kq,A@,@|K1` h8&>8~`K`}8`8|cc(cKY`K`}88K8`8!}N }88Km8`8!}N }8898TK>,A@,@|KU` h8&H8~`K`}8`8cc(cK}`K`}88K8`8!}N }88K8`8!}N }8`8GK8`8!}N Xb 8\}8TKA,AKd8!}N AH/NiIWakeupConnect__FPC11NI_NODEADDRUsPP5NITABPUs||yaA!a@8P8`XcKz`g;«`8( hc8%u8`99=^pH,U`b@,@K]`8}`8%uK`|p8KY`K`8`8!}H|#y@8PX8`cKy`g;«`8( hc8%v8`99=^pH+`b@,@8K`8}`8%vK=`|p8K`K!`8`8!}N d \|(Ax@,@hK-` h8%z8~`K`bX808`cpH$("VZ^KA`Ky`d&88K}y`z~08c~0, T`>@, @b@,=@x,@Ku` 8X8b`cp~H ` hTf>c80ceK`8K`cKA(H\,A`K` 8X8b`cp~H` hTf>c80ceK`8KM`cKA(H,=b@@p,@K}` 8X8b`cp~H`0 hTf>c8\ceK`8K`Hl,AdK` 8X8b`cp~H`0 hTf>c8\ceK`8KY`KA(88!C}AaN ApNiWakeupDetach||yab@8v!ap@8P8`XcKu`g;`8( hc8%8`99<]xH'`,@8K`8|`8%KI`x8K`K-`8`8!}aH&,$,@@,@K5` 88`x(cH `T`> hc|c8K`8Ku`8`ax8!}Hx,AXK`8`(fxH E`T`> hc|c8KE`K`8`ax8!}N @,@ K%` 88b`x(dH `T|>cH ` hcT`>cc|8dVK`8KI`H,AK` 88b`x(dH %`T|>cH ` hcT`>cc|8dVK`8K`8p8Ha|c8!}aN Al NiWakeupExec`T>b |`c\!1|Atb@,@dKQ` h8&a8}`K`bX8`80_$?"VZ^cK-`K````!8Tc88H]`,A(8`Te88|(*A8| N |@A8PX8`Kqq`g9B`" hc8(x8`8&tp99)pJH#5`b@,@xK=`" h8&u8i`K`(8`c"" h8cK]`K`8`8!}N 8`8!}K8`8!}K9b` h8&;b8c8T99 9@ 9l`axpK}|c8!}KL9B`b h8&}9b8` 8c8T99  9@9k`axpK}-|c8!}K ANiIWakeupSend__FP5NITABPCUcUi||y`aA!T>!Ax@8P8`XcKn`g;`8(" hc8%8`99)]H `b@,@@K}`" h8%8i`KY`" h8K`K~9`8`!8!}N @&, ,@@,@K}=` 88`(cH`T`> hc|c8K`8K}}`8`!8!}Hx,AXK|`8`(fHM`T`> hc|c8KM`K}`8`!8!}N @,@(K|-` 88b`(dH`Tz>cH`F? hcT`>|cc80)VK`8K|M`H,AK{` 88b`(DH)`T{>cH`f? hcT`>|cC80)VK`8K{`xc%Ka|c8!}!AaN A NiWakeupExec2||y`!qA<;$, 6A8PX8`cKk5`g;«`8( hc8'8`99=x^H `b@,@8Kz`8}`8'K~`|8K `Kz`8`8!}N ;cHQ,@̀Xb hc|A$b pc|Ab `c|@Ԁ\b xc|@$, 6@:, @8`;XdX,#AX:8`KMA(|b@|"|*|2Ȁ|: (؀,@ cKKx`bX, h8 cA8 "8`8KE`Kx`cKx;;K,8PX8`cKi `g;`8(" hc8'8`99)(]H`b@,@Kw`" h8'8i`K|u`" h8PK`KxU`K A#NiITcAddHdl__FP5NITABP11NI_TC_PARAM||~y!qA,8`, AcKz`Ku`8`Hb@,A 8!8`}N Ku!` h8' 8`Ky`bX8`8 cKzQ`Ku`8`8!}N N , A(, @K\8`K8!}N A NiITcCheckParam__FP11NI_TC_PARAM|8`aA!aA!x!A(K!A(8`X,?A`~@ h;`;`X:«`X:`bX:B`"X:`X``!$`z, A؈:, A, A| @AL, A| @A4, A| @A, A| @@?|>A؀|+yAX,@ "e| EN!A(,?A:, A|9@t,$A,#A:,@(q@t8,A88| ```!x 8|(|(|*x|+xx C ,&@,|@@$8`8!}N 8`8!}N 8PX8`cK_-`g;«`8( hc8'8`99=p^H`b@,@Kn `8}`8'Kr`|8K`Kn}`8`8!}K AD NiITimeConstPasswordCheck__FPcT1|``a!Q, @ ,#@8`8!N 8`KA(,#@}@8P8`XcK]`g;`" h8c8(8`8%F99)p]hH`,@DKl`" h8%G8i`KqE`" h8h8Ki`Km!`8`8!}N ;88K޵,A|,@HKl` h8%U8|`Kp`bX8`8cchKqE`Kl}`}KA(c8!}N 080}cc&,#@,@Kku` 88b`h}c(dH`T}>H`Tg>0 hccc8,Ku`8Kk`8`8!}aN ,AKj` 88b`ch}c(HY`T|>HI`0 hceTg>c8,KuE`8Kj`8`8!}aKT ALNiWakeupAttach@AF107_978P8`|X!qcKZ`g;«` hc8(8%8`99=^PH `b@,A8`8!}HHKiy`8}`8%Kn `|P80Ku`Ki`8`8!}N ANiWakeupGetCntNo@AF108_93|!Kh`bX8`8Ș h8*cKs`KiE`8`8!p}N AXNiSetSiTrace@AF109_80|!Kh5`bX8`8Ș h8*cKr`Kh`8`8!p}N AXNiDisableSiTrace@AF110_78|!Kg`bX8`8Ș h8*cKrM`Kh`8`8!p}N AXNiEnableSiTrace@AF111_77|!Kf`bX8`8Ƞ h8*cKq`Kge`8`8!p}N AXNiDisableTrace@AF112_76|!KfU`bX8`8Ƞ h8*cKq `Kf`8`8!p}N AXNiEnableTrace@AF113_75|`T>aA`!aA!xp!Kea`b Xc h8HfKp`;b Ke`,>A;`B@"HXh:pb hB " h  h `!{u |@Dz$y|.|c9@Рx|9@dw|9@t|9A@h;{|;@A8!}px!Aa!AaN Kd1`X8ILeKy`b Kd`|@;{|;@@dKKc`X8IXeK-`b Kd]`KAK@t|9A@hKKc`X8I@eK`b Kd `z|.|K@w|9A@KKc9`b X h8I4eKy`b Kc`z|.|KD@x|9A4@KKb`b X h8I,eK`b KcI`z|.|KKb`b Xez$|B h8Hf|B}B.Km9`b Kb`z$y||.|c9Al@LK48!}N A$DumpPFDS__FP10SI_POLL_FDUii@AF114_40|`T>aA` !a~0,#@d~ ,#A 8KA(~0,#@8p8Hb@,@08`@8!0}AaN K``bX 8 8pcKk`Ka=`8`A@8!0}N aKA(`||{808a```!KYA(,#88a|A4A 0K8aceH,@8aKqA(|P;8|At`;8|ccKX-`8|| , @ 8`@88!0}|!K88`@8!0}|K8|ccKW`8|| , @8`@88!0}|!KD 8|KiA(~ ,#@8|~ K8KA(~0,#@xK88KUA(~0KA(KT A ErrGetTxt|``!a88ap8`!AKA(8 c,#@d8apKA(8cKA(,#@8`8!p}N 8pK]`8`8!p}N KŽA(8apK)A(8cK}A(,#@K AErrSetMyLocation 8bX( M `N @ErrGetMyLocation,'a?|aA``!a!aa(0a!Aؐ@;`,?;@@h(:;"X(@c:@c;ccKA(c8 (~|#@A$8w|c, (@|, )AcCKA(c5|#@A$8w|c, (@|, )Ah:cd8aH%8a 8K`8aKAA(cD|cH: x8a x888KEA(c8GKA(|; x |x8a xT88KA(,@8bKA(cd||x8aTK` 8a8K5`cD8aK%`8aL888KA(88aL ;AL88KA(,@8,689Z@c7,;a(A`!89L0pxH}|c8!}!AaN 8 8aM 8````!;ZK=A(8,8z8@K8a y 8 8``!;KA(8,88@K@88a:bKQ`|a88|Z"Kl88a;bKQ`|a88|{K;A8ac8K5`8K|;a8a`8K`8KL A DErrSet88,%A(`<;;9%;;,(%A48,(@,&@8`N 8`N ,&,%@ 8K8A0&,(d@88K,s,(o@88K|,uA,(xA,XA,(eA,EA,(fA,gA,(nA,iA,(A`8A|````!8888,d,(sAH/(o/uA<,(x,XA0/(eA(/EA ,(fA,gA/(nA/iA,(OFӂOL^AK`e,(dAK @ ErrFmtFilter`aA`a:!` |aA!xpT>!,<aAA, A8ap8 88|KI`8`KUA(8a8aKI`,#@4\l|dna찁8aKMA(8|, @ 8|f,@ 8,@ 8,@ `8H:,@ ,8=(9@;"X8bXcKA(a8bXbKA(aaKA(a8aKA(aaKyA(`v8aKiA(`u(?@;XcKMA(`t8aK=A(`saK-A(`r8aKA(`q8aK A(`p8aHKA(`o(.@9µXaKA(a8apKA(ac#KA(a aa(KA(a80`KA(@aH`KyA(PaX`KaA(A a|}!A||֢8|2||B!H| R|"|aX|*z%|c|*|||"||c"8,(@p@,@KSM`8|8KW`bX8p{KX`KS`,@KS `B ;{88K]`:KS}`,@xKR`{8X8c&xK]`KS=`,@8KR`{8X8ؓpK]I`KR`,@KRI`{8X88K] `KR`,@KR `{8X88HK\`KR}`,@xKQ`{8X8ГK\`KR=`,@8KQ`{8X88K\I`KQ`,@KQI`{8X88K\ `KQ`,@KQ `{8X8cK[`KQ}`,@xKP`{8X88K[`KQ=`,@8KP`{8X8K[I`KP`,@KPI`{8X8aK[ `KP`,@KP `{8X88KZ`KP}`,@xKO`{8X88HKZ`KP=`,@8KO`{8X8(KZI`KO`,@KOI`{8X80KZ `KO`,@KO `{8X8@KY`KO}`,@xKN`{8X8PKY`KO=`,@8KN`{8X8p8KYI`KN`8 8!8`}px!,Aa!AaN , A:·X,@KM`@,@lKM` 8bX8acKXu`8KN%`,,A@PKMi` 8bX8ce8HcK`8KM`,AccDKQ`, @0KM`8bXccKa`cKMA(`}8|~b`|K9`cK%A(`|]8|~`{K `ccKA(`{|z88|~`zK`cCKA(~~|8a`|~`zK`cCKA(`z~t|<`72882|~"|!.KqA(`w~|s88|~`sKU`bcKAA(|cah|u8|~`uK!`bK A(|8~ap|8|~`uK`bKA(~`u|v8 |~`tK`bKA(`t~|s88 |~`sK`bcKyA(~u`ra~?|p8 |~`pKY`bKEA(`p}}z8|qr8 |~`qK%`b#KA(`q|8H|n8 |~`sK`bcKA(`s||v8p|8|~`K`cKA(|c$!`|8c|*ah||*Ap||*||*||*||*||eKY``KEA(8(`~|`}K1`cKA(0`|8|`{K`ccKA(|@`}8|`{K`ccKA(P||8|`}K`cKA(|c||8|K`8` 8!}px!KKH`8|a8achKu`KIM`KKH` 8bX8ccFcK`8KI `KDAK<,AAK,8a8 8cFKU`K8a88cfK9`8Hcc8HK8aF8 8K `KT8a8 8K`K,K!a;(;µX!aXhp!aPx`AXhp!@ccAac#KA(c (~|#@A$8w|c, (@|, )A|cCKeA(|#@A$8w|c, (@|, )A:8ac$K8a 8K`8aK A(cD|cK:8a888KwA(:8a:88KA(,@P8ac$K`88aK=`cD8aK-`8a888KvA(8a;A88K)A(,@a9upi9Zxc9aK|c08! }!AaN 888a```!;ZKmA(8,88z@aK88a88````!:KA(8,88u@Kx88a;bK< `|a88|DK88a;bK;`|a88| KXaZK A  ErrSetSys,A 8`N Tc>T>H> @ ErrPrErrno2|aL;aa*a ``!```d8` paxapxaaHU8!}aN AErrGet}Cya^|}&aA!T}>a7`aA``!`xp!A(A 8X,)A 8X,$A 8X,5A 8X,%A 8X,&A 8X,'A 8X,*A 8X,/A 8X,.A 8X,<A 8Xa,;A 8X x, A`8X, A`8X(, A`8X0. A`8X8- A`8X@-A`8XB ,,,8@b@,@\8`8!|} px!AaAaN K?m`bX 8cKJ5`K?`8`8!|} K(@b@,@@K?` 88KC`bX,8cKDE`K?}`8`8!|px} !AaAaN ::@D| c$B@(```!, @:8C , @:8Xc#bK}`,Ab@,@DK=` 88KB`bX8cKC5`K>m`:,c#c 8H -8`8!|} px!Aa!AaN 8|xabKA(b|cPK`,@,@pb@,@D~K<` 88~KA`bX8ccKB)`K=a`8`8!|} Kc#KA(`v8|yKA(~,?`x8A|y8|c"|yKA(a|,78A||v8|c"w|yKA(~,2~`v|8A||8p||y"KYA(a~P,5|w8A|y|v|r8cu|yK!A(|,4`u|8A||||r8|y"KA(,3|~|8A|||8||y"KA(a~u,1~W|8A ||"8|"|c"|c*q|yKYA(~4,>a|r8 A|y|s|q8c ~|yK!A(|,/`p|8 A$|||t||e8 |y"KA(,.a}|z|28 A||"8 |c"|c*n|yKA(}|za|r,<|*8 A$||"||*|c"8c |o||yKEA(|r},;|z8 A$||8 |||*|y"KA(`{||Ax|8,2A,|||"|||*|"8|c"r|yKA(||a!||"|"|",8|"|8|AcKYA(`{8!,9A||8cy<c#K)A(`x~8A||c"8ce~bKA(`u~8A||"|c"8ce~|bcKA(`rA ||8c||,?A ,= @H,>A ,= @ 8`KPbcKeA(,@8`8cc8p8g| GN!A(,Az@,#@|8apKA(||`|`"8||KA(|c8|K1A(z@,#AP||8|8p|*H 8`@KxKA(Kb@,AK6`bX cc80cKA`K7u`8`K$c#K9A(,@8`<8yc8p8g| GN!A(,A|z8,#@d8apKA(`ybKA(|c8|KA(z8,#A(8|8pH,>8AK K A(Kb@,AK5`bX 8c80cK@`K6e`K C (ErrIGet|aLa*aAa `!````d!8` aaA!pxaaA!K 8!}!AaN A ErrGetAllT>@, @ 8`N H2 @ ErrPrBadInfo8,&@8`N H3 @ ErrMergeTxt 8@|;,!q, |,A$ @D|88B@ `!, @88C , @8, @,|}AX@0c``!KA(;8c|?@Ac8!}N |,@@K2`8O 8~K7M`cbX8cK7`K3-`8bX8!}N ,ALK2Y` bX88cK=!`K2`8bX8!}K8bX8!N A ErrGetFld|`T>8!88888889!x9A8 p9808(88K88X,`@$xH8( A|(*| N a`8!P}N a`8!P}N a8`8!P}N a`8!P}N a0`8!P}N a(`8!P}N a `8!P}N a`8!P}N a`8!P}N a`8!P}N a`8!P}N a`8!P}N a`8!P}N a`8!P}N A ErrGetFldL|Tc>;!`pahxpaxKU8!}N AErrGetL`X|}&aؑ!|#@@b@, Ab ,, @db@,@8K.u` 88K3`~8XK3`K.`8`@8!0}N 88a8888x89Ap9!98888K,@$b@,@|@@8`>9!p, A88>8| ````!8c8, AA,@:>cc8\ccbK`~8p~"||d,# @`8x, @`xcK|A(PbK| A(,>@8w>>8>8>, A4||#@````!88c, AA,8Xc@;>c8\ccbK1`c|"| :, A`K{aA(PbK{MA(,>AHcc8lcbK`,;A4;XcK{A(P8x, @`xK8`8!|} !AaN |K|wK,@(cc8cc9pK`KD~4T~@9@K0AT;9:KP C  ErrITrace`` |!q,<A, AL8!,~,}||cxx`T8|N 8`KA(,#~@cKA(88`8!}K8`KA(||y~A, AKT8`8!}Kt A ErrGetAttr8X``aT>|`!aKz`,b@A,@tK! ` 8~8~K%`bX8cK&A`K!y`cccd8KA8`ax8!}N ccd 8K 8`ax8!}N cKwA(c|cP8|Ky`, b@@,<AP, A(@b@,@hK` 88K$`bX8,cecK%1`K i`8`8!}aN 8`8!}aKccceK`,8`8|H 8`8!}aK8`KA((,}A @KcKA(88`8!}K(8`KA(||y}A, AK8`8!}aK,@Kt AErrCpTo`|aA!!a `a ` h p x  ! A b ,,>@pb@,@ @8! 08`}N K`bX 8cK(u`K-`8` @8! 0}K;`d;;a8acDcDK`c,@T;cC```!KtA(8|PC:ccKt}A(;8ccC|8@A8(A8bXxH8c| *| N ; hcKt-A( (|#@A$, (@8||, )A;X;!8a8c8 pKN A(88aKÉ8a888 pKMA(8b ׃,cCKsA(`c#KsA(|P|( @b@,@!aaxb ,>A4, Ab ,|(@@b@,@`K` 88K-`bX8|ccK`K `8`8!}N 8`8!}N axcK`8`8!}N 8`K~A(,# dA,|(@@KcK~A(8 8`8!}KL8`K~qA(|~y dA, AK8`8!}N A ErrCpFrom``a T>|!a,<A, A(b@(@x,@DK`8 8KI`8bX8cfcK`K%`8`8!}aN <\Ac``|"xch\|y@H`~,p(;@b@,@@K`8 8K`8bXcK1`Ki`ap~cd 8K-H)8`8!}aK(8XccKm`,@X;cKkA(c|cPKm`,8`@(,8`@D| 8B@(```!,%@88C ,%@8@,@\|,@@K`8 8KM`cbX8DcK`K-`H8`8!}aK8pc8cH!M`,ap@ ~,K$88`8!},K8`KzA(,#~@(cKzA(88`8!}Kl8`KzA(||y~@8`8!}K@ Ax ErrCpNetToInt ,, Ad d8,#| 8cADx B@$`! |Ґx 8cC |Ґ8`d,N @|ErrClearT> |!a,=axA, A<,axccH |c8!}N 8`Ky=A(,#A8,ccaxH8!|c}N cKyA(88`8!}K|8`KxA(|}yA, AhK,8`8!}N A8 ErrCpIntToNet|```!Qab ,=A, Ap8paH`,A(8`8!}N ,?p8`AԐ8!}K8`KwA(,# eA(8paH9`,AKxcKwA(8 8`8!}K\8`Kw-A(|}y dA, AlK8`8!}K AxErrCpIntToNet28` ,(M 8`N @ ErrIsAInfoT`> (Ad,8`N `H@ @$ ErrSetLength8` H @ErrPrTc> |aA,!, A088889;`88x89Ap9!98888KcKdA(,@88Xcc8dxKcKdA(#c8cKdA(,@<8XcccgdpKcKdqA(88"`P8Xccd 8K`cKg`cKd%A(`}AcPcCKd A(,@@8XcEccgdK cKcA(88|cdPcKcA(,@<8XcccgdKcKcA(88"`PcKceA(,@<8XcccgdKecKc5A(88"`PcKcA(,@<8XcccgdKcKbA(88"`PcKbA(,@<8XcccgdKcKbA(88"`PcKbuA(,@<8XcccgdKucKbEA(88"`PcKb%A(,@<8XcccgdK%cKaA(88"`PcKaA(,@<8XcccgdKcKaA(88"`PcKaA(,@<8XcccgdKcKaUA(88"`PcKa5A(,@<8XcccgdK5cKaA(88"`PaK`A(,@T8X cdc8Ki`cK`A(88*`PcceH `cK`A(8 |P||8 H q``8!P}AaN 8bXH8!PN AtErrIPrTc>K\ @ErrPrLN @ErrFreeN @ ErrProExit|!,,'L#BA |cKdaA(8!p}N 8bX8!pN AD ErrPrErrno,8A8,`g,AT9%`eAH,%99@`!|H@AUF>88,(A,%| H@99FA|'@|!|8P@4| ``!g88,#%A8T>|d1C `N T>8|d1T>|d1C K9H@88UF>,(AKh8`N @ErrSafeAsFmtString  , A 8`N H @ ErrSetMsgFile8`d8`N @ ErrSetGetTxtT`> 8`, A (N 8`N @$ ErrSetMsgKey8`N @ ErrVersion||y!AL, 8@a@8!QaxK%` X8 |K `K`,@08`8!}aN |c8xK@`,@H,AK`8 |K e`K`8`8!}aK|c8xH`,ADK A4ErrPrBadInfo@AF43_12`` |}&aA!`}`̑!A, &@(8( @c,@;c;@c. AKWA((#,@lA8``!c8x;KWA((#,@ @. 8;ZA`|:@AcKWA(,@(#AL;};X``!c8x;Z;{;;KW9A((#,@\@;, @8`8!|!Aa}} N ||`||,AKX||`||,AtK(||`||,AK||`||,@Kb@,AK`bX 8LcK `KA`K|,;@b@,@cKUA(,@(#A\;]cc8|```!z;Z;;KUA(,y;9+#8|@(LZӂc@,;8A`;KL||||,KȀ||`||,AKXK`bX 8lcKy`K1`|K ;;K C ErrMergeTxt@AF44_13T>b@|!,A8`x8!N K ` 88~K`bX8ccK=`Ku`8`8!}N AErrSetLength@AF45_28Tc>8h|dN @E8ToUcTc>8h|dN @UcToE8Tc>8h||48TN @E8ToB8Tc>8h|dN @B8ToE88bh|N @UcsToE8s_ErrCnt8bh8N @UcsToE8s_ErrReset88h8`!8|;yA8c|88K8N @@E8sToUcs,8·h|L 8c8| `!8|(8cC N @<E8nToUcn88h8`!8|;yA8c|88K88`N @D UcsToE8sCheck,8¸h|@,8c8| `!8|(8cC 8`N @@ UcnToE8nCheck88h8`!8|;yA8c|88K8N @@ UcsToE8sSubst,8¸h|L 8c8| `!8|(8cC N @< UcnToE8nSubst,8¸h|L 8c8| `!8|(8cC N @<UcnToE8nTd>8h8`{`, M |e N @ A7ToE8Tc>8h|d(L 8`#N @E8ToA78c8h,L 8{||8c`B@(`!,&A8| 8c`C ,$A| N N 8c`C K @A7nToE8nInPlace,8h|L 8c| ``!| (@8#8cC N @DE8nToA7nInPlace|`````!aKMIA(8|"8p|px8x8`H`8,<|cpAp|P8!}N AUcsToUtf8sFast||`!QacHY`8pcaK`pa8|K1`,>pA8!}N AUcsToUtf8sFastOverlap|``|!q|xap|8x|8p8`H`,>|cAp|P8!}N AxUcnToUtf8nFastOverlap_2|`````!aKJA(8|"8p|px8x8`HE`8,<|cpAp|P8!}N AUtf8sToUcsFast||`!QacH`8pcaK`raK`,>pA8!}N AUtf8sToUcsFastOverlap|``|!q|xap|8x|8p8`H`,>|cAp|P8!}N AxUtf8nToUcnFastOverlap_2f|#8@|(@@9#8#@t9H```!i9)8c,+@N @PrEchoTd>8bx8c||c N @ PrToAsciiTd>8bx8c||c N @ PrToEbcdicT>T>99 H0 @PrBinAllT?M T>U>U)>HN @ DpPrintBinT>T>9H4 @ PrAppcAllT>T>U>9 Hp @PrAppcT>T>99 H0 @ PrAppc2All,%M T>T>U>U)>HhN @ PrAppc2}Cy|}&aA!`T>`waXaAU2>!xp! xA(aT>A d8bx88,&`A b8xK}A(bK;iA(|w8 cE`wKYA(bK;EA(;(2 ~@8@:½x:|@@::bp*2 69:R ````!,1|@/ At/|@T>|4@@|||%8@8}.$V}:x})Rx|Kx|Bx|#y@:  `o,18uA|8A,|x@A |@8LFBAbp8@K)A(bK:A(~:(5A8|::`:@: .: ````!,5|@@|@@A4,A(|y8|@A8V: :s:(3A8| 88` 8!} |px!Aa!AaN A(|y |@A,AD|@A<|z|@@<|T>|T>, A,~AA$K4AK|~T>| |^N!A(T`>,5K8K]A(bK8IA(~K4|ypTe>8``bT>@$|(KA(bK8 A(~K|08$KA(bK7A(~Kp`8,bA80KA(bK7A(~K|#p@LQA8| ||%8@$V }?.8$})RxV( |:x,})3x}Rx|:x}&Cx|#y@K@b|yTd>`@@P8| |%0@<|| .|(||(||4T@`/~OAl8v| |#(@X|| .|d||d|c|d4T@`K$::bp:2|  -5) 9:R````!|s8T,#A`,@T>}|1@@<|}?|(H@(96}_.e}IJxV}kbx})[x|Rx}*+y@ M`o:A||x@At,A |@@d8p@4b8KA(bK5}A(~:(4@pKb8KaA(bK5MA(~K,&@0T>b8|(K-A(bK5A(~KbT>8$|(KA(bK4A(~Kp|#p@LMAt| }?|(H@`|.V$ %e |Bx(})RxV,|Kx}hBx|Rx|Cx}$+y@ 8 `o:MKA$K@b`Td>`|@@P| %8@@9#}0| .|(||(||4T@a,~L!A| |%8@|8c| .|p|e ||d|c|d4T@aAhK:½x:|@8@@::p*2 :r:R6 ````!|@, A,1@@|T>|3@@ ||$(@| }?.$(,}(Bx$D }%*x}F2x|:x}+x|3x|#y@`8 : `oA,1A||x@At,A |@@d8p@4b8KA(bK2}A(~:(5AKhb8KaA(bK2MA(~K8p@4|bT>8|(K%A(bK2A(~K|b8$T>|(KA(bK1A(~Kd8p@(b8,KA(bK1A(~K4b80KA(bK1A(~KAK,@|ybTd>` @@P| (@@8|| .|||||4T@`,~OBA| | (@x8| .|||`|||4T`@`K@)2 :bp:2:R | -```!, LpBLBKBAtAh|T>|1@@X ||$(@H| }?.$(,}(Bx$D }%*x}F2x|:x}+x|3x|#y@8 `o:M||x@At,A |@@d8p@4b8KA(bK/A(~:(4@Kb8KA(bK/A(~K8p@4|bT>8|(KaA(bK/MA(~K|b8$T>|(K1A(bK/A(~KdAK,@|ybTd>`|@@P|  (@@8|| .|||||4T@`,~L!A| | (@x8| .|||`|||4T`@`AKT8`AAa8!N C$ ThDispLine| !`eb KA(b 8!p}N A4 PrPtrToStr||+yT>aAU=>!U>T>!aA, { ;A, ;A, ;@T6(@`W>8T>Ki`,7A8KY`;  a846K*U`6K`K!`8L6aK*-`6Kա`,;A" ,7 :A:c888``!Apx8ab`cccjKKԕ`a88K)`K`::~4z (T`~z |5@AKI`;c>ca8LK)I`KԽ`KԵ`8!}!AaN 8c88````!Apx8ac$`cccjK:;9~4z (T`~z |5@A,7ALK]` ; a8LK(]`K`K,;AK,88fT>Tz>K `,7@K8!N (T6@KX8!N A PDpPrintBin@AF12_5|}&aA`q>NB!N1B`;NRBT>T>NsBU>;:!a8xa(0Ac:PH :c,:,@ H:X@,>APH ,>AD(Pb ,/$AA,$@(;Ap8T8a, @ ;NH8p@ H$85|(@ 8H8"cKɝ`Nb (P@|H(P@pH@h:PPXNs`hPH\NR0J8@px0A,a(0ccf8c(9 K}AHb c|y@L zD,8t$z,,>zN1; A8H ,>A,a(0ccfcGc(9 PKALH(a(0ccfcGc(9 KA$a|A$pax08@vHA88TcK`A$aw8!|} !AaN C PrAppc2@AF13_98b`8N @l__sinit80000000_x_2fsapmnt_2fis0174_2fa_2f722_5fEXT_5fREL_2frs6000_5f64_2fgenopt_2fkrn_2fsi_2fsiux_2ecpp__Fv`;`|!A, @;8` 88pHqA(,A$p8` 8p8HqA(,@\,?A888`8!}N 88`8!}K8`8!}N 8`8!N ASiInit8`N @SiExit|```|c|!q|HpyA(,@bc} 8(@8(@$/<,A,Ap, AH@$8`8!}N 8`8!}N 8`8!}N 8`8!}N ,B,JAxAt@K8`8!}N }8`8!} }K8 A`SiSocket|``8``8Kl @ SiSocketIPv4|``8``8K, @ SiSocketIPv6|``8``8K @ SiSocketUDS|`c!K*A(,@pb ,AD, A$8`,9A8!}N 8`8!}N 8`8!}N 8`8!}N ASiClose``b|``.!a,@@8x$8t8|Px| px```!|8cC 8ap8l8xcdx$8sq,A$,A,@8,=8qA r,>A(@x~xa8pHlAA(,@,b /,DA, , AA,,AP@(8`8!}N 8`8!}K8`8!}KA@8`8!}K8`8!}Kx,FAA,9,CA@`8`K8,QAtAp8`8!}KH8`8!}K88`8!} K88`8!} K8,=8qA r,>A(@tK0(l@88arc8qK+)`8arKuA(8T>K88ap8H`K ASiBind|`T>c!HiA(,@b /,DA, , AAH,,A$8`@8`8!}N 8`8!}N A@8`8!}K8`8!}N 8`8!}N ,FAA,9,CA@8`Kh,QAtAp8`8!}K8`8!}N A@SiBind2|`|c!HhA(,@pb ,AD, A$8`,9A8!}N 8`8!}N 8`8!}N 8`8!}N ASiListen|``aA``!T>!A,Ap,AP,@ ,$A (A;@Apc8p8xHgA(`y,A<,p|@A@,>A;`}|@AT8<8`| 8!}!AaN |Pc8zT>cdK]`p}8|PT>|K88`8!} KAD,A8,@T,=A z,>Aa~K(,=A z,>A |Kbc 8(@t8(@D,DA, /A,A, A`, A4A 8`K8`8!}!AaK8` 8!}!AaK8`8!}!AaKt8`8!}!AaKP,9AA@\8`K8`8!}!AaK/L,OA,F,JAAAK ,Q/yAAAK8` 8!}!AaK8`8!}!AaK88`a 8!N ,$A (A;@K,$A (lA;@K ASiAccept|```!q8ppcHcA(,@bc 8(@x8(@L,DA, /A,A|, AT, A,8`A8`8!}N 8` 8!}N 8`8!}N 8`8!}N ,9AA@t8`Kp8`8!}N /L,OA<,F,JAA @,K8`8!}N ,Q/yAAAK8` 8!}N 8`8!}N p}8`} K A SiAccept2``b|``.!a,@8x$8t8|Px| px```!|8cC 8ap8l8xcdx$8sq,,/AlA@@ (@88qr~xa8pH`A(,@bc 8(A<8b`xH8c| *| N 8` 8!}N 8`8!}K8`8!}K8`8!}K8`8!}Kp8`8!}KL8` 8!}K(8` 8!}K, /, AA,A@8`K,AA8`8!}K8`8!}K88`8!} Kl88`8!} KP(@88qrtK(l@88arc8qK`8arKA(8T>K88ap8H`K4 A SiConnect|`T>c!H]A(,@8bc 8(A8b`xH8c| *| N 8` 8!}N 8`8!}N 8`8!}N 8`8!}N 8`8!}N 8`8!}N 8` 8!}N 8` 8!}N , ,/ Ad@,AAlK8,A@,8`8!}K8`8!}N Ax SiConnect2|`~`cT>|!H\IA(,AH,?@ 8`8!}N 8`8!}N bc~ 8(@,J, A, /A\,A8, A8`@8` K|8`8!}N 8`8!}N ,A0A,@ 8` K,8`8!}N 8`8!}N ,LAA,9,;Ad@8`K,OAA8`8!}K ASiSend|`~`c|!HZA(,AH,?@ 8`8!}N 8`8!}N bc~ 8(@,J, A, /A\,A8, A8`@8` K|8`8!}N 8`8!}N ,A0A,@ 8` K,8`8!}N 8`8!}N ,LAA,9,;Ad@8`K,OAA8`8!}K ASiSendV``b|aAa=a\!T>`a.!A,@88x$8t|Pxpx| ````!|8cC 8ap8l8xcdx$8sq,A,A\,@8(@89qr~xaFce8pHWA(,A@,<A|8`8!}!AaN bc 8(@,;A,/A,A, A`, A4A 8`K8`8!}!AaK8` 8!}!AaK\8`8!}!AaK88`8!}!AaK, /9AhAA@T8`K8` 8!}!AaK/J,LAH,@,D/FAAA @K8`8!}!AaK,O/QAAAK88`8!} K<88`8!} K (@89qrtK(l@88arc8qKA`8arKA(8T>K|88ap8H`K ASiSendTo|`~a?cT>U>|!HTA(,AH,?@ 8`8!}N 8`8!}N bc~ 8(@,;A,/A,A\, A8, A8`A8`Kx8` 8!}N 8`8!}N 8`8!}N , /9A4AA@8`K8` 8!}N 8`8!}N /J,LA@,@,D/FAAA @(K8`8!}N ,O/QAAtAK A SiSendTo2``|ab ``!1px, A;ab.,@88x$8|Px| ``!|8cC 8a88xcdx$8,A,A,@d(@<8`8ax~~caap8p (04HQYA(,A8,=A}8`8!}aN bc 8(@,;A,/A,A, A`, A4A 8`K8`8!}aK8` 8!}aKd8`8!}aK@8`8!}aK, /9AhAA@T8`K8` 8!}aK/J,LAH,@,D/FAAA @K8`8!}aK,O/QAAAK88`8!} KD88`8!} K((@8`8ax~~K(l@8a88K`8aKA(8xKL88a8H`K8xK, At SiSendMsg|`~`c|!HNeA(,AH,?@ 8`8!}N 8`8!}N bc~ 8(@,;A,/A,A\, A8, A8`A8`Kx8` 8!}N 8`8!}N 8`8!}N , /9A4AA@8`K8` 8!}N 8`8!}N /J,LA@,@,D/FAAA @(K8`8!}N ,O/QAAtAK A SiSendMsg2|`~`cT>|!HLA(,@bc~ 88((@@,/@, ,9/LA,A`A@A 8`8!}N 8`8!}N 8`8!}N 8` 8!}N ,A8, A, A @xK8` 8!}N 8`8!}N 8`8!}N AlSiRecv|`~`c|!HKA(,@bc~ 88((@@,/@, ,9/LA,A`A@A 8`8!}N 8`8!}N 8`8!}N 8` 8!}N ,A8, A, A @xK8` 8!}N 8`8!}N 8`8!}N AhSiRecvV|`aaA`a<!a[T>U>!A,A,A,@; |9p8x!pcHIEA(`x,AXp|@,@4A,A,@4,<A z,=Ap(ALa}8`8!}!AaN 88`8!} KK,<A z,=A(AĀ|KK|,=A$(lA;`|@A8KP|Pc8zT>cDKQ`p8|PT>|K@L,=AKbc 88((@@|,/@, ,9/LAA\A4A 8`K8`8!}!AaK8`8!}!AaK8` 8!}!AaKl,A@, A, A @tKx8` 8!}!AaK(8`8!}!AaK88`Aa 8!N ; !pc|9p8xHFqA(`x,AK,; K Ap SiRecvFrom|`aa=T>|!q9ppcHEA(,@0bc 88((@@,/@, ,9/LA0AlAHA$8`8!}N 8`8!}N 8`8!}N 8` 8!}N ,A<, A, A @hK8` 8!}N 8`8!}N p8!}8`}K A SiRecvFrom2|``aA``!!, A`, AT,Ad,#A<,A,,@;@b ;ad.px,@8a88xc$|Px| ```!|8cC 8a88xcdx$8 apAx(8p04HBA(`|,Ad,:AL,ax|@A@~,#A((lA;`|@AD848`8!}AaN |P8T>K=`~8|PT>|)K88`8!} KAL,AL,@l~,#A ~,#A (AK,~,#A ~,#A(AhKbc 88((@@,/A,A, A`, A4A 8`K8`8!}AaK8` 8!}AaK8`8!}AaK`8`8!}AaK<, ,9/LAdAAAXKL8` 8!}AaK88a8H`K88`А 8!N ;@K;@ 8a.px,@8a88xc$|Px| `!|8cC 8a88xcdx$8 K88H` K;@K A SiRecvMsg|`~`c|!H>eA(,@bc~ 88((@@,/@, ,9/LA,A`A@A 8`8!}N 8`8!}N 8`8!}N 8` 8!}N ,A8, A, A @xK8` 8!}N 8`8!}N 8`8!}N Ah SiRecvMsg2`<`@|`8f!q8pH!Q,A|,AL,@;`8p8xapcH:A(,@b ,A, A@,A\8`,9A,8!}AaN 8`8!}AaK8`8!}AaK8`8!}AaKp|@,@A,Ah,@4,<A z,=A@(Aa}8`K88`8!} K8`K,<A z,=A(A|K8`K,=A$(lA;`|@A8Kx|Pc8zT>cDK`p8|PT>|8`KP@@,=AK88`A 8!N ;`apc8p8xH8A(,@K;`K A SiGetSockName|``!q8ppcH8A(,@b ,Ap, A0,AD8`,9A8!}N 8`8!}N 8`8!}N 8`8!}N p8`8!}K ASiGetSockName2|``aA``T>!Q,A,A,@\;`8p8xapcH6A(,@b ,/9@,L,OAAX8` @,8!}AaN 8`8!}AaK8`8!}AaK8`8!}AaK,A, A8`AXK|8`8!}AaKLp|@,@A,Ah,@4,<A z,=A@(Aa}8`K88`8!} K8`K,<A z,=A(A|K8`Kx,=A$(lA;`|@A8Kx|Pc8zT>cDKM`p8|PT>|8`K@@,=AK88`A 8!N ;`apc8p8xH4aA(,@K;`K A SiGetPeerName|``!q8ppcH3A(,@b ,/9Ap,AL, A(8`A8`8!}N 8`8!}N 8`8!}N ,L,OAA8` AK8`8!}N p8`8!}Kl ASiGetPeerName28,``~a`|}&.&!A` -)}AA;`A@08(@d/,,ApAX,AHAD,;A |ap~8p|8xH2=A(,@b ,/9A,Ax, ATA48`|8!} aN 8`8!|} K8`8!|} K8`8!|} K,=,@AAAKhp|@@ A`A8A@08(@T/,,ATA4,AA 8`Kx|48TdK,A@|xKx|48Td|K88((@x@(, @x|48TdK`(A(|x|K88`ʐ |K<|xK,@x|48TdK, / , AA<, A@|xK(Ax|xK, A@؀(AP(AD|x||Kx|t8xdK88`a 8!} N ;`K,A@;`K;`K88((@A;`K;`Kx,;`A;`Kd88, (+@,;`@@K<;`K4;`A;`K$;`@K C SiGetSockOpt|``||!q8ppcH-A(,@b ,/9A,Ad, A@@ 8`8!}N 8`8!}N 8`8!}N 8`8!}N ,=,@AA@K|p8`8!}Kp A SiGetSockOpt2|8,,)`/`!q|AAdA@<8e8((@@,,//A@Ac||!H)UA(,@bc 8(@,/,A,/AtAX, A8@8`8!}N 8`8!}N 8`8!}N 8`8!}N 8`8!}N ,9,=/QAAA@Kl8`8!}N A$ SiSetSockOpt2|`~`c8!H(A(,@|b ,AL, A(8`,9A8!}N 8`8!}N 8`8!}N T`8`h8!}K ASiGetBlockMode|`~T>c8!H'A(|`,A~x,?`x@8H&A(,@|b ,, /9ADA$A 8`8!}N 8`8!}N 8`8!}N 8`8!}N 8`H&AA(,@KTb ,, /9AAtApKP A<SiSetBlockMode|`~`c8!H%A(,@|b ,AL, A(8`,9A8!}N 8`8!}N 8`8!}N x`8`8!}K ASiGetCloseExec`T>|88|t!xтH$A(,@pb ,AD, A$8`,9A8!}N 8`8!}N 8`8!}N 8`8!}N ASiSetCloseExec!|.,@888x$8| Pxd!y 8x$}) (08@HPX`hp```!|'8C 888xdx$8!pN 88H`8!p}N A4 SI_FD_ZEROc8xfтTe|(6x$|*|+x|*N @( SI_FD_SETc8xfтTe|(6x$|*|x|*N @( SI_FD_CLRc8xfтTex$|(6|d*|8|t8xN @0 SI_FD_ISSET|a,a>T>!qA=bT9HM|c|P|6p} Jy Udy(.}HPy+$| Z}(p}@8P8p}Iy Udy(.}HPy)$| JxH,@b,>@p,AL, A(,98`A8!}N 8`8!}N 8`8!}N ,AK8`8!}N |c8H=,@K@ ATSiSelect|!|cHA(8!p}N A(select__FiP6fd_setN22P7timeval|``T>|!H,@b,>A\,/ ,@88`A$@8`8!}N 8` @K8`A@K,/ ,@K8`8!}N ASiPoll|!HA(8!p}N A$ poll__FPvUllTc>N @SiHtoNlTc>N @SiNtoHlTc>N @SiHtoNsTc>N @SiNtoHs|`~T>axc;|c8!QpcP|x~a|```!8ax8c8p8 K-,A, ;`{@W>(A,?A\b@,@KuM` 8C8Ky`bX8`8d8cKzu`Ku`,Ab@,@Kt` 8K8Kyy`X8b`88~cH-`hc8ccfcKy`Ku)`8`8!}aN 8`8!}aK؀p, AP~T>| A@tb@,@ 8`KKs`bX8`z 8pcK~`Ktq`8`8!}aKH@b@,@8`8!}KKs}`bX8`z 8cK~9`Ks`8`8!}aK8`8!}aK8`8!}aK8` 8!}aK\,AKcW?AKD AdSiPeek|`8T>,,8!/|1AA`A,|cc|K/9`8!}N c`8K-`c8!}N c`8K`c8!}N c`8K`c8!}N ASiGetErrorText`;|aA;|!;c c<!!ax|`!8ax8c8pcgK,A`z, @;=W=>(A,=A\b@,@LKp` 88}KuI`bX8`&8d8cKu`Kq`,Ab@,@pKp]` 88~Kt`X8b`88fcK`hcc8cccKua`Kp`8`8!}!AaN p, @b@,@8` 8!}KKo` 8bXc8` 8ĐcKz=`8Ko`8` 8!}KT~p@ac```!cc88K,A`~,A,@b@,@pKn` 88}Ks]`X8`88cGfK`h8cCceccKs`Ko `c8!}!AaKt b@, c,A@,C8`A08` K(Kn` 8X88b`8_ccKY`hc cecF8cKx`8KnI` Kx@8`8!}KKm` 8bX8` 8HcKx1`8Km`8`8!}KH8`8!}!AaK4cW>K$ AlSiPeekPendConn|`8`aW>!aH-A(,@@,@Klu` 88~Kq`bX8`8pc K%`Kl`{'cKA(,#@,@pKl` 8 8}Kp`bX8`8c Kӹ`Klq`8`8!}N 8`8!}N ;,<`~A;`;``!;8`cKU,@;{|;@Ac,@,;}``!8|;K;|?@AcKA(c8!}aN ;`K{'cKҝA(,#@8K|c8!}N A,SiGetMaxSockets| 889 9`~8!!9e@8ap9A8aaaaaȐȀv!ptTF>w$}&px$}&Fpy$!zdUfF>{$}&p|$}&Fp}$8!~aA~HA(,A,A@,@x|KiA`b 8w8cKm`bX8`c8 8Hc(Kne`Ki`88` 8!}N 88`8!} K8`8!}N b ,AD, A, A8`,9@8`K|8` 8!}N 8`8!}N A8 SiSendSocket|`8aA8`8!8`! 89t9!8!8aАH }A(,A,A@,@L|}KgI`8~8Kk`bX8`8c8c0Klu`Kg`88`08! } N aȀ``($ @t8`8b@,@Kf`8~8KkA`bX8`8(@,@d;{Wc>H AA(|zy@,@DKee`8~8Ki`bX8`88c0Kj`Ke`cK88`08! } !AaN 8pccD88K,A,@HaKd`8~8KiE`bX8`8c0Ki`Ke`cK1cCH QA(88`08! } KDp|@AX,@Kd-`8~8 Kh`bX8`88pc0KiY`Kd`KtcCH A(,@8`08! }KcH``cHe`,A`|Kc`bX(?9xc@a(<Ac8`8c0Kn-`Kc`8`08! }K(Kc)`bX8`8zc0Km`Kc`Kpb@,@Kb`8~8Kgu`bX8`8\c0Kh`KcQ`88`08! } Kb , , A,Ap, AH@$8` 08! }N 8`08! }N 8`08! }N 8`08! }N A4,9A,L@8`08! }N 8` 08! }N At SiRecvSocket````aAac|!T>,T>!QA,A,@l;@8ap|||8|*T>KYQ`|@,AA<88` 8!}!AaN ,=A$(lA;`|@A88`K|P8rT>cc$KUm`8`|PT>|}!8`KpA,AH,@,;A r,=A (A0xa}K|8`K ,;A r,=A(AtKH8`K,=A8K88`!xa 8!N ;@|8ap||8|*T>KW`|@,AAKl;@K A8SiConvSockAddr! |ax8K¹A( 88axK¡A(ax 8KA(ax 8KyA(ax 8KeA(ax 8<8@KMA(ax 8XK9A(ax 8K%A(ax 8x8K A(ax 8KA(ax 88`KA(ax 88@KA(ax 88KA(ax 88KA(ax 8KA(8`8!}N AlSiPrintPlatformInfo|`4(.Ab 8`xH8|(*| N 8c|N 8cN 8cN 8cN 8cN 8cN 8cN 8cN 8cN 8cN 8cN 8cN 8cN 8cN 8cN 8cN 8cN 8cN 8c$N 8c0N 8cT>U >(@9#x 6dx$}@`P9c@9D8;H|Q.%x6dx$PP|$ (x6dx$}DHP|R08x6dx$|(P|1.x6dx$|(P| 1.x6dx$| P}).88`N a$aGahH90 @8appendRule__9NIACLIMPLF11NI_ACL_STATP11NI_NODEADDRT2UiT4|`8`8D8!| ```!x` 8x6dx$}0P8c|A.C 88`KA(88`8!}N Aflush__9NIACLIMPLFv`@|}&aA!`T>`w!р,@L,%A48, A;`;B;";:: `!.?8 8w8p8\KW`:,@748áW8:8888b9pK1`,@4@tV>(@z6zH|P| ., @x8`@:8!0|} !AaN 8a8K`|<@@Hcc8K`8a8K`|P88aT>K`K8cc8XKA`;,@V>(@,KKJ9`}8hKU`KJ`KKJ `}8KT`KJ`@$K748a8W8:888b9pKӡ`,@@Kp, AKKI`8 }84KTY`KJ`,?AK C dump__9NIACLIMPLFPP4FILEPcUi|`aA! !, A;;;c;C````!;:H;Z8acDc%KzM`p`8|@LT|>(@x`6xcH|P| ., @|~8瀟xa8|v8|888.KN%`b@,@lKH)` 88|DKL`bX94(c@8,@X8?88K`KHi`cp8!`}!AaN 8?88K`KH`K9$8,@Kp{6d{$|P~D@,8c~DA@;|@@ KPa88.8KL`cCc$88\KS!`,@KF` 8bX8c,@L89\ >DH898pKQU`8KG`K89\ 8>DH9p8KQ `8KF`KT@|@AK|~8瀿x`|v8|888.8KK`b@,@K Ax'checkAddress__9NIACLIMPLFP11NI_NODEADDR| P,A\``8L19@T>8`!'8`8@L,) A4L1,9U>@|$(@A 8`N `N D`N ,) A , KH`N @NiIAclGetNextLine__FPPcPc|``}aAT>!|#y!@@8`8PXcK5``g;8(" c88D99)X\K`,@@KC`" 88iDKHm`" 8K`KDM`8`8!}!AaN c#KA(`f8a8c%KQ`,@x, #@,@48`8!}!AaN KB`bX8c& 8cKM`KCi`8`8!}!K8a8#KA(,#A`{,@8c;c#KA(,#AL, A , @8cz``!8{;{KA(,A;Z, A, A8aB 8x8K``y8`88xK``x8`88xKq`,9@h,@KA`8zD8FKFE`bX8888chcKF`KB `K,8@X,@KAI`8zD8NKE`bX88HcfcKFu`KA`K``w88pc88pKT`,AT,@(K@`8zD8UKEY`bX88xccKE`KA-`K,@8c#K`,@<; 8,7@Dt}hc$88cK|c8!}!AKt8tb8KA(,@tt,@h,A`,AK?`bX88 vcKJ`K@E`t}hc$88cK%KP,@K?q`8zD8rKD`bX88bcgcKD`K?`K8c#K9`,@8; K,@PK>`8zD8eKC`bX88(c&cKD`K?U`KK>`bX88c&ccKIe`K?`K,ADK>e`bX8c& 8cKI!`K>`8`8!}!K ccKA(,#@KK>`bX8cf 8cKH`K>u`KLK=`bX8c& 8cKH`K>=`KX A NiIAclAppendRule__FP5NITABPci|``a;`;`!aKA(p8apcK,#@h, @b@,@HK<` 88}DKAU`bX88T"c K`K=-`c8!}aN ~8!c}aK`d;``!;cK`{,@,8apcK|dy@h, @K`~b@,@XK;` 88}DK@e`bX88x"hc K`K<5`c8!}aK ANiIAclParseString__FP5NITABPc|,$aA!!Aax@8P8`XcK+``g;8(" c88D99)](Kݩ`b@,@@K:`" 88iDK?=`" (8K`K;`8`8!}N ` 8K5A(,#@lb@,@DK:%`8D8K>`bX88c(K?U`K:`8`8!}N `~88KAA(cKA(`}cH&A(8}KqA(|yy@b@,@DK9y`8D8K> `bX88,cc(K>`K9`cKuA(8`!8!}N ;(=@8;`;Y`!cH&=A(48p@z;Z`|$@AcٮcKA(|;@Ab@,@TK8`8D8K=%`bX88Tccic(K=`K8`c#KAA(8`8!}!AaN axc$K`c#KA(8!}!AaK;`K ANiIAclReadFile__FP5NITABPCc8`N @NiIAclInit__Fv8`N @NiIAclExit__Fv||y;aA``!T>!!8b8xA$, @0; h,#A,B@,@Ѐ,@h@,`yh8`8 H#A(,#ap@h,=@,<@,9A,>Ab@,@DK6` 8K8~DK:`bX88,c0K`K6y`h,#@8?h8`8!}!AaN 8KKc#8Kc8!}!AaKccK T~>hKcKA(8|cKA(,#@|b@,@HK5` 848DK9`bX88cc0K:1`K5i`8`8!}!AaKacccK`cK=T~>aKqA(hK,8cd{K՛{apKK4E`bX8 8c0K?`K4`hK@$,#@ hK8KhKK3`bX8 8c0K>`K4a`hKK3`bX8 8c0K>q`K4)`h,K8PX8`cK$=``g9B8( c88D99=J0K `b@,@,#!qAT, @,%A ,&@8PX8`cK``g;8( c88D99=^@Ky`b@,@8K.`8}D8K3`|@8K}`K.`8`8!}N $, @ch,#@8PX8`cK``g;8( c88D99=^@KЭ`b@,@lK-`8}D8K2E`|@88K`K.)`8`8!}K4K)|c8!}N 8PX8`cK``g;8( c88D99=^@K`b@,@K,`8}D8K1`|@8K`K-i`8`8!}Kt8PX8`cKu``g;8( c8~8D99=P^@KE`b@,@K,M`8}D8~K0`|@8xKI`K,`8`8!}K A NiIAclDump__FP5NITABPP4FILEPcUi|,#!qA$, @ch,#@8PX8`cKQ``g;8( c88D99=^HK!`b@,@8K+)`8}D8K/`|H88K%`K+`8`8!}N K|c8!}N 8PX8`cK``g;8( c88D99=^HKU`b@,@lK*]`8}D8K.`|H8KY`K*`8`8!}K48PX8`cK``g;8( c88D99=P^HK̭`b@,@K)`8}D8K.E`|H8xK`K*)`8`8!}K AXNiIAclFlush__FP5NITAB|,#!qAH,$A$, @ch,#@8PX8`cK``g;8( c88D99=^PKy`b@,@8K(`8}D8K-`|P88K}`K(`8`8!}N K |c8!}N 8PX8`cK``g;8( c88D99=^PKʭ`b@,@lK'`8}D8K,E`|P8K`K()`8`8!}K48PX8`cK5``g;8(" c88D99)]PK`b@,@K' `" 88iDK+`" P8K`K'y`8`8!}K8PX8`cK``g;8( c88D99=P^PKU`b@,@K&]`8}D8K*`|P8xKY`K&`8`8!}K A'NiIAclCheckAddr__FP5NITABP11NI_NODEADDR|,#!qA$, @ch|`y@8PX8`cKQ``g;8( c88D99=^XK!`b@,@8K%)`8}D8K)`|X88K%`K%`8`8!}N c8!N 8PX8`cK``g;8(" c88D99)]XKa`b@,@xK$i`" 88iDK(`" X8K]`K$`8`8!}K88PX8`cK``g;8( c88D99=P^XKƱ`b@,@K#`8}D8K(I`|X8xK`K$-`8`8!}K ATNiIAclGetStatus__FP5NITAB|`,a|~!QA8bXT8`|0@8b8{$|p|xEx.|0Pc|c$pA |@,$@,%@8PX8`cKY``g;8(" c88D99)]`K)`b@,@@K"1`" 88iDK&`" `8 $K%`K"`8`8!}aN 8K|c8!}N ,%A8PX8`cKm``g;8( c88D99=d^`K=`b@,@TK!E`8}D8K%`|`8KA`K!`8`8!}N 8P8`XK``g;8(b c8p8D99;h\`KÉ`,b@A`,@K `8{D8K%`bX`8|ccK}`K `8`8!}aKX,A|{!QAd8bXT8`|8@L8b8{`$|p|xEx.|8Pc|c$pA |@,#@8PX8`cK ``g;8(" c88D99)P]pK`b@,@dK`" 88iDK!a`" p8xK`KA`8`a8!}N 8`8!}aN K-|ca8!}N 8P8`XK ``g;8( c8ap8D99<h]pK`,b@A`,@XK`8|D8K Y`bXp8|cfcK`K5`8`8!}aK,AKm`bXp8|8cK&1`K`8`8!}aK A NiAclDump|`,|~!aAX8bXT8`| @@8b8{$|p|xEx.| Pc|c$pA |AD8P8`XK U``g9B8(" c8p8D99)hJxK!`,b@A,@lK!`b 88cDK`bX8c 8|cxK `K`8`8!}N 8`8!}N ,AK`bX88 8|cxK$M`K`8`8!}KK|c8!}N A NiAclFlush|`,|~!aAX8bXT8`|(@@8b8{$|p|xEx.|(Pc|c$pA |A@8P8`XK Q``g9B8( c8"p8D99<hJK`,b@A,@hK`8|D8"K`bX88|ccK} `K`8`8!}N 8`8!}K,AK`bX88|8cK"M`K`8`8!}KK%|c8!}N ANiAclCheckAddr|`,a|~!QA\8bXT8`| @D8b8{$|p|xEx.| Pc|c$pA |@,#@8PX8`cKA``g;8( c838D99=P^K`b@,@\K`8}D83K`|8xK{`K`8`8!}N 8`8!}aN K|c8!}N 8P8`XKI``g;8(b c81p8D99;h\K`,b@A`,@XK`8{D81K`bX8|ccKz `K`8`8!}aK,AK`bX8|8cK}`K5`8`8!}aK ANiAclGetStatus`b@|!,A8`x8!N K ` 8>8~DK`bX88,8cK1`Ki`8`8!}N A?appendRule__9NIACLIMPLF11NI_ACL_STATP11NI_NODEADDRT2UiT4@AF25_3 A( L| N  A( L| N  A( L| N  A( L| N 8`N @ NiRiCloseb@,A 8`N HH @NiIRiCliGetHdl__Fv8P8`|Xc!qK5``g;" c8(88x99)]K`b@,A8`8!}HPK`" 88ixK`" 8K-`Ke`8`8!}N ANiIRiCliAccept__Fi8P8`|`abX!acdK ``g; c8(88x99<]K`b@,A 8`88!}HPK`8|x8KU`{8K`K9`88`8!}aN A-NiIRiCliConnect__FPC11NI_NODEADDRUsiP5NITABPi8P8`|Xc!qK``g;" c8(88x99)]K`b@,A8`8!}HPKy`" 88ixK`" 8K`K`8`8!}N ANiIRiSrvPeek__FP5NITABi8P8`|X!qcK``g; c8(8.8x99=^ Ka`b@,A8`8!}HHK U`8}x8/K`| 8K`K `8`8!}N A*NiIRiSrvAccept__FP5NITABiPP4FILEUiPP5NITAB8P8`|Xc!qKU``g;" c8(8;8x99)](K%`b@,A8`8!}HPK `" 8<8ixK`" (8KM`K `8`8!}N ANiIRiSrvCloseHandle__FP5NITABT>@,A 8`N HD @ %NiIRiSrvProcEvent__FP10NISEL_IMPLiPCv|!K ` 8J8xK`bX88c0KA`K y`8`8!}N Ah+NiIRiSrvProcEvent__FP10NISEL_IMPLiPCv@AF9_8|!K Q` 88xK`bX88cK`K `8`8!}N AhNiIRiCliGetHdl__Fv@AF10_2|`8Ȩ;8`8!KpA(c8!}N A\__ct__8NIHSIMPLFv`8bȨ|x!8@cx8!N cKA(c8!}N A\__dt__8NIHSIMPLFv8`N @ setTimeFunc__8NIHSIMPLFPvcN @getTimeFunc__8NIHSIMPLFvcN @getLastFlushTime__8NIHSIMPLFv8`N @ setTraceLimit__8NIHSIMPLFUicN @getTraceLimit__8NIHSIMPLFvcN @getIndexSize__8NIHSIMPLFv|c!A(|`yA<c| CN!A(<b8M|cTcѾ8!p}N 8`KmA(T`QTd*|PTcx|T>K A|iClock__8NIHSIMPLFv| @<|e P|PA|(PT>N T>N @(iClockDiff__8NIHSIMPLFUiT1|`!K 88c8 (8!}N AH__ct__7NIHIMPLFv|``8888!K{@c8!}H cKA(c8!}N Ax__dt__7NIHIMPLFv<8Q|@@ 8`N T>T>HI @$ setHostBufTimeout__7NIHIMPLFUiT1T>T9A 8`N `HGh @!getHostBufTimeout__7NIHIMPLFPUiUi|`!K-8`8c8 (8!}N AH__ct__7NISIMPLFv|``8`888!K1{@c8!}H cKA(c8!}N Ax__dt__7NISIMPLFv``@d|aA!Tv>!1|(@t|#yA , A;bXB ;  :```!|@H;98T>xH|*, @bK`Te>8apb 8 lKMA(|AK` bX8 H8pcKS`8K)`|ADKu`cbXc,%A\8 TKS`8K`8`8!}!AaN 88 TKSQ`8K`8`8!}KK`8 (c{|*KS`K5`8;9T>xH|*, AK\bK%`Te>8apb 8 lKA(|@8`8!}K|AK` bX 8 8cKRY`8K`KxK` bXc,%@< `88 K `8K9`|#yAdKD 8 K Y`8K `K A DtraceServ__7NISIMPLFP7serventi```aA`a!Ty>a8;|T>T>aAT>T>!8U>!~U1>,#A(8@~,#@ KM`:Bb@cT,Al@88`PKA(,#a@~,#A08`@KA(,#a@~8PX8`cK``g^ 8( c8A8h99=K`b@,@8K`8}h8BK=`| 8Kei`K!`8``8!P}!Aa!AaN 8HE!`8, A,7A<`8Q|@@<`8Q:Q,6A |@@`,5A |@@`,4A |@@`,3A |@@`,1A |@@` 8 KQA(,#@ ~c$bbb8h| HN!A(,A|}~|`yA,88f| FN!A(8~|`yA,88f| FN!A(8c`8!P}K0~c$bbfb'8h| HN!A(|},@88aK-q`,@`8!P8`}K 9@x88p8899 A9@9haxKQ``~|`yA,88f| FN!A(8~|`yA,88f| FN!A(8`8!P}KKRqA(,@b@,@@K9` 8bX8 ( cK`8K`; K8PX8`cK``g p;|@c`^ c8(p8h8899<DK}`b@,@K`8|h89K`pA;| 8tcfKa-`K`K8Kx8H)`8aKK`bX  8cK`K`K@L8`@KQA(,#a@~,#AK8H-`8aKK`bX  8cKY`K`K8PX8`K5``g^ 8(" c8'8h99)K `8`!`8!P}a!AaN (ALNiIHSBufInit__FUiN61;|!Q, @, @~8aK)`,@8`8!}N b 89>(88!p899 9@8 hxK]`88!|c}N 8PX8`K``g^(8(" c88h99)Ku`8`8!}N A0"NiIHSBufInit2__FP7NIHIMPLP7NISIMPL8b!|A(c|`yA88f| FN!A(8bc|`yA,88f| FN!A(8`88!p}ddN 8bc|`yAK ANiIHSBufRelease__Fv```|T>8b@8|a`c!, A(A,<A4|8( A c8:KOA(,#@8bgccccc#)@ i| IN!A(,@,@, @(A,@, @(@@,@,8`8!}aN c88.8K`,AK`8 c8~8 0K`KI`K8bP88(8O9b" 9c8h9) c 0pKE`8`8!}aK<8bP88(8F9b" 9c8h9) c 0pK`8`8!}aK|c8!}aKccK`,@,@, @(@,@, @(@8.;c88K%`8PX8`K ``g9B8( c8p8h99< J0K`b@,@@K`8|h8Kq`~88 ,80K`KM`8`8!}aKK0`p`@T,#@(A<;8.c88K%`8PX8`K ``g9B8( c8p8h99< TJ0K`b@,@@K`8|h8Kq`~88 80K`KM`8`8!}aK;8.c88KY`8PX8`KA``g9B8(" c8p8h99) J0K `b@,@tK`" 88ihK`8" 8~8 0KA`Ky`8`8!}aK,K9`KcK`,@, @(@8, @@,@, @(Ah,A(c88.8K`,AK!`8 8~8 0K`K`Kc88.8K`,@DK` 88|hKU`~88 h80KS`K1`b cK$c88.8KA`,@DKM` 88|hK`~88 <80KS=`K`b cK8, Kt@Kt8`d88X8X89X9 XK,A@,@HaK` 88hK1`~88 H0K`K `8`8!}aKD A,NiIGetNodeAddr__FPCciP11NI_NODEADDRUiPP4FILE`;`|;|aA!`aT>T>T>!, A(A<,<A, @(@ , A, @c88.8K`8a8.Ka`|9@@A 8P8`XK`a88a8.K%`|`c x{8(ap8h899? cK`,@\K`8h8K%`88a8.K`8 c|hcgc8K`K`8`08! }!AaN cc$8K`,@8`08! }KK`z,7 9A9@88 8cK`K9`8`08! }KT}ccc&bccICJH j| JN!A(,@X@,AHc88.8K`,A$K`z,7 9A!A, A(Ac8( @8xc8 HA(x, @,Ac|ATc>Kp)`T`>@|},Ad`KpE`Te>8ap 8 lKA(,A4KY`~88 c8p@K`K`8`8!}aN 8bcccfcc@h| HN!A(,@H@,A|Kom`Te>8ap 8 lKA(,A\K(|c8!}aKT8`d88X8X89X9 XK,A@,@laK` 88hK`~88 H@KM`K`8`8!}aK8`8!}aK8( @K ANiIGetServNo__FPCcPUsUiPP4FILE|``aATz>T>8;T>!AA(~|`yA(#cDcccgc)H i| IN!A(,@@,A4cCKm]`Te>8apb 8 lKA(,@08`8!}AaN KE`}H8 p8pcK `K`K|~cCKl`Te>c 8 lKuA(c8!}AaK|8`d88X8X89X9 XK,A@,@haK` 8'8hK`}H8 HK`K`8`8!}AaK8`8!}AaK~K A@ NiIGetServName__FUsPcUiT3PP4FILET~>8b|c!|`yA(A8, Axce| EN!A(`8bcce| EN!A(|`88!|}N 8PX8`cK``g9B8(" c8F8h99)pJPK`b@,@`K`" 8G8ihKA`8" 8PK`K`8`8!}N 8`8!}N ANiISetHSBufIndexSize__FUi;|!,#@|b@,@\K` 8V8~hKY`bXX8cK`K9`8`8!}N 8`x8!N , @b@,@K|x8!K< ANiIGetHSBufIndexSize__FvT>;|T`>!q,#@8PX8`cKϙ``g_`8( c8e8h99=pKm`b@,@\Ku`8}h8fK`|`8K`K`8`8!}N 8`8!}K`Ku|c8!}N A(NiISetHBufTimeout__FUiT1|T>;!aax,#@8PX8`cK9``g_h8( c8u8h99=pK `b@,@\K`8}h8vK`|h8KQ`K݉`8`8!}N 8`8!}KxKu|c8!}N A(NiIGetHBufTimeout__FPUiUi9T>T>|}Cy!A(AD,@aXh| HN!A(|c8!}N 8PX8`cK̝``g9B8(" c88h99)pJpK~m`b@,A 8!8`}N KY`" 88ihK`8" 8pK`K`8`8!}N 8`8!N APNiISetHBufEntry__FiPCcT2UiT4|`;!aA(ax|,#AHcPxf| FN!A(|c8!}N 8PX8`K``g\x8( c88h99=pK|`b@,@\K`8}h8Ka`x8K `KE`8`8!}N 8`8!}K ALNiISetHostInvalid__FPCcPP4FILETd>8b|c,#!@8P8`XcK``g9B8(" c88h99)pJK{`b@,@`K؝`" 88ihK)`8" 8K`K`8`8!}N 8`8!}N KХ|c8!}N ANiISetHSBufTraceLimit__FUi;|!,#@|b@,@\K׍` 88~hK`bX8cK`K`8`8!}N 8`x8!N x8!K ANiIGetHSBufTraceLimit__Fv|!qA(ax8bc|`yA8, @8PX8`cKq``g9B8(" c88h99)pJKyA`b@,@`KI`" 88ihK`8" 8Ky`Kֱ`8`8!}N 8`8!}N xe| EN!A(`8bxce| EN!A(|`88!|}N ANiISetHSBufTimeFunc__FPv;|!,#@|b@,@\K` 88~hKy`bX8cK!`KY`8`8!}N 8`x8!N , @b@,@K|x8!K\ ANiIGetHSBufTimeFunc__Fv8b|c|`y!A(A8, Ad| DN!A(`~8bcd| DN!A(`HA(,@ 8!}N 8!}N 8PX8`cK``g9B8(" c88h99)pJKu`b@,@`K`" 88ihKׁ`8" 8K%`K]`8`8!}N 8`8!}N ANiIHSBufFlush__Fv|``aA|{y!!A;A(AT,$A,%A,A<8, At, AhD K`T`>;<, A;<~ d| DN!A(,@cccDc%K\`|@`8|PT>:p``!~8t8t8p80h| HN!A(,@d8atK(eA(`z|@cd|yc8tc&K`ZPpW[>, Ax~(d| DN!A(,@$~ d| DN!A(,@,q@0ccd88qKU`8z8T{>;q:p`!~8t8t8p80h| HN!A(,@ 8atK'EA(`z|@cd|yc8tc&K`ZPpW[>, Ax~(d| DN!A(,A<|c8!}!AaN 8`8xd 8`||"K~(d| DN!A(88`x ||Kd|b@,@DKΡ`8|h8K1`bXg8LccK`K `~(d| DN!A(c8!}!AK~(d| DN!A(88`x ||K~(d| DN!A(88`x ||K@|b@,@DK}`8|h8K `bXg8tccKҭ`K`~(d| DN!A(c8!}!AK~(d| DN!A(88!8`x }!a||AАN |c8!}!AaN 8PX8`cK%``g^8( c8U8h99=pKn`b@,@8K`8}h8VKБ`|8K=`Ku`8`8!}aN 8PX8`cKq``g^8( c8P8h99=KnE`b@,@8KM`8}h8PK`|8K0I`K`8`8!}aN 8PX8`cK``g^8( c8O8h99=HKm`b@,@Kʙ`8}h8OK)`|8pK/`K `8`8!}aKL8PX8`cK``g^8( c8N8h99=Kl`b@,@K`8}h8NK΅`|8K.`Ki`8`8!}aK8PX8`cKu``g^8( c8M8h99=KlI`b@,@ccK/YA(,#A`|8bc d| DN!A(,@P8;Bc```!bcez880h| HN!A(,@4bKYA(|`#Pa~W;>,#A8bc(d| DN!A(,@cdb b8KQ`|`zA8PX>8`cK1``g9B8(c8h8<99;JKi`b@,@DK `8{h8=Kʝ`88cFcK=`Ku`cK-A(8`8!}!AaN `x88bȘc d| DN!A(,@H|xPWTy>, @x;```!cDc%x880h| HN!A(,@,cCKYA(|`|Pa@T>,#A8bc(d| DN!A(,@8aHF`,A@a,@DKe`8{h8hK`bX88cKɕ`K`cK,!A(a8!}!AaN cCc$8KN`|AP8PXa8`cK``g9B8(c8h899;JKei`b@,@Kq`8{h8K`~88cKǡ`K`Kd|P8`|P8!8}KX|cK)A(c8!}!AaN |b@,@HK`8{h8RK9`bX8'8LccK`K `8bc(d| DN!A(cK)9A(c8!}!AaN |cK(A(c8!}!AaN |b@,@LK` 8&8~hK-`bX8g8tccK`K`8bc(d| DN!A(cK(-A(c8!}!AaN |cK'A(c8!}aN 8PX8`cK``g9Bb c8(p8h899;JKbM`b@,@DKU`8{h8K`88cK'`K`8`8!}aN 8PX8`cK``g9B8( c88h99=JKa`b@,@|@A(@|8bP88(9bˈ" 089A89)c pKN`8`8!}a!AaN |a8K`,@H@,@X|8`(KA(|7@P,@ :`KKA`8ˈ 0|8K`K`:`K~0||, AT8!8`"}a!AaN 8bP88(89bˈ" 09A89)c pKMM`8`8!}a!AaN K`8ˈ 0|8K`K`0Kx8bP88(89bˈ" 09A89)c pKL`8`8!}!AaN C +getServNo__14NISIMPL_LINEARFPCcPUsUiPP4FILE|}&aA`T>N!aN1T>`;`c!K2y`Te>8a 08K!A()Ah,'AT8`0|8"`!x{ {`6d{f&}P|@, A$, A|B.| A48cC `(A_"@,:AcKY`88 cacH<=`-|`4cT~K%``ecK`|@@0,@`wK` 8,88p}A8d8ˈ~8TI89U|ApKI`8K`,@t@@MЀBA, A@A08x6dx&| P8c"#.80x6dx&|P@X8`8|)80x6dx&|(PKA((|(88c8|@AX, A<8`8````!088c|!80|@A88,@AL8`@:8!0|} !AaN 8a8 KV9`|<@A8PX8`K`a;ˈ8a8 ~KU`|`cx8(p88995cjKHe`,@\Kq` 88a8 KU`|g8!qA(K,Ax@ax,@LKa` 088K`bX8ˈ8xcK`K`ax8!}N cc$(8h| HN!A(,A@|,@dK` 08%8~K=`bX8ˈ88ccK`K`c8!}N c8!}N 8`8!}N A!setIndexSize__14NISIMPL_LINEARFUi|`!, @8b@8,A\K`bX8ˈ 08c Ki`K!`8`KA(8!}8`N 8`KA(8!}8`N 88`8```!08c|!80|(@Ab@8,AK8 Aflush__14NISIMPL_LINEARFv8<8`N @ lockLineDump__14NISIMPL_LINEARFv8`N @"unlockLineDump__14NISIMPL_LINEARFv|``aA`;`!`T>!1`d, Àc<,#A|@@0x`6dxe&|P|(, @D```!8<T>| @@x0x6x'|0P|(, A@Xx`6dxc&|cP||, A e"K$`Te>8a 08K각A(0Y(K=`b@,@HK`B 8|8(ccg>K`8K`8`8!}!AaN <8`8!8A80888(}((q'A}H0*|*@|)0|(,'@x6dx&|HP| @{6d{&}+PP}(H,)A@80}(8q)A(}H0*|*@{6d{&}*HP|I0K{6d{&},XP}H:}hJ}H*kK k(}9*jJ j(0|I0880T>80|@A 8x`6dxd&|P| , @,#A 888`8!}AaN @c}dP9 }i``!}PP;W>{6{'}`P}خ,,@ 9)C }+PPU>>| @@80|@@,K0,)ATK08x`6dxe&|P|(, @(K AX cacheCleanup__14NISIMPL_LINEARFv``|aA`T>!T>aA!xpb !!8(cK `,@; b:>``!5bKA(|zyAbcCH`!a8iE8AK:A(,A Ȁ|A`;9@cCK}A(K8(z'7W#>K1A(,#A `y,@cW,8 h@L8`:µPxu$@:bB @````!b8w(#@8`~"|(AP p|(@8T@0|||7 @A8aKa`cCKA(b@,@lc#KyA(8`8!}px!Aa!AaN K`B ;X8 @8wK`:Ku`(|@@{,@, A0,<A(:,>@;````!z 8ax&|T>|*KM`|*, @|.(@:|88.8K`,@ :|@@|0@@KK`w,484~A8688996K`Ke`K:Kp:```!z 8azr&|T>|*KM `|*, @|.(@: |88.8K5`,@ :|@@|0@@KK%`w|, @@96,184~A86889K`Ky`K96K: K\K`w~8K`K9`K98cKYA(|py@X8`KE``gSap8(88992K3`,@@K%`8r8K`bX8@ K}|@A8c}Kb$x`&8|cT`>|yK`8,>x&|8T>|}xc&||*}A}}Kq ax"|@@D, AHK4bb$aKI`a=(b8iK4A(,AbTKA(K8ab$8K`88a8KI`,@9bK]A(KpKQ`X{88a0KK-``h8\aa80K`K`9bKA(K~"K,>A:µP@:b HB @`!b8w(#@8`~"|(A8 p|(@8T@|||7 @@K98cK1A(|py@pX8`K~``gTap8(88992K/`,@@K`8r8K`bX8@ K }|@A8c}Kb$x`&8|cT`>|yKi`8,>x&|8T>|}xc&||*}A}}Kq aKLbb$aK=`a=(b8iK1A(,AbTKA(K8ab$8K`88a8KF`,@9bKQA(KKE`X{88a8KH!``h8\aa88K`K`9bKA(K$~"K4:µP@:b HB @````!b8w(#@8`~"|(A8 p|(@8T@|||7 @@K98cK!A(|py@pX8`K{ ``gTap8(88992K,`,@@K`8r8K}`bX8@ K }|@A8c}Kb$x`&8|cT`>|yKY`8,>x&|8T>|}xc&||*}A}}Kq aKLbb$aK-`a=(b8iK.A(,AbTKA(K8ab$8K`88a8KC`,@9bKAA(KK5`X{88a@KE``h8\aa8@K`K`9bKA(K$~"K48aK`cCKA(8PX8`cKxy``g;<b @c8(p8899;]K*A`b@,@$x&|Pxd|@b @;B88`X ; x::`p| |.t|*:````!t:t(@d@,@|@@@{ >${$&{%d|Pxf$|*xg|g0P|*|68|.~8T>;9|9@A8` 8!}a!AaN K`x888xt7Wwpax K9`8b K`~KcK1A(8PX8`cKp``g;8( @c8899=<^K"`b@,@K`8}8K]`|8TK`KA`8` 8!}aK A &NiPGetMacAddrList__FP10NI_MACADDRUiPUi||!qHUA(,A8bPb8(8I99B89 @8c 9JapxK7`b@,@XK~`88LKQ`bX9B8cKu`K-`8`8!}N 8`8!}N 8`8!}N ANiPMyHostName__FPcUi|`!KmA(8`8!}N A8NiPGetPid__FPUiT>`|aA,+`!aa\a;8!x8aT>@L8,#@088`((@88a8@K`88a88H5A(,@;@"@,@`,=Aa,&@08,A, Apb Hc````!,@ {F&|2|1* 8(T>,A8|(@A^Apc@````!;Z(y@|@@DaH]A(^8``8!P}!AaN aHA(8``8!P}!AaKĐK,@${E& |*|)*K 8PX8`Kl``g;8(b @c8p899;8^K`,@|``8e(@`,AX8bP88(89 pAaxB @c89JK25`8`8!}N 8bP88(9`89 AApB @axc89JK1`8`8!}N A NiPGetAddrInfoError__FPCcT1iT1Uc```@|aA!aA!xp!Q|0@d,?Ab @8" ;@;`:`9`!,A,@ 8a88.8K}e`|@,,&@Ȁ|,Ax,A4,A@p(;Zy@p8`8!}px!Aa!AaN Kv`|8 K`KwM`|A`Kv`8| | K`Kw`KAKvQ`|8Kȝ`Kv`|AKAKv`|8Ka`Kv`|AKHAKu`|8K%`KvY`|@Kh8a8@8pK`|A(Ku`|88K`Ku`|KKuI`8aK`Tu>bK`Th>Eb88bK`Ku`K8a8KeA(:K\ax98ax88.8| Kzy`KKt`b b @8l|KM`8Kt`Kh A,NiPTraceAddressInfo__FPC8addrinfoPCcPP4FILEi``|aA`T> @W>!8axx@, A8 p,<;@y@t88@899 H A(,A|``8e(@`,AX8bP88(89 pAaxB @c89JK%`8`8!}N 8bP88(9`89 AApB @axc89JK%9`8`8!}N A NiPGetServInfoError__FPCcT1iT1Uc|T>` @ h`;aT>8!8'89 a8a8!9 HA(,@Pa8( @<88a8 HA(, @,Ac|@8aKaA(@|#@A,@Kj`b @88cKoU`8aKA(|f @8c8 KΥ`Kk`8`08! }aN 8`08! }aK8a8Kvy`,A4cK`Te>8a @8KiA(,@8`08! }K`Ki` 88b8 @8P0}Ktq`8Kj!`8`08! }K8ax @8K~A(8b8Ƞ88x @8c0TK1|c08! }aKa8ap @8K~=A(8b8Ƞ8p @8c0TK|c08! }aK AX NiPGetServByPort__FUsPcUiPP4FILE PA( L| N  XA( L| N  `A( L| N  hA( L| N  pA( L| N  xA( L| N |`!KaM`8X8c808@L8!}N AT__ct__15NIHIMPL_LINEAR6Fv|`8!a, @0, @ $8(,@L@tb@,@8!8`}N Ke`bX8 8|cKp`KfU`8`8!}Kx>Hx.|cPK IA(|fyA8( @,89`!8h`9`H8|'@A88`K A(|gy@h08, At,'Alb@,@$cH8`8!}N Kd`bX8 8cKo`KeY`K8PX8`cKUy``g;Ȁ8(c 8Zx>$x.|(P8|\9p9=K1`b@,@PKd9`8}8[Kh`~8x>$x.|0P||K`Kd`8`8!}N H8g0H8g`H8gH8gH8gH8g H8gPH8gH8gH8gH8gH8g@H8gpH8gHy8gHq8gHi8g0Ha8g`HY8gHQK8PX8`cKS``g;8( c88899=H^K`b@,@8Kb`8}89Kg]`|8`Kh `KcA`8`8!}K Ainit__15NIHIMPL_LINEAR6FUiN318 HPXN @$$__ct__Q2_15NIHIMPL_LINEAR67HOSTBUFFv8 8 (N @8$__ct__Q2_15NIHIMPL_LINEAR67PREFPOLFv|`b 8c!qKA(|}yAcKA((#Ab@,@Ka `b 8R8cKe`X8cpKQA(|g ccc89K`KaM`8`8!}N 8`8!}N 8ax8c8K2U`8ax 8p8K<`|dyApcH88` 8p8K<`,#AH `d```!L(@T>T>;@; ;X````!8|,7@8@T>;`;9`|@@b@,A4KX`8 xt8(Kb`KXy`8`8!}!AaN {@>$r {E.~PA|*| A~ @|*| AAr A ~ax8K`,A$8;`@T>;9`|@AKb@,@D,7@8`8!}K(H8`8!P}KKV`t8|H, A 80|, A, @X 9X8 x8(KaI`KW`8~|, @d8`8!}Kt, A,  9xA9K 9hK 8x9L8(K``KV`8~|, @KP(@ 8(K|*| @8|ɮKhr A`K@ A xAcacheLookupNameToAddr__15NIHIMPL_LINEAR6FPCcP11NI_NODEADDRPP4FILE|}&aA``!``T>;@aA!#!,9A KM`a;0888899 @caK``wTv>cKM``ecKNM`|@@@,@t`uKT)` 8,b 88|A 8D8~B )89JApK^`8KTe`b ,6c}@d, AXa}L, A4"@,@, A: ,;A`8.,@x,#@؀x(@z7&L,#Ap::::`:@(`!0b||K`p`A0|.|A@8:R0LT>:s0:0|@A8q;Tq>|@AT,@,@@KR` 88KW`|888Ky`KR`,;Ab c}, AP,@8`88| ``!x 8y&|8*,&@|8.(A8C b@,@\8`pj|8!`} !Aa!AaN KQm`|, 8(A8088\K\`KQ`Khy&j|p|KP,@(8`88| ``!x 8y&|8*,&@|8.(@8C K8`pj8!`|} K|az6dz&|Pc}08c(C .K@z7&x,#@,x(AK`>L,#At;z7&::::`(`!0b||K`p`A0|.|A@8:s0LT>:0:0|@A8q;Tq>|@@Kp|a{6d{&|Pc}08c(C .KKOq`8 |8KZ5`KO`K,@Xb@,@ KKO!`8 80|8KY`KO`KTb@,AKN`8 |8KY`KOM`K;0`888899 @cK`Tv>K C?osLookupNameToAddr__15NIHIMPL_LINEAR6FPCcP11NI_NODEADDRiPP4FILE|``aA`T>!8`!AxKA(8(T>; Ad(A\b@,@LKM`B 8.8zKR`bX88cxc8KR`KM`cH8, A88X| ````!x y>$y.}'0P|H,&A|H*|&@ aT>8C { >${$.xP8@8}|gHP8|`8cK `88`KA(~X@|@@8?@8`8!}!AaN 8`8!}!AaKa{ >${$.xP8@8}|gHP8|`8cK`88`KA(~X@|@A@8`8!}Kp Ah;cacheAddName__15NIHIMPL_LINEAR6FPCcPC11NI_NODEADDRUiPP4FILE|}&aA`a!`}a<T>`88!88.KP`(A, A , @N]"@,:AcKC`888@aacKi``xTw>cKC``ecKDA`|@@x,@p`uKJ` 8,B 88|A8D8~8I89JApKT`8KJa`,7@,,@(A, A , @@P8`8!|} !AaN 8a8@Km`|;@A8PX8`K9`a;8a8@}K1`|`c x8(p88;99>|cjK`,@\KH`b 88a8@K`|g8cccKSA`8KH`8`8!|} Kacd8K!`8`8!|} K8a8@K5`(#@@d@c88cHMKHKG`8 8|8KR`KH9`(AK,AP,@HKGu`B 88zKL`|88LbKL`KG`NB,AKG%`8 8|8tKQ`KG`KPa888@cK`Tw>|vKc88@cHQ,At,@8bP88(9b" 899A89)c pKE`8`8!}aN 8a8@Km`|;@A8PX8`K6`a;8a8@}K1`B |`xcpcj88(9:|89K`b@,@XKE` 88a8@K`|g8cccKP=`8KE`8`8!|} Kacd8K`8`8!}aN c88cHYK C p=getHostName__15NIHIMPL_LINEAR6FPC11NI_NODEADDRPcUiUcT3PP4FILE|``aA`8`!T>!KMA(`|(8`K9A(`z?$8`K%A(`x 8pc8.8KI`|P|P8`|PT>T>T>88X````!8|",'@8T>@8`8`|8@@b@,@@8`8!}!AaN KC`8 8p}88 KM`KC`8`8!}!Kxj>$p xl.PPA}F(*|*HA| @}F(*|*AApAt|^'H| @(^gL| X@gP^| XA~L^~GPT}kbx}Jx> }J[xlx}Kcx':x}j;yA$88`@T>8`|8@AKdb@,@X@8`8!}K|a8bK`8`8!}!K`KA`8 8p}8\ KLM`KB`8|| @Kp^^gLgPZx> T}JZxKSx}x}jcx':x}K;yA K}F(*|*@@8|!KpAKh A |CcacheLookupAddrToName__15NIHIMPL_LINEAR6FPC11NI_NODEADDRPcUiPP4FILE|``aA`T>!8`!KyA(8(T>; A (@cHy8, A88X| ``!x y>$y.}'0P|H,&A|H*|&@ aT>8C { >${$.P8@8}|gHP8|`8cK}`88`KA(~X@|@@8?@8`8!}!AaN 8`8!}!AaKa{ >${$.P8@8}|gHP8|`8cK`88`KA(~X@|@A@8`8!}Kp8pc8.8KDI`b@,@8K>Q`B 88zKB`bX88 cc0KC}`K>`K Ax>cacheAddAddress__15NIHIMPL_LINEAR6FPC11NI_NODEADDRPCcUiPP4FILE|`8`aA!!Q@KA(`}(8`KA(`{_$8`K}A(,>AX|P 8T>|PT>|fPTh>9 8`89@|2q AX|=@A(} @gX|+A@X|'(@}$18|2,'@xg>$xl.}l8P|@{>${.|`P|8,'A @@8{>${.| P|:8s AdX|;@A( @X|=A@X|=(@},98K}lZ}I``!d8 k9k C 8}$9888`T>|@AĀ@x`>$xe.|P|(, @,#A 8@8`8!}!AaN @cP8`!`P;^W^>{\>H{[.;PȮ,<@ 8C |`PT>|@@@K|@@4K88`T>|@@0K,,A$xe.|P|(, @,K A!cacheCleanup__15NIHIMPL_LINEAR6Fv|`T>!qA(KA,Ax@ax,@LK:A` 8]8K>`bX88xc@K?m`K:`ax8!}N cc$(8h| HN!A(,A@|,@dK9` 8f8~K>`bX88cc@K>`K9`c8!}N c8!}N 8`8!}N A"setIndexSize__15NIHIMPL_LINEAR6FUi`|#y|}&aA!``T>T>aA!8!8@N,<@-;A(A(A(A(A( Ab@,@HK7` 88K<`bX88cfcHK`K8]`8`@:8!0|} AaN ; ,8A,>A@:ptcaxA|``!{ >${#.`|P:`,$A~0*8cKy`,A8qHLPT~x~"x|g#x~e*x|+x~D2x|e#yAlT>|@A8`@:|8!0} !Aa!AaN b@,@|@@{ >${#.@#PXX,@l@ paxHxP,@,>@A@ɮ,A0K5` 8bX{H89Xcf 8ĐcH|8*K@`8K6I`8`@:8!0|} K8x8@cKy`,A`K5e` 8bXc8 8cHK@`8K5`ATKK5`B 8bXc8 8cHK?`8K5u`KK4`B 8X8`8ȐHXKA(`gb bb8dK?]`8K5 `@TK4K4]`bX8c 8@cHK?`K4`|@@XKb@,AK4 `bX8c 8cHK>`K4}`|@@Kt:c```!{ >${#.`|P:`,$A<|*8cK`,Ad8T>|@A8`@:|K@8pptcx|``!{$>${).C`}i P8c`,*A|Z99DHdLPT| Rx|Zx}W[x|bx~cx}"x}K#yAtU9>| @AK8` `!xy { >${$.|P|(, AL8cC |@@cKA;; ;````!_8{>${.|P|خ, @;{`8T>|@A@@8`8!|} !AaN 8bP88(89b" 9A89)c PpK9`8`8!|} K|"a8K`,@$b@,@0NB8|ٮ@8;{`T>|@A@TKK.`yc8PK9`K/Y`88NB|ٮ@K@Kb@,@K.` 88K3 `8aPKA(|gc8hc9@KU`K.`8`!8!}N 8`!8!}N C,setHostInvalid__15NIHIMPL_LINEAR6FPCcPP4FILE|`!, A088`8`!88c|!8`|(@A88`@KA(b@,@8!8`}N K-`bX8 8TcXK7`K-`8`8!}N Aflush__15NIHIMPL_LINEAR6Fv8D8`N @!lockLineDump__15NIHIMPL_LINEAR6Fv8`N @#unlockLineDump__15NIHIMPL_LINEAR6Fv|`;aA``!`T>`8!, A8cD,#Ah|@@$x`>$xc.|P|x"| , A:, AH, @P(@:8͠:8a8.K`Db8.8x>$x.}P|B8gHK0`Dx`>$xe.|P| ,%A|"8pA9@R,,A@Xp " 8A8|fb ccD8aHb` pK]`|A8PX||8`ceK``g;B8(cc88999Z`K`b@,@HK)`b 8}80`ccFK4`8K*1`8`8!p}!AaN D8`8!p8D}K8`8!p}K p " 9A9|fcpxb cD8` K`Kpp9@ A9@AK8PK::8͠8a8.Ki`K|:P8a8.:KI`:8a8.K1`Kp88!p8`}!AaN cKEDK A (dumpBufLine__15NIHIMPL_LINEAR6FPcUiPUcT2|``!K~A((#7@b@,@dK'=` 88K+`X8ahK~A(|g8cc97K `K'`8` 8!}N 8a8787K`8x8a 8K5`|}y8pAx, Ac8p88K:`,@xc88K`,#A\a,#APK~AA(`~axK~1A(,A0,A(,A ,AL0,|@8|x6dx&|0P|0.|@```!x6dx&x6dx&|0P}'P|2}J|,}$H*Hh (}$1*Gg (0@(x6dx&8|8P|9|0.|Ax6dx&|(P8(!.0|d1.08`|*0|* L8LK A$addPolicyRule__15NIHIMPL_LINEAR6FPCc|`!K`8ͨ8c8088!}N AL__ct__14NIHIMPL_LINEARFv|`a0!Q, @P8 $(,8@lb@,ALK#`bX8 88cK.a`K$`8`8!}N 8`8!N x6x'|`KA(|fyA( @088``!8gP8PH8|%@A0b@,AtK"`bX8 8cK-`K#U`8`8!}K<8P8`X@0cKY``g;b8(c 8Sx6dx&|8|[9p9<PK`,@xK"`8|8TK&`}8px6dx&|:||K`K"y`8`8!}aN 8`8!}aK8PX8`cKQ``g;8( c84899=^K!`b@,@\K!)`8}85K%`|8K&e`K!`8`8!}N 8`8!}N ATinit__14NIHIMPL_LINEARFUiN3188DHN @#__ct__Q2_14NIHIMPL_LINEAR7HOSTBUFFv|`8ͨ`8!Hc88K`{@c8!}H cK A(c8!}N A__dt__14NIHIMPL_LINEARFv|`8!c0,#@08`x8!N KA(88!8`}0N Addeallocate__14NIHIMPL_LINEARFv``|}&aA!`a`aA!xp!q, A @;@(@; ;:::b@,4A|cK1`8:@0`oc888A899 @cK``qTp>cK``ecaK`|@~/@,@x`nKi` 8,b 8|A 88}B c~89J\ApK'`8 K`,0@Ԁ, A,@,@|Aa},@ (A,:@, A ,#A.7@8|@A0@h88c8|@AP, A48````!08;9|8cP|@A88,@x~xxT|||8!} px!Aa!AaN K`8 |8K&]`K`~xxT|||K`0{6d{&8@c*c|`8cK)`,60@,8|ٮ08`K9A(~H@K8c8|ٮKt=`,@0|خ`|ٮ08aK`DKK`8 c|8 K%U`K `(ATKKY`8 80|8K%`K`KT,A@,AP,@HK` 88vK`|88|oKDcKpA((#@A|;@b@,@`K`" 88yK`8cKp]A(|gb8|@A(@$8bP88(9b" 89c89)lc pK`8`8!}px!Aa!AaN c}z8Kp`,@4@,@,0@ $H8`~"K~}A(|4@P,@ :KK!`8 c|8K!`K`:K8bP88(89b" 9c89)c pK`8`8!}px!Aa!AaN 8a|zDxK `8` 0|zH~K}EA(|4A8!8`}px!Aa!AaN K`8 c|8K a`K`0}z~xK8bP88(89b" 9c89)c pK `8`8!}!AaN 8bP88(89B" 989)cJK`8`8!}aN C 9getNodeAddr__14NIHIMPL_LINEARFPCcP11NI_NODEADDRUiiPP4FILE|}&aA``!a=T>a;@; ;aA:`!8!a88.Ku`, @(@(A,#At , Ah0``8``!{F6d{G&䈤P~:8P,%A0pA| D|*yA\8T>|@A(A8@,5AcK `888@accK``tTs>cK ``ecK `|@~@x,@p`qKi` 8,B 8}A88~(84~89J\ApK`8K`,3@H,@(A, A , @,8@`8a8@K`|<@A48PX8`K`a;8a8@~K`|`c x8(p88$99?cjK)`,@\K5`b 88a8@KQ`|g8cccK`8K`8`|8!} !Aa!AaN ac8Ku`xxT|||K8a8@K`(#@@d.9@_8|@A@H88c8|@A0, A88`8```!088c|!8P|@A88,AK`8 }8Kq`K)`K0{F6d{G&8af:K]`,8D0@,8|ٮ08`KveA(~H@PK|c8@8c8K `08 |ٮKK`8 8}8`K`Ki`(AK,AP,@HK` 88xK1`}88bFK`K `;,:AdKQ`8 8}8K`K`K0c888@cK `Ts>|rK8`8!}!AaN b@,@|v|pHAp(8` "KtA(|9@b@,@ ; KdK Y`8 8}8\K`K `; K, 8` "KtMA(|9A8KduA(|<@A8PX8`K`a;b8[Kd=A(|`c x8(p8899>cJKi`b@,@K q`B 8{8KcA(|g8ccecK`8K `K@8ac|K `8`8!}!AaN K `8 8}8<K`K 9`0Kb@,@@K y` 8v8K`}88Kpm`K `8`8!}!AaN C !qA(KA,Ax@ax,@LK a` 8;8K`bX88xc K`K `ax8!}N cc$(8h| HN!A(,A@|,@dK ` 8D8~K=`bX88cc K`K `c8!}N c8!}N 8`8!}N A!setIndexSize__14NIHIMPL_LINEARFUi|#y`~|}&aA!``T>T>a8!@@,<@$8.;A(A(A(A(A( Ab@,@HK)` 88K `bX88cfc(Km`K`8`0*8! |} AaN - @x, @(Apb@,@K` 88K `bX88c(Klq`K`8`0*8! |} K\; ,8A,?A~0@8c:``!{ 6d{#&䈕P|:P,$A~*8cK`)`,A 8tD~yA`T>|@A8`0*|8! } a!AaN b@,@L|@@0{#6d{$&#",:AXH@,@A ,?@A\~0ɮ,AHK` 8bX{H89Xcf 8ؐc(|8*K`8K5`8`0*8! |} K08@c|`8cK]`,ATKI` 8bXc8 8c(K`8K`AdK08apx@K`pD,AK`B 8bXc8 8c(Ky`8K)`KK}`B 88`8X(0|HKkA(`gc bb8xK `8K`AK 8`Kk=A(xHKK`bX8c 8Hc(K`Ki`|@@Kb@,AhK`bX8c 8c(K]`K`|@@K,:c`!{ 6d{#&䈗P|:P,$A|*8cK\`,Al8T>|@A8`0*|Kl@d~08c8````!{&6d{'&P}&:8P,(A||J8D|2yAXT>|@AK8`0 `!xy { 6d{%&|*|0, A,8cC |@@cKcKYA((#@tb@,@HK)` 8l8K`bX88cc(Kg`K`8`0*8! |} K8axcK`,Atb@,@K` 8s8K-`bX88cc(Kf`K`8`0*8! |} Kx8KcKXA((#@Ab@,@4K` 8`8~K`X8c(KX]A(|g8A(;0c;\```!{6d{&P#";ZP, A0|a8KXY`,A8T>|@A8bP88(8 9b" 9A89)lc 0pK`8`8!}!AaN b@,@8|@A8x6x'|c|, A8||88x6x'|"|"| ``!``d%8 #8c C  (88` (088x6x'||!888K88`8!}|ᮀ888KKa`8 x80K!`K`08|@AK8bP88(8 9b" 9A89)lc 0pK`8`8!}N A+setHostInvalid__14NIHIMPL_LINEARFPCcPP4FILE|`!, @8b@8,A\K)`bX8 8(c8K`K`8`Kc-A(8!}8`N 8`KcA(8!}8`N 88`8```!08c|!8P|(@Ab@8,AK8 Aflush__14NIHIMPL_LINEARFv8<8`N @ lockLineDump__14NIHIMPL_LINEARFv8`N @"unlockLineDump__14NIHIMPL_LINEARFv|`;aA``!`T>`!, A c<,#AL|@@ 0x`6dxd&|"| , @@``!8<T>| @@0x6x'|| , A@x`6dxc&|`;||, At8aDxK `8a88.8KE`0K!`8K`8`P8!@}!AaN <8`P8!@8<}K8`P8!@}!AaK pf " 9A9pc9@ |A9@A9b͠ ccD8 `px laKa`Kd8PK8P8a8.K`K8P8!@8`}!AaN cHQAx|P 0T>|PT>|ePTk>98`8; |*&q( AFH|*XA(}  @H|(A@H|& @})0|*,&@xf6dxi&}J|@{6d{&|R|0,&A8@ē8?0{6d{&|R|20s AH||@A8x`6dxd&|"| , @,#A 888`8!}!AaN @c}CP8}I```!HP;~W~>{}6{|']Ю,=@ 8C |HPT>|@@8Kt|@@,Kh88PT>|@@(K,)AK08x`6dxe&|*|(, @$K A cacheCleanup__14NIHIMPL_LINEARFv A( L| N ,|L 8c8| ``!88cC N @8UcnToB7n8, A@8c, A,```!888c, @8N @XUcsToB7s``|a|3y!QA(@xb@,@~x,#@~pKY)A(;~|`ypAt, @x|%AXbf|x| 9A`8T88h| HN!A(~P|`yA, @8, A,@\~(,AL8,$A|0|$@Ap``!x@8ax8,$A@@ax8c@,#A88axH8|#yA0| @@~(,A\``!ax8,$A@@ax8c@,#A8@8ax8@Hq~(|`y@@{, AT,@LKi`8s8|PK`(88BchK`K`{,@P, @X, A8b8cX| @@|b8 8| jpx ```! |l)Ґd8C cKVA(8!}aN 8~XHUK8~PHIKXKa`(8"8@chK`K`K(K(KK`(P|#ycAh, A\8r88, hA$8w8K`Ka`KL8-8K`KA`K,8-Kc8p8Tf| FN!A(,@\~p|484HI`K@88K`8xKK!` 88b8̐h"(cK`8K`Kf| FN!A(Kl ANiBufIClose__FP5NITABP7NI_XHDL```@|aA!aT>`!,@; cc;HbU,@|X;8X|#@@x, @<Xcc888Hw,AT,@HaK`8-8~PK!`(8 HcK`K`8`8!}!AaN 8`8!}!AK,#AT|@@<,&@|X|0Ad}&, @,@LK` 8b8l(Xc Ka`8K`8PX8`K9`|X"8(`gXcp8P8Q99)' xK`X88`x |2X|Ҁ|K,AhK` 8b8l(Xc K}`8K-`8PX8`KU`K8|XHEcc888Hum,AT,@HaK1`8_8~PK`(8 HcKa`K`8`8!}!AKXacDK`KcF[Kc~cH,@<|X|`y@8`8!}K(8!}!AaN K9`" 88b8"(cK`8K`K A p&NiBufIRead__FP5NITABP7NI_XHDLPUcUiiPUia`@|aA`}`!W>`!1,A(@l,(A@8ccH],@ {ccceHj,@|#yAc9Ap9!t9xcc' l| LN!A(,@xtcc8chH_a|`,@ap;`,#@cc8c'HmM`{,A ,@<,?Acc888HrU|`4T~8dx|8!}!AaN ,?@K,@;`p, @KL`8!}!AaK|c8!}!AaKcc8c'chH^),@;`,?A K,@,;`,?AK,@cc8c'Hk`{,AKccH[],A8!}KK`B 88b8"}(cK`8KE`,?AKT A(NiBufIWrite__FP5NITABP7NI_XHDLPCUcUiiPUi88b8c9U|c8*(@8H|iN 8d(,#Ad$,#@H88`N 88`N 88`N 88`DN 88`HN 88` N 8`N 8`N @9NiBufIGetHdlParam__FPC5NITABPC7NI_XHDLP13NI_PARAM_DATAPUc`;`|aA`|e;88!aT|d*(A |iN , A8PX8`cKA``g]`8(c8 8P99> K`b@,@8K`8~P8 K`|`8 KG`K`8`8!}AaH , ,A, AA8PX8`cKu``g]`8(c8 8P99> @KI`b@,@lKQ`8~P8 K`|`8 KFM`K`8`8!}AK4@z,#A8H&b@, @t,@K` 8߀9|("T 8,'c|H*@9`8pK]`8K `H,AXKY`|(8߀"T8,$9c|8*@9`8pK`K`H, A8PX8`cK``g]`8(c8 8P99> K`b@,@Kߝ`8~P8 K-`|`8 KD`K`8`8!}AK, A8PX8`cK``g]`8(c8 8P99>K`b@,@K`8~P8 K}`|`8KC`Ka`8`8!}AKccDK&b@, @T,@Ky`b b`8 |("cK-`8K`H,A8K)`|("`8 cK`Kޝ`H(, A 8$Hxb@, A8PX8`cKΕ``g]`8(c8 8P99>8Ki`,@Ku`8~P8 K`|`8xKBq`K`8`8!}AKX|&,#@T,@K ` b`8|("cK`8Km`H`,A8Kܹ`|("`8cKu`K-`H @, A8PbX8`cdK=``g]`8(c8 #8P99<K`,@8K`8|P8 #K`{`8$KA`Kܑ`8`8!}AKD|&,#@D,AK۱`|("`8`cFKm`K%`H,ALKq` 8b`8`|("FcK!`8K`HĈ@, A8PbX8`cdK``g]`8(c8 .8P99<K}`,@K`8|P8 .KQ`{`8$K?`K5`8`8!}AKH|&,#@D,AKU`|("`8cJK`K`H,ALK` 8b`8|("JcK`8Ku`Hh@, A8PbX8`cdKʅ``g]`8(c8 98P99<K|Y`,@Ke`8|P8 9K`{`8$K>a`K`8`8!}AKH |&,#@D,AK`|("`8c"K`Km`H`,ALKع` 8b`8|(""cKi`8K`H 88`8!}AaN A 8NiBufISetHdlParam__FP5NITABP7NI_XHDLPC13NI_PARAM_DATAPUc|``T>!, @P, @|X,Ap,&APX,#@ 8`8!}N 8`8!}N @8`8!}K|cHrm,@dX,>,A@xP|`yAX,#@K8X, A8`8!}Kl,@!qA,AXc`XH,@(8`(8!}N 8!}N 8P8`XKM``g;8("c88P99)&^Kx`b@,@DK%`"88iPKٱ`bX"8&cK:`KՍ`8`8!}N 8P8`XKŕ``g;8(c88P99=\^Kwe`b@,@Km`8}P8K`bX8cK9e`K`8`8!}KP A NiBufAlloc2`?|@;@|aA!`{``T>!AAp}, A|@@,@|8yHK;5A({,#A,,@88| px ````! |daҐe8C 8`8Д8!}!AАe 8Hd8Had0N Ky` 8(:8xAcF 8$K!`8K`{K8P8`X|PK``g] 8Hb|cp8(8P899;HKt`,@8|!q, @, A8PX8`K``g9B8(c88P99<#JXK`a`,>Ab@,@(8`8!}N K=` 88b8$XK`8K`8`8!}Ke8`8!N AH?NiBufISetExtFunc2__FPFv_vPFP5NITABP7NI_XHDLUciPCUcUi_iPP4FILEUc`@|a;!Q,@, @$, A8PX8`K``g]`8(bc88P99;K^`,@DK`8{P8KQ`(`8cK`K)`8`8!}aN 8`K#-A(,#A8`~8 8c| px ``! |aҐ8cC 8<8b~c K`~`8`8!}N 8PX8`K}``g]`b8c8(8P899;HpK]I`,@KU`8{P8K`"(8h8`cK"`K`8`8!}aK8PX8`K``g]`8(bc88P99;K\`,@0KK` 8b`8("cK]`8K `, @`K< A NiBufIHdlInit__FP5NITAB|``aA`!AK `p`Ab@H8PX8`K``g;8(b"c8Jp8P99;(\pK[i`b@,@XKq`8{P8KK`"(8<pcK`K`b@&, @|,@K` 88bc8\p"(cK`8Kq`Ecc899 HHd,A`U9>!8a8K`,A8PX`~8`K!``g;8(bc8p8P99; \PKX`b@,@DK`8{P8K`"(8 cPcK%`K]`8`8!}!AaN x|`;W>bK9A(,#@8PX8`K!``g;bc8(p8P899;H]PKW`b@,@@K`8{P8K`"(8 cPcK`KY`K`xbH`8(WcF>epfFp8 x :  8xxxKi`,=TF>aT`>aTc>x@@K`,:|y8T>A ,:@,9@88,>AԈ, @؈, @cKA(8PX8`Ku``g";8(c8Pp8996 $]PKVA`b@,@@KI`8vP8K`"(8 DPcK}`K`8`8!}!KXcc8cH+,,@8`T~>cKA(,>Ab@,@HK`8vP8K!`(88 dc"cPK`K`c8!}!K8`8!}!Kt``ADK<c9c`8K9`T~>Kcc&|`K`K A ,NiBufISendMsg2__FP5NITABP7NI_XHDLiT3UcPCUcUi|`aaA`T>9PW>8`!1XhK``g9B8(""cc8vp8P99) JxKS`&b@, @,@ K`b 88bc8 x"(cK]`8K `c8ccIK8!}AaH,AK`(8c"8 cxK`K`c8ccIK8!}AaN c8ccIK8!}AaK A)NiBufISendMsg__FP5NITABP7NI_XHDLiUcPCUcUi|``}aA``!`a8!ѐfA((@z, @ ,@TKa` 88b8b"}(> cK `8K`,5A X,5A ,<A ,5A ,5A,5@, @x, @p, @(7@8aK)`cc8889K1,Axa,@DKu`8{P8K`}(88cK`K`a@8!0}K8`KA(,#|p@8P8`XK``g";8c8(x8P899;p^KI`,@DK`8{P8K)`"}(8 8cKI`K`8`@8!0}K|c8cH cc8H%8`@8!0}Kp8PX8`K``g;x"<c8(8P8p!x99;!^pKHY`,@Ke`8{P8K`"}(8c*x<pcK`K`8`@8!0}K;?} KyAD|8ccb i8b| IN!A(|`,@|8PX8`K``g_8(pc8P8 w99;KGU`,@DKa`8{P8 xK`"}(8bcK`K`t, A`, @T,@pK`8{P8 K`"}(8vcK`Ke`K,cc88K,A,@ bcK]`K`K\88~c$K9` ~ |tTc@.TT|x|+x|x,@K`8{P8]K`(8b"cK``hc8ccc9;9[!p!xK`KI`K KK`" 88b8|}(cKM`8K`K A +NiBufIProcMsg__FP5NITABP7NI_XHDLPCUcPUiPiT4|``aA`}!T>!1| A&b@, @,@K` 88e0(="DHax(cH`hcCcec&8xK!`8K`8!}!AaN 8!ИN ,AK` 88e0(]"$H%a(cH`hc#cecF8KU`8K`8!}!AK48!N A%NiBufISetStatus__FPC5NITABP7NI_XHDLUc|``~dT>!A, ,@t@8, @h@8T>,$AԀ~&,#@t,@HKi` 8b8 p~("cK`8K`8`8!}N ,AK`~("8 pcK`Kq`8`8!}Kcc888H",A,@ aK`8:8}PK `~(88 HcK`K`Kc8H5-,A,@Ĉ$@, 4A,@pP, A\,@PK`8,8}PKq`~(88 P"cK`KI`KKK`~(8"8 cKM`K`K`8!}N @K@A,#@8, @8pAb@Kcc888H!,A\@,@LaK`8h8}PK]`~(88 HcK`K5`(, Atcc8H,A\,AT8!|N c8H3=,A,@b@,@tP, A`b@,@PK`8Z8}PK`~(88 P"cK`Ka`KKK`~(8"8 cKe`K`K\8PX8`KA``g9B8(""c8D8P9p9) JK6 `8`8!}N A NiBufISetHS__FP5NITABP7NI_XHDLUc|`8cTa``c!A8K(!`,A48`{cc8hKYc8cKi8PX8`K``g;8(""^c88P9apAx9)\XK4`b@,@xK`"88iPKe`("cf"X8,cK`K5`8`8!}aN 8`8!}aK8`8!}N A/NiBufISendSocket__FP5NITABP7NI_XHDLPC7SI_SOCKUi|``aA|!`@c&!1,, A@L,@K]` 88bcf88"(cK `8K`8~PK8~XKcc8K88p8axKm=`,A8PXa8`eK``g;B8("cc88P999Z8K2i`,@DKu`8yP8K`"(8 8cK`K`cc888H=|`48!T~8}!Axa|N xpcc8XHcc888H|`4T~8x8!}|aN 8~PKA8~XK9cc8KI88p8axKk`,APKT,AK` 88bcf88"(cK`8Kq`KA,@,cca8!}N K`(8cf8c8KM`K`cca8!}K,@lK5` 88bcf88(cK`8K`cca8!}K4cca8!N A#NiBufISetError__FPC5NITABP7NI_XHDLi8, @ 888`N 88`N @@$NiBufIGetParam__FP13NI_PARAM_DATAPUc8, A8`dN H @$%NiBufISetParam__FPC13NI_PARAM_DATAPUc|`|`T>`!QH,@, @, @8PX8`K{``g;8("c8 =p8P99= $^K-`b@,@dK`8}P8 >K]`"|(8 DcK`K9`8`8!}N 8`8!}Kcc8cH,,@8|8!}K``@|c8!}Kp A,NiBufIWriteUserMsg__FP5NITABP7NI_XHDLPCUcUii|``a!Q, @X|#yATdKg`8`KU`K]A(`{&@|}, @,@K` 88b|c8@"(cK`8Kq`8~XKc8!}aN 8~XKuc8!}aK,AKe` 88b}c8@"(cK `8K`K|8PX8`Kx``g9B8(""c888P9p9)pJ@K*`8`8!}N 8`8!N A$NiBufICheckError__FPC5NITABP7NI_XHDL|}&aA`|+y!``T>!AAL>y8}, @8}9p,#@cccecFp8K `|z,A\,>@48!cC}!AaN cK=cC8!}!K!xp8xcc|P|H|E,@0, ax@(88ax@}(,#A x@x(8, AH,>A 8&@, @,@K` 88bx8 p"(cKM`8K`,Acc8H}8`|8!} !AaN 8`|K,AK` 88bx8 p"(cK`8KA`,AXKDx8cc888H,A8!}!AaN @x}088}08,$Ax@}0x8K$ccpcecFK `|zK4cEH"8,pA|zK; K C4NiBufIPrivWrite__FP5NITABP7NI_XHDLPP8NIBUFFERPCUcUii|`,a``||!AA(A8bXT8`| @8b8{$|p|xEx.| Pc|c$pAc |@8, b@@|,>A, A8b8{$|p|,xEx.c| P@8cHu,A(8!}aN cK},@,ccH,@|3yApc9A9!9 l| LN!A(,@c8cKI`, A,A ,@;, A`c888H ]|`4T@8!8`}K8!}aKcc88H|,A,A|c8!}K|cKK8|cKc8!}aKPcc88cK%|`,A ,A`8!}Kc888H E|c4T`~|`|xx8|K,A|cKKP|c8!}aKK` 88b8"|(cKy`8K)`K$8PX8`cKpI``g;8(c88P99<#t]K"`,@8K%`8|P8K`8#K!`K`8`8!}aK8PX8`cKo``g;8(c88P99=\^K!i`,@K~u`8}P8K`|8Kq`K~`8`8!}aKP8P8`XKn``g9B8(c8p8P99=$JK `,Ad,@K}`8}P8KY`bX888ccK`K~1`8`8!}aK,A|K}i`bX8888cK)`K}`8`8!}aKH8, Kp A, NiBufSend, A 8`N H @$NiBufIGetBufHdl__FPC5NITABPP7NI_XHDL|```!a, A(@x8, A\ccH1,@((, A`!, A0|;yA4~|`y@\cc8HAcccH,@(, @8`8!}N cc9x9!t9Ap l| LN!A(,@hxtcc8cK`}p, A ,A\8!}Kdcc8H],@K,|c8!}K4b@,@DKz`8 8}PKE`(88 cK`K{!`cc8Hs-8`8!}K8`8!}K8`8!}N 8!}N (, AK|H`,A,A,@8, @pK88`8!}8XXN A'NiBufIEmptyOutQueue__FP5NITABP7NI_XHDLi|``dDT>@!q|@AЈ&b@, @x,@PKx` 88b8"H"(BcK}`8Ky-`8`8!}N ,AKx]`(8"B8"cHK`Kx`K,%A;eap0, @ }0ap(8ap@}(,#A p@}@p(8@,$A8&b@, @,@`Kw` 88bp8"H#("BcK9`8Kw`b@,@PH}@D|| @A&b@,$@,@hKv` 88b8x 8#@(D"H|c||K`8KwA`8`8!}N ,AKvq`(@88Dx "}AcH|B8#|K`Kv`8`8!}K8b考,$A8x |)|,A܈&b@, @p,@,Ku` 88b8#HH(cKm`8Kv`8`8!}K,AKuU`(88#HcHK `Ku`8`8!}K8`8!}N cc8HmK,AKt`(9""pB8"cH)Ky`Ku1`b@KHcc888H,@K;c8ppHji,@apK0 A9NiBufIAddToUserQueue__FPC5NITABP7NI_XHDLPP8NIBUFFERPCUcUi``}T>aAT>|}&!ȋ_?,$8!!A(@b}$,#4@|9A|xx |8T>,#A`,;N@`|:(@ ,<@&@, @,@c|(9|+xA`8T8h| HN!A(,@T,<@ , @|9A0,9@(;,;@ ,9@|9A, @c,#A|@ &b@, @0,@d88Tcf| FN!A(,@h,<|484@DHՙ`8`8!|} !AaN H `K8PX|8`KbY``g;8(b"c8x8P9p9;\K`b@,@DKq%`8{P8Ku`"}(8ccKvU`Kq`8`8!|} KKp`9 r9`-}(8"|98-cA8r9@w8-|9A8wh9-|9A9c|9@9 -9@9@-`9A9`capx88TKz`Kp`K,AKo`b 8b8}8,?}(|9} 88}H8/(/}$ 8|89fc..'A"9 r9@-@8-@8-8c@9-@`9 -@4pxa8TKz!`8Ko`K9@wpxa8TKy`KA9@wpxa8TK9c@K|8wKd8r@KT"9 r8-8-A8r9@w@<8-@(9-@9 -@89@-K0@,9@-K$9c@K8w@KcK;K"8|dHY`8`8!|} K`Kn`9r8-9 -}(8]"|89cA8r| 98-A8w|9@9-|9A9 wb88$pKxu`Kn-`K,AKmq`8b 8|8,}(|9|88|08/ /8cA]"9-@8-@d8-@<9 wp8$Kw`8b Kmu`K9r9 wp8$Kw`K8wA9r9 wp8$Kwe`K8r@Kp]"9-@8-@d8-@<9 -p8$Kw!`8b Kl`K,9r9 -p8$Kv`K8wA9r9 -p8$Kv`K8r@Kp,<@8K,X, Abx( A`8, @$, 4A, @0b(, c@|`9A|x,#@D(,#@8,#@,$b,$4c|xA``T>KKbcKP, @, @ K0bc|x|9AK C H*NiBufISelUpdate__FPC5NITABP7NI_XHDLPCvUcT4|`,``||!QA8bXT8`| @8b8{$|p|xEx.| Pc|c$pAc |@L!A,>A8b88@{$|p|xEx.c|0P*,@X8cK,A$8!}N cKߑ,@;8XdX|#@@x, @c8888XK,AX@,@H|~Kh`88}PKmQ`(8 HccKm`Ki-`8`8!}K(8`8!}K,#A~8c888XK1,AX@,@H|~Kg`88}PKl}`(8 HccKm!`KhY`8`8!}KTcH,@@aX, A K48`8!}K|c8!}KKg` 88b8"(cKq`8Kg}`Kh8PX8`cKW``g;8(c8u8P99=\^K m`b@,@8Kfu`8}P8uKk`|8Kq`Kf`8`8!}K8P8`XKV``g;8("c8sp8P99)$]K`,b@Ah,@|Ke`b8s8cPKjE`bXc88cKʥ`Kf`8`8!}K4,AKeU`bX888cKp`Ke`8`8!}KL"BAKT A@ NiBufReceive|``aA!aA!!8, A;bX;@|PH`p:@h``!, A8axKa`8axKU`8T8xK`8T8xK`8ax8xc%8K`,@8T8xK%`T`>, @P8T;@8xK`T`>, @(;,:At,=A8, @Dccc%H!8! }!Aa!AaN cc8K,A ,@,=AKp`~b@,@HKb`88}PKga`(88HccKh`Kc9`c!8! }!AaK,W>KWZ>8T8xK`T`>, @K!8! }!KT8ap8;c%p8Av|Kx}xtK%9`,@v|89@DvWZ>|x|+x|x|cx|9@ W>K;Kv;@|x|+x|x|cx|9@K|H!8! }N A|#NiBufITryToRead__FP5NITABP7NI_XHDLi|`8!Q, aA|;;`!8, @tca89pK`,@蛟$8x8@8ax8,$A@@ax8c@,#At88axK80|#@A0,#@`8`8!}N 8ac888K,@K(8axK80|#@AKc@,#AKd|`,A`8!}Kxp, A<88x 8|8p|!Ҁ|$8`K ac9pKE`,A|`,A`8!}K A (NiBufISendReadyQueue__FP5NITABP7NI_XHDLi``|}&aA!`}aU;>UZ>aA!x$!,T>)X)X@ |c,#)@D88`o,#,;@ ;@%),:A,@88a`ccK-`,A,AX) )|8!)} !Aa!AaN 9"Ƞ;8a88@88c xKp9`8aK-`)X8a8`K 9`|8 c8cKx`8P8`cKM``h_;cgc8(!829 8P b|9^"89"\pxaK`b@,;@,AHK\Q`8~P8:K``x8"dc&9"Ka}`K\`88KQ`8`) )8!)|} K`,@K,:Ao, @KY,@L8`K,@,;Aa8o, @(,>@ 8`K8`) )|K̈parb@qs|tTc@.T|xT|c+x|x8,T>@48K;8K,:@a8`8`8c'bKq,A8,@,:A,>A,:@,@8H,A|~,@TKZU`88|PK^`bX8!c8c"cK_u`KZ`88KO`c) )8!)|} KX8`) )8!)|} K<8`) )8!)|} K 8PX8`KJm``g;8(Bc8p8P99: \K9`,@LKYE`8zP8K]`8!bc"c(cK^m`KY`c(K~Q`88KN`8`) )8!)|} K<|~c(K~ `88KNU`c) )8!)|} K,:@bH,AP|~,,@;bA|8PX8`KI``g[8("c8p8P99)!|K`88KM`c) )8!)|} K@KW` bc8!@"c(cKbm`8KX`K@@KWm`88|PK[`88!cc"c(cK\`KW`88KL`K0Ke}8`) )8!)|} K`KV`88 c(cKa`KWQ`Ko, @LK$8|~8KLE`c) )8!)|} K8|`8KL`c) )8!)|} K@Kc&Kd8ac`c&cK`,A,,@`;;K,cKAcKcec8`HE,@Aa(,@DKU`88PKZ1`x88 t(KZ`KV `a() 8!)}!AaN ,Ao, Atv8)X8a`uwW|9!|tT@.)X!xTTp|#x|Cx|#x8c899 9AH ,@ao8oT>)XwTF>tT>uT>vKKTq`8x8 K_5`KT`o, @$av8xutw:Tc@.T|tT|x|3x|x|~"```!8abKi`,@bKIA(`s~4:C88aK5`,@L|tKA(`r|s:c|tKA(|8o|c"T>:|5@HKlKSY`x8 8K`KS`|t.KA(`r|s:cAKS`x|, @ 88 KM`KS`KT8KKR`x8 8K]`KSU`K8PX8`cKCu``g;8("c88P99)t]KE`b@,@@KRM`"88iPKV`"8KA`KR`8`) 8!)}AaN C 8T>cKEA(||yb@A:,@cccEK =`,<;\AbB"`!cYcC8K-A(,#A48;Cc#8K A(,#A8;8c,6Ab8KA(,#A|8:.:Ac#cbccH;,@l@\cKeA(8` 8!|} !Aa!AaN acKA(,@HKM`b88cPKRu`8}8LKS`KNM` a8!|} KHcKA(`eccKA(,A؀,AKMU`}cc8KX`KM`K:Ka8KAA(,#A8:KHa:K8(:@cc#Kb;c#K;@KcCc8KQ`,AXKL`}c8KWe`KM`K,8PX8`K=A``g;8"|cp8(8P899)H^K`,@DKL`b88cPKP`}c8K`KLy`8` 8!}!AaN 8'(c8H`K` C-NiBufIHostToRoute__FPCcT1UcPP4FILEP9ni_iroute|``aA``!a`a:aYaA!xpc|tTTc@.T|x!|+x|x|@A8PX8`K;E``g;8(bc8]8P99;x\K`b@,@@KJ`8{P8^KN`}~8KOQ`KJ`8`p8!`}px!Aa!AaN |8dKA(`u|w8|@A8PX8`K:1``g;8(bc8g8P99;x\K`b@,@,KI `8{P8hKM`}8~|8KN5`KIm`K8T>8||"K%A(`s~U|8|@A8PX8`K9]``g;8(bc8q8P99;x\K-`b@,@XKH5`8{P8rKL`}98}8|~KMY`KH`K8T>|t8||"KEA(`oTn>|r|w||88e|@A;(<Ac8c8@cKU`8(;:p?Acwbc8 K%`8,:A 8(qAl(AL8|q,9@,$@a,#A  | A| P88`K8PX8`K7``g;8(bc88P99;x\Km`b@,@KFu`8{P8KK`}8 KK`KF`KX8b8cK^`,@8K9@cc%8cKP`,@K}|cCK`K|cC8pK`8pK8PX8`K6i``g;8(bc8|8P99;x\K9`b@,@dKEA`8{P8}KI`88}|9/|8 })~KJ]`KE`K A8ENiBufIRouteGetNext__FPC9ni_iroutePUiiPP4FILEPcN25P11NI_NODEADDRPUsPUc|``aA!aA!xp!a, A(A `<`NI:, @ 8ccF9K `,,A8AT,@0, A~P|&,#@`,@ , A, @Pcc898K,,AA,@x, A~P,A,, @,@~x~*x|+y@t&, @ ,@TKBY`8b 88(h"cKM `b KB`P~,:A,4@cccH9!9A l| LN!A(,,@8~PKqK|c@Pc8PcH7,@PX8P&}, @,@`8`8!}px!Aa!AaN K@`(8"8chKK`KAm`Kp,AhK@`8b 88Ȑ(h"cKKi`8b KA`K|c8!}px!K,A8K@=`b 8h#("cKJ`b K@`P~,K(A~x~f2x|3x|+y@Ȉ&,%@X,@K?`88h("cKJm`b K@`P~,K`,AXK?]`81(h"cKJ`b K?`P~``,K 8PX8`K/``g9B8(bc8 L8P99;JhK`,@PK>`8{P8 MKCM`(88"Pch KC`K?`8`8!}px!K|~,@HK>=`8 8}PKB`(888cchKCi`K>`c8!}px!K8~PKmcc888K,@`, A8`8!}KLcc8Kcc8K8`8!}px!K8~PKm%cc888KM,@a||`x|v|`8|K, AKDK<`(88lPch KG`K=i`K,AK<`b 88l#hP( cKGi`b K=`K`cc8P88`HG9,@cc888KY,A8!}K8|~8!c}pK , A0~P|}&, @T,@ 8`KtK;`(8P8lch KFy`K<1`8`K4,AK;y`8b 88lh~P( gKF%`8b K;`8`KP~, @,#@, AЀh |@A0cc8P8`HE,A8!}K;8@88@8K@`8aKd`8a8lK``{PK=`Te>|{8\KOA(8a8lK`888Tc89K`8PX8`eK*``g"8P9Bcc9<`x8(8 p9JhK`,@|K9`8|P8 K>]`(8""AaehKU`8ccecT`>cpcFcG9AK>`K9`8`8!}px!K8PX8`K*``g9B8(c8 8P99<JhK`,@pK8`8|P8 K=m`(88"chK> `K9E`8`8!}pK,K , @, @|X|@x@, @H(A`88cc8P8`HC,@cc888K!,@~PK\88K888K4|cH4,Adc`~cccK~q,@$8!8`}N 8!}N 8`8!}N A \NiBufIIn__FP5NITABP7NI_XHDLi|`|,a`|~!A`8bXT8`| @H8b8{$|p|xEx. Pc|{$pA |@ 8Ku,A,08! |c}aN cKu,Ax@|,@c08! }KK5`bX8cc8cK@`K6Q`c08! }K`$, 4Apb@,@8`08! }K0K5e`bX8c8hcK@!`K5`8`08! }Kc8KQ`,A|@Xa,@d8|@8c8@88KG`,Aa08! }Kx8acKZ`a08! }KTK4`8c8<K?E`K4`Kl8P8`XK%!``g9B8(c8p8P99=$JK`,b@Ap,@DK3`8}P8K8}`bX888ccK`K4U`8`08! }aKd,AK3`bX8888cK>A`K3`8`08! }aK ANiBufCheckPendingConn8cN @NiBufIGetExt__FP7NI_XHDLb8|`|x|v|(8N @ NiBufIGetExtText__FPC7NI_XHDLc@N @!NiBufIGetOutQueueLen__FPC7NI_XHDL|``aA``U>d!A,#@(b@&, @,@x^cc88K,@,A8!8`}N A8!}N K1I`(88"8cK<`K1`KT,ALK1` 88b88"(cK;`8K1a`K|%@@, @hc888K,A$A8!}N 8`A8!}N c888|xKE,A8!}AaN 8PX8`K ``g;8(bc8Ap8P9x9;\K҅`b@,@lK/`8{P8K4`"(8cFcK4`K/`8`8!}AaK,8`8!}AaK A 4NiBufISelSet__FPC5NITABP7NI_XHDLP10NISEL_IMPLUcPCvT4```}ad||%@T>!QA8P8`XK5``g;b8("c8,p8P9x9)[K`b@,@xK.`"8-8iPK2`}("c"8cK3%`K.]`8`8!}aN 8`8!}aK؈c88|x8Km|8!|dx|v}|d8|N A2NiBufISelClear__FPC5NITABP7NI_XHDLPC10NISEL_IMPLUc|``aA!`y@!A|%@@X&, }@4,AK,e`y(88"8cK7`K,`HD8PX8`K``g;b8(Bc8Jp8P9x9:[Kν`,A(8!8`}!AaHK+`8zP8KK05`"y(8ccK0`K, `8`8!}!AaH,APK+5` 88b88Ԑ"y(cK5`8K+`;c#c888K,@T>@|a`!a,@4,>@ $, 4A(, A c8cdKu`e,@8,<@,c8cdKI`e,@L8b8XXccd888K8!}aN ,A,A,AccdK8!}aK,@K@c88KvU`,@(, AK,@,@8K$`88~PK)m`(88T"cK`K%E`ccd888K8!}aK,@48ccdK8!}aK`eccdKa8!}aK,<@LK K#`8b 8,<,("c@t@@8r9w88K.`8b K$5`$, 4@xK`8-9w88K.M`8b K#`K@48r9-88K.`8b K#`K 8-9-88K-`8b K#`K Ax7NiBufISelProcess__FP5NITABP7NI_XHDLPC10NISEL_IMPLUiUcT5889K @/NiBufISelError__FP5NITABP7NI_XHDLPC10NISEL_IMPL|!`80KA(8!p}N A0&NiBufISelDump__FP5NITABP7NI_XHDLP4FILE|,`aA`T>!`x||!AL8bXT8`| @4;b8{$|dp|xdExe.E P;|y$pA |@,A`|@{$|p|xEx.~ P|$pA |@8K,A<|c8!}!AaN cK,@`, Ap8, @dP|`yAd, AXb@,@HK `B8o8zPK$`(88cK`K u`h, @b@|h,@8dh$, @hdh@,AXP,AL8,=@(dhc|`yA8cadh%c8K!c8K18cc89Km,@HccH,A@,A,@ 8`K8`8!8}8XXK8`8!}!AK8dh$, @ `8bH|P|tx`тK 8K88`aK8KK`(8cc8cK(`K`K8ccKM,@ KccK,A@,Ax|},@HK`8^8~PK"`(88ccK"`K`c8!}!AK,@ KK`(88cK'`K`K8PX8`K ``gX `"}|@X8\b x|@$8c8(px;8P8Q99<L^K9`b@,@hKA`8|P8RK `X("| c@t8\| @D98pK!M`K`8`8!}!AK8 9Ԁ| A9K h| @ 8K p8Ȁ| Al8Kdb 8Ԁc|A8Kb hc|@ 8Kb p8Ȁc|A8K8P8`XK ``g;8(c89p8P99=$^K`,Ahb@,@K`8}P89KE`bX88ccK`K!`8`8!}Kb@,AxKQ`bX888cK%`K`8`8!}KH8P8`XK ``g;8(c88p8P99=$^K`,A\b@,@K`8}P88K9`bX88ccK~`K`8`8!}K A LNiBufSendHandle|`}`!a, @|````!8, @cccKI,@0, A8`8!}N ax,@Tb@,@DKu`8 8PK`}(88$cxK}e`K`ax8!}N cccK ,@TK@8`8!N A<)NiBufIFinishHandshake__FP5NITABP7NI_XHDLi|`|,aA``|{!AA8bXT8`| @8b8{`$|p|xEx. PC|z$pA |@;,?@8PX8`cK``g;8("c88P99)]K`b@,@@K`"88iPK5`"8K{`K`8`8!}AaN 8K],A|c8!}K}ccKq,@;8XdX|#@@dx|`y@Xcc888K,AX@,@H|K`88~PK5`{(8 HccK`K`8`8!}AaK cc888XxK9|c||dx|v|d8|K,#AhcccK%,A@,@cccK,A ,@8`8!}KDacx|`y@L8`8!}K 8P8`XKI``g;8(c8ap8P99=$^K`,b@AL,@K`8}P8K`bX88cfcKy `K`Kl,AdK`bX888cK`KI`K4 ANiBufGetSentHdl|``aA!!aKjA(`}aKjA(`|aKj}A(||?|"|c:|tT@.TU|#x|Kx|Cx8 y';|@@ 8PX8`K}``g;b8'cp?8(8P8x9\9;K5`b@,@pK=`8{P8K`~8c8'cKm`K`8`!8!}aN 8`!8!}aN 88#|y`}K`|8dKhA(`~8T>8#||`}KΝ`|8dKhA(`{8T>8#|zKi`||8dKhA(|| |:8!}888`8!AИ TF>T>aT>N A.NiBufIAddRouteEntry__FPCcN21PP4FILEP9ni_iroute|``aAT?`!;@d|tTc@.TT|x|3x!|xA 8@$ ?8,9Ac:b@````!a888c899 p9@xK1,@|Px|@||&t|`@`z|P|@AH|@@|, A48c;`8v8 88 K`8:|7@ALb@,@D8`8!p}!AaN | |d!|8| PKa`8|8HK!`K`,@|~||`8|,AD;`!@||@@@P;;`|~||c8||@AAK `|8K`KM`KK `|8K_`K)`,KAK q`|8K_`K `,K\K E`|8@8c8 K `K `,KK `|8l8x8 8K`K `,K8a8K`,@8@c88?Kޭ`8>Kc8@88@Kމ`8x@8 88 Kq`8?_;`Kab@,@DK A`88PK`|88Kq`K `a8!p}KH A d>NiBufIRouteToTable__FPUiPC9ni_irouteP14NI_ROUTE_TABLEUiPP4FILE`T~>(|!qA8Tcx8|*| N b8!8cN b8!8cN b8!8cN b8!8c(N b8!8c,N b8!8c8N b@,Ab8!8c@N K ` 88bc8K=`8K `b8!}8c@N A`NiBufIStatusText__FUcPP4FILE|``a`{`eT>!Q|`yxA|&@À||"|%@Ab@,@,8`8!}aN K 9` 8b88 ̐( gK`8K `8`8!}aK|8@Accd K`b@,A$K` 8b88 ( gK-`8K`KcK8 ccxcc8 H,@ccd K`b@,@HKdccc8 H,@LK A@1NiBufICopyTo__FPC5NITABPC7NI_XHDLPP8NIBUFFERPCvUi```aA(|!}&,<!1A:b@N|(@;`B8;   ``!|<@A:0|<@@;_NBALK`8c(c cKI`b #K`b@|@|;@@@c88,<@t, A@`0, A A@@|@ATATK` ~b8 ,(BcK`8KY`b@|@H8!|} !AaN K]` b8(cK`8K`8!|} KK ` b8 (0c@8K`8Kq`b@|KK` b8(8c Kq`8K!`b@|KXKi`8(cKV`b #K`b@|K@ 8KK`b cD8 D(@cKVY`8b K`b@8c|K; @8K|K` 8b8ԓ"(cKq`8K!`b@(,<|A@K8!N C (NiBufIDumpOutQueue__FPC5NITABPC7NI_XHDLi|``aA`!x!, @ pyA 8;@|,;A8; 8aX!K`,A@a,@HKU`8p8~PK`(88xcK`K`a@8!0}!AaN ,6A (A cbK`,@``!8T8K`,A,@a,;@  `| A p@H,6A,8@:b,;T>@: `cbKq`,@````!8T8K`,A,@,a| A@H|wP,8(@:@b:|7@Ad&, @ aC&a8KH`,A@|~,@HK=`88}PK`(88ccKi`K`a88K`c@8!0}!AaN a;舜K4`,;,@l@a8H`@a,@&,$@,@b@:,A:@P,A:D8b88lKjI`,@a"&",$A;@b8899 cJx8pK.`cKfA(>pX, @ 8XXxcc888K},Aa,@DKA`8\8~PK`(8 HcKq`K`a88K`a@8!0}Kcc889KLQcc8Kecc8Kc8`@8!0}K,@aKY`8{P8K`(80cK`K`K:PK@daK@,A@|~,@DK`88}PKu`(8TccK`KQ`a88K]`c@8!0}K8<a88Kq|{,@, @b@,@DK%`88~PK`(8xcfcKU`K`a88K`cc@8!0}Ka898P8@8TK`,@A|},@DKq`8#8~PK`(8ccK`K`a88K`c@8!0}K8,a&,@@H,@@"_"8A8888b8p9KI`a `X| A8cT88D8lKe`,@Xa"&, A;@8T8D89x9 cJ8pK*`K|,@p|zK`8{P8EK`(80cFcK9`Kq`K,@8K0PXK9b8.8bc8TA99 9@9Px pK``a88K`@8!0}Kd`~b@,@HK`88}PK`(88 ccK=`Ku`a88K`c@8!0}K:cbK`,@P````!8T8KY`,A,@a|P8,T\(@ :@b:|7@@Kp@KPXKT\K8P8`XK``g;8("c8|p8P9x9<]Ka`b@,@DKi`8|P8}K`"(8bcK`K`a88K`8`@8!0}!AaN 8P8`XK``g;8("c8cp8P99<,]Ky`b@,@@K`8|P8dK`"(8PcK`K`8`@8!0}N 8P8`XK``g;8(""c8[p8P99)]K`b@,@K`"8\8iPKM`(""8cK`K%`8`@8!0}K8 A  'NiBufIAcceptSentHdl__FP5NITABP7NI_XHDLi```|`|aA!c`f!| A(FN!A(,@|@@H8|@88.8Ku`888Tc89K`8PX8`K=``g;b8(c8x98P9= \[ pK`b@,@pK`8}P8K`(;"adEK}`8 c%cFcTj>ccc9!K `KA`cK#u8`8!}!AaN 8!8`}dN |c8!}N A4NiBufICallAlloc__FPC5NITABPC7NI_XHDLPP8NIBUFFERUiPCc|``~d@p0!Q8@0@@e8,#A@@e8@,$Ad8p8apK" cc888K~5,@AX,@PaK`888}PK`~(88 HcK!`KY`0&,#,@l@ ,@TK` 88b8 l~("cK9`8K`8,#@(,#A,@DK`8C8}PK`~(88 cKM`K`8(,Acc8K}8!}N ,AK,ALK` 88b8 l~("cK1`8K`K@l,@K%` 88b8 ~("BcK`8K}`,AK,AK` 88b8 ~("BcKe`8K`,@8!}K(Kp8, @8pK At/NiBufIRemoveFromUserQueue__FPC5NITABP7NI_XHDLUc8P8`|Xc!qKߕ``g;"c8(88P99)](Ke`b@,A8`8!}HPKY`"88iPK`"(8KSM`K`8`8!}N A,NiBufIGetBufHdl__FPC5NITABPP7NI_XHDL@AF70_35|@;!q, @d,AK]`bX8#cK`K`8`8!}N 8PX8`cK``g^8("c8 8P99)K`,A8`8!}HPK`"8 8iPK5`}"8$KQ`K`8`8!}N 8`8!N Al-NiBufISetParam__FPC13NI_PARAM_DATAPUc@AF71_308P8`|Xc!qKܕ``g;"c8(88P99)%]@Ke`b@,A8`8!}HPKY`"88iPK`"@8%KPM`K`8`8!}N ANiBufGetPtr@AF72_14b808cdN @(o__sinit80000000_x_2fsapmnt_2fis0174_2fa_2f722_5fEXT_5fREL_2frs6000_5f64_2fgenopt_2fkrn_2fni_2fnixxsel_2ecpp__Fv8H< @ NiSelNewSet||yT>!aA(A,A88`Ha,#Ac`}axe| EN!A(,@(8!8`}N 8|ax8f| FN!A(c8!}N 8`8!}N 8PX8`cK=``g;08("c8C8 99)T]K `b@,@@K`"8C8i K`"8|KM `K`8`8!}N 8PX8`cK؁``g;08(c8B8 99=^KQ`b@,@KY`8} 8BK`|8(KLU`K`8`8!}KL At NiSelNewSet2|;aA;0!8aA(8`hK A(a,#@l8P8`@XceKI``g_`8hcc8(8 8d99<dpK`,A8`H8H1B@y@8PX8`cK``g_`8hc8(8 8d99<dpK`,@LK`8| 8eK-`~`88hKMU`K `8`H8}e| EN!A(,A88|~cf| FN!A(8PX8`cK``g_`8(bc8op8 99;K`,@TK`8{ 8pK5`}`8cK`K`8`8!}AaHH}8@H`8}88KA(,@(A8!c}N K` 8bX8`8cK`8KM`cA8!}N 8!}AaN 8`8!}AaK (AcreateSet__10NISEL_IMPLFPCUc||yT>!aA(A,A,%Abc| Abc| Abc| A8PX8`cK=``g;08(c8e8 99=^K `b@,@8K`8} 8bK`|8(KG`K`8`8!}N 8`K,#Ac`}axe| EN!A(,@(8!8`}N 8|ax8f| FN!A(c8!}N 8`8!}N 8PX8`cKѭ``g;08(c8a8 99=T^K}`b@,@K`8} 8aK`|8|KE`K`8`8!}Kp8PX8`cK``g;08(c8`8 99=^K`b@,@K`8} 8`Km`|8(KD`KQ`8`8!}K AP NiSelNewSet3|,#!qA(AX8|3yA0`88f| FN!A(8`8!}N 8PX8`cKϵ``g;08("c8}8 99)]K`b@,@`Kލ`"8}8i K`"88KC`K`8`8!}N 8`8!}N APNiSelDestroySet|T>,#!qA(A@|8h| HN!A(|c8!}N 8µPX8`cKE``g;08(c88 99=p^ K`b@,@\K`8} 8K`| 8KB`Kݑ`8`8!}N 8`8!}K A@NiSelSet||~y`aT>!QA(A|,A8bXcTc8`f|0@8b8{d$|p|xEx.|0Pc|c"$pAx |@l$,$AX$,$"ALcxx`(#A`ccd`e| EN!A(T`>, @xccdcf| FN!A(,@88ccdHf| FN!A(, A$8`a8!}N ccd8f| FN!A(8`a8!}K|ca8!}N TzK8P8`XKM``g;08(c8ap8 99<](K}`,b@Ap,@@K`8| 8Kީ`bX(8cfcK? `Kڅ`8`8!}aN ,AK٭`bX(88cKq`K)`8`8!}aK8PX8`cK5``g;08("c88 99)p](K|`b@,@4K `"88i Kݙ`"(8K>`Ky`8`8!}aK A NiSelClear|,#!qA(A8 d| DN!A(|c8!}N 8PX8`cK``g;08(c88 99=p^0Kz`b@,@\K`8} 8KY`|08K<`K=`8`8!}N 8`8!}K A4 NiSelClearSet|,#!qA(Al|8p(f| FN!A(|`,@$ap,#@8!8`}N `8!}N 8PX8`cKa``g;08("c88 99)p]8Ky1`b@,@`K9`"88i K`"88K;-`K֥`8`8!}N 8`8!}N Ad NiSelSelect|`,#!aA(A`#8p)8 i| IN!A(|`4arT@8`8!}N |c8!}N 8PX8`cK``g;08(c88 99=p^@Kw`b@,@\Kԝ`8} 8K-`|@8K9`K`8`8!}N 8`8!}K A` NiSelNext|`,a|!QA(A8XT8`|(@t88{$|p|xEx.|(P|$pAD |@8,#APc`e| EN!A(Tc>8!8|t}xтN 8PX8`cK``g;08("c88 99)p]HKu`b@,@`K`"88i KU`"H8K7`K5`8`8!}N 8`8!}aN 8P8`XK``g;08(bc8p8 99;\HKt`,b@A`,@xK`8{ 8Kq`bXH8ccK6`KM`8`8!}aK8,AKх`bXH88cKI`K`8`8!}aK A NiSelIsMember|,#!qA(A8d| DN!A(Tc>8!}N 8PX8`cKq``g;08(c8,8 99=p^PKsA`b@,@\KI`8} 8,K`|P8K5E`Kн`8`8!}N 8`8!}K A4 NiSelGetError|,#!qA(A ,$A4xe| EN!A(8!}N 8PX8`cK ``g;08("c8;8 99)]XKq`b@,@\K`"8;8i Kq`"X8K3`KQ`8!}N 8!}N 8PX8`cK=``g;08(c8:8 99=p^XKq `b@,@8K`8} 8:Kҥ`|X8K3`KΉ`8!}N A NiSelDump8H8N @__ct__5NISELFv`8bH|x!8@cx8!N cK%A(c8!}N A\__dt__5NISELFv|`;808!aaxpK 88sH`88c8ވ8! 8(,980V}08X`48<@bh>HXPN (Ap__ct__10NISEL_IMPLFv``T>c|!aA(e| EN!A(,A8P@,,/AALA|~8`XK``g9B0c8(8p8 99=XJhKm`,@DK`8} 8Kρ`bX808pcchK!`KY`8`8!}N 8`XKe``g9B0c8(88 99>JhKm5`,@KA`8~ 8K`bX808chKu`Kʭ`KT8`XK``g9B0c8(88 99>JhKl`,@Kɵ`8~ 8KE`bX808$chK`K!`K8`XKM``g9B0c8(p8 899=JhKl`,@DK!`8} 8Kͱ`bX808cchKQ`Kɉ`8`8!}K0 , Ab@,@$8!8`}N Kȁ` 8bX80888chK-`8K`8`8!}K Ainit__10NISEL_IMPLFUi|`},8bP,|;!1A(AlA|8`XKm``gcpx8("898 9)AKj5`b@,@PK=`"88i K`bX"ccc8HcKa`KǙ`8`8!}N 8`XK``gcpx8(8A98 9=Kiq`b@,@Ky`8} 8K `bX8$cccK˩`K`KH8`XK `a}Xd| DN!A(|`cpx8(89A8 9<|Kh`b@,@pKű`8| 8KA`X}Xd| DN!A(|hc8ccKʵ`K`8`8!}KT AsetError__10NISEL_IMPLFiPCcT1|}&aA`,!`T>T>|!1A(AP8bXT8`| @88b8{$|p|xEx.| Pc#$pAy |@P$, @ {x@ K^`,@K`8~ 8zKE`bX8 @ccK`K!`8`8!}KT8`XK9``gcAp8(8r8 99> K^ `,@`K`8~ 8sK`bX8 ccKI`K`8`8!}N 8`8!}N AhclearError__10NISEL_IMPLFiPCcT1|}&aA`,!`T>|!AA(A8bXT8`| @8b8{$|p|xEx. P#|$pÀf |@$, @{x@$bp@N,CdADex@c8@f| FN!A(|d,@|@xA`P,A<8Pcf| FN!A(|d,@<8`8!|} !AaN 80ccxK|c8!|} K8PbX8`cdKQ``g;08(c8p8 99< p^xK[`b@,@ KTi`,@Ku`8~ 8K`bX8 ccK`K`8`8!}KT8`XK``gcAp8(88 99> `KS`,@`K`8~ 8Ke`bX8 ccK `KA`8`8!}N 8`8!}N Ah removeError__10NISEL_IMPLFiPCcT1|`,a`~T>|!QA(A8bXT8`| @8b8{`$|p|xEx.| Pc$pA| |@$, @H@,A<~8@c f| FN!A(|d,@̀P,A<~8Pc f| FN!A(|d,@b@,@,8`8!}aN K` 8bXcf808 0cKq`8K!`K80ccfK|c8!}aKx$, "A,$@T~8Tc f| FN!A(|d,A80ccfK!K|cccK `,@T~8Tc f| FN!A(|d,A80ccfKK|c8!}aK~8@c f| FN!A(|d,A80ccfKAK8P8`XK``g9B08(c8-ap8 99=JKO`,b@Ap,@DK`8} 8-K%`bX808cfcK`K`8`8!}aKl,AK)`bX8088cK`K`8`8!}aK A@remove__10NISEL_IMPLFiUc|`(!a, A(Ap;;8;`! |,A }x$|p|xEx.|(P|c"$,%A܈$,%"@;;|@A(d| DN!A(,Ah8P,A|X8`K``g9B0c"8(8p8 99)XJKMi`b@,@LKq`"88i K`bX80c"8cK`K`8`8!}N 8`XK``g9B0c8(88 99?JKL`b@,@K`8 8KE`bX8080cK`K!`KP8`8!}KL,$@;;|@@8Kc8K|m`,@ (K|c8!}K AremoveAll__10NISEL_IMPLFv`;||\c!Q8pA(g| GN!A(p, @``!;c`c8pg| GN!A(`|p, @`(NAb@,@HK`88~ K}`bX808N 8 cK `KU`8!}N `|8!}K ATselect__10NISEL_IMPLFiPUi``|}&aA!`T>aA!8!,A(|4,AX8```! xc$|4x$`88|g.,|3. 8d|+.,|4,@88`8,$0 TKG`b@,@ KF`b@,@|K`8~ 8K`bX8 ccK-`Ke`8`p8!`}K<;8;`;@"@;0X*````!88889#)@ i| IN!A(`v, ALTe| EN!A(`u T:x$~d,A|z`$|p|xEx.|(P|"`$, A$, "A`, @8c88p|!,@~,A8a8 beKA(,@, AĀTc8,|4HK,4~@$, @@|AȀP|A8p@p`8y,@HK`8p 8KY`w8 4bfB2Rb'K`K-`\8\K$, "@@|A08p@`8y,@K=`8p 8K`w8 xbfBb'Km`K`\8\KT|A8p@h`8y,@@K`8p 8KQ`w8 xbfVb'K`K)`\8\KT|AԈ8p@d`8,@DKE`8p 8K`w8 xbfVb'Ku`K`\8\,@K`8p 8K}`wKq``dcxe| EN!A(KA`K(AD,A<bCbTc|;x|48TKw`KbCbcK{`KK9`w8 8K`K`@K8a8 K賁A(K`-@Kd:@K`80|,@|Ax8,=A 88`pj8!`|} !Aa!AaN ,=Ac0d| DN!A(,AlK`w:8 K`K`8`pj8!`|} K8K`bX808cK`KA`Kx C selectInt__10NISEL_IMPLFiPUiPUc```@c |aA!|4{z$~!A,A8,|$@Ab84;#|$@A;#K` 8bX9_80cgc(8c <|ҪK]`8K `,A,@KM`88} K`bX808cfcKy`K`,Ah x$88!8c}#.|w|8!AaN 88!}|8K,AKd,@|@KKA`" 8bX9_80cg`89Đc <|ҪK`8K`K| A d/listInsert__10NISEL_IMPLFPQ2_10NISEL_IMPL4LISTs,,@84<>8`N <8>8`N @8startLoop__10NISEL_IMPLFv`||#x`~|v`!A8p|8A(`!~ccc9xAc@ l| LN!A(|`,@},@ax,#@,?Ap|c#x`8!}N Anext__10NISEL_IMPLFPUcN21PiPPCv|``aA``!`aa6e| EN!A(,A(88x$|p|xEx.|(P$|wa88cFh| HN!A(,A|~,,AA8PX8`cKa``g;08("c8zp8 99)<\K9-`b@,@DK5`"8{8i K`"c8`Ke`K`8`8!}!AaN 8P8`XK``g;08(bc8g8 99;\K8Y`@,@pKa`8{ 8iK`bX8c<bcK`K`,@K `8{ 8oK`bXcKӍ``dcxe| EN!A(K]`K,9@bc|9@,>Abc|`8|t8x,=A,bc|`8|t8x|xx },<A,bc|`8|t8x|xx |,;AT|xxf cH,&@b@,@hcccccgcHbA@ l| LN!A(|c8!}!KKm`" 8bX808cK`8K`cccccgcHbKT8`8!}!K 8Kl88Hf| FN!A(K$, A$, "At,8@Hbc|9A88Hf| FN!A(Kc#cc8Ki`,@4Kbc|x|d9A8K`; ;K8`8Aah 8!N A +next2__10NISEL_IMPLFPUcN31PPC7SI_SOCKPiPPCv<,M x$8|*<,L >, L 4<8>N @HincNext__10NISEL_IMPLFv|,`fa``|!QA(A8bXT8`| @8b8{$|p|xEx.| Pc|$pAPe |@D8e$,#@\@,Af8@cHf| FN!A(,A8P,@8`XK``g9B0c8(8p8 99>JK2`b@,@`K`8~ 8K%`bX808@ccK`K`H|}8`XK%``g9B0c8(8px8 99>|JK1`b@,@4K`8~ 8K`bX808cccK!`KY`8`HxP,Af8PcHf| FN!A(,AD8P;0,@@8`XK)``g^c8(8p8 99<K0`,@K`8| 8K`bX8@ccK9`Kq`H|{8`XK~``g^c8(8 pax8 99<|K0e`,@Kq`8| 8 K`bX8ccgcK`K`8`HH8bc|x|d9A88`a}HȈ$, "@f8@cHf| FN!A(,AD8P;0,@@8`XK}e``g^c8(8'p8 99<K/5`,@ KA`8| 8(K`bX8@ccKu`K`H|{8`XK|``g^c8(8/pax8 99<|K.`,@K`8| 80K=`bX8ccgcK`K`8`H4bc|x|`9A8`~H ,$@f8TcHf| FN!A(,A`8P;0,@@8`XK{``g^c8(8Gp8 99<K-`,@dK`8| 8HK)`bX8@ccK`K`H$|{8`XK{-``g^c8(8Opax8 99<|K,`,@DK`8| 8PK`bX8ccgcK5`Km`8`8!}aHbc|d9A`|xbc|`xHD``cK_e`,|`A$a`8!}N 8`a}8!N 8P8`XKy``g;08(c8p8 99<]K+`,b@AL,@xK`8| 8K=`bX8ccK`K`H8,A0Ke`bX88cK)`K`8`8!}aN AgetMode__10NISEL_IMPLFiPUc|,`~a``|!QA(A8bXT8`| @8b8{$|p|xEx.| Pc$pA| |@8|$,#@Ę@,A~8@cPf| FN!A(,A8P;0,@@8`XKw``g^c"8(8p8 99)0K)`,@HK`"88i K!`bX"c8hcK`K`8`8!}aN |{8`XKv``g^c8(8pax8 99<K(`,@DK`8| 8Ke`bX8ccgcK`K=`8`8!}aKD},#@P,A~8PcPf| FN!A(,AT8P;0,@@8`XKu``g^c8(8p8 99<0K'`,@tK`8| 8KQ`bX8hccK`K-`K4|{8`XKuU``g^c8(8pax8 99<K'!`,@K-`8| 8K`bX8ccgcK]`K`8`8!}aKX}|x|9A8`}T`>8`|#x`|(8K<8`K$, "A4,$@~8TcPf| FN!A(,AT8P;0,@@8`XKs``g^c8(8p8 99<0K%`,@K`8| 8Ka`bX8hccK`K=`KD|{8`XKse``g^c8(8pax8 99<K%1`,@K=`8| 8K`bX8ccgcKm`K`8`8!}aKhbc|e9A(|xd|ex|xx` KcccKYA`,@08`|#x`|(8K|c8!}aK~8@cPf| FN!A(,A<8P;0,@@8`XKq``g^c8(8p8 99<0K#`,@\K`8| 8K9`bX8hccK`K`K|{8`XKq=``g^c8(8pax8 99<K# `,@K`8| 8K`bX8ccgcKE`K}`8`8!}aK@8P8`XKp``g;08(c8tp8 99<]K"Y`,b@AL,@ KY`8| 8tK`bX8ccKM`K`K,AK`bX88cK`K`K A getStat__10NISEL_IMPLFiPUcc!|A(Xd| DN!A(Tc>8!p}N AHgetMaxSockNo__10NISEL_IMPLFv|!,`eA(A8bXT8`|0@8b8x$|p|xEcx.|0P|$pAlf | @`$, A$, "@@e8@`e| EN!A(Tc>8!p}N ,$@@e8T`e| EN!A(Tc>8!p}N `KVQ`Tc>8!p}N @,@\P,@$, "@|K8!p}N e8@`e| EN!A(Tc>8!p}N 8`8!pN AisMember__10NISEL_IMPLFi|,`~a``|!QA(A 8bXT8`| @8b8{$|p|xEx.| Pc$pAĀ| |@8|$,#@@,A~8@chf| FN!A(,A8P,@8`XKk``g9B0c8(8Zp8 99>XJK`b@,@DKz`8~ 8[KI`bX808ccK`K{!`8`8!}aN |}8`XKk%``g9B0c8(8bpx8 99>JK`b@,@HKy`8~ 8cK~`bX808cccK!`KzY`8`8!}aK8, @P,A~8Pchf| FN!A(,AT8P;0,@@8`XKj``g^c8(8up8 99<XK`,@hKx`8| 8vK}m`bX8ccK~`KyI`K(|{8`XKiq``g^c8(8}pax8 99<K=`,@KxI`8| 8~K|`bX8ccgcK}y`Kx`8`8!}aKX8`8!}aKx8K@$~, "h@|8@cf| FN!A(,A8P;0,@@8`XKhE``g^c8(8p8 99<XK`,@Kw!`8| 8K{`bX8ccK|U`Kw`Kl|{8`XKg``g^c8(8pax8 99<K`,@Kv`8| 8K{`bX8ccgcK{`Kv`8`8!}aK8Tcf| FN!A(,A 8P;0,@@8`XKf``g^c8(8p8 99<XK`,@4Ku`8| 8Kz9`bX8ccKz`Kv`K|{8`XKf=``g^c8(8pax8 99<K `,@hKu`8| 8Ky`bX8ccgcKzE`Ku}`8`8!}aK$8P8`XKe``g;08(c8Gp8 99<]KY`,b@AL,@KtY`8| 8GKx`bX8ccKM`Kt`K,AKt`bX88cK~`Kt`Kl A getData__10NISEL_IMPLFiPPCv|,`~a`|!AA(A8bXT8`| @8b8{$|p|xEx. P|$pAd |@$, @@,A~8@pf| FN!A(,A8P;0,@@8`XKc``g^c"8(8p8 99)XKU`,@HKra`"88i Kv`bX"c8cKw`Kr`8`8!}aN |{8`XKb``g^c8(8pax8 99<K`,@DKq`8| 8Kv1`bX8$ccgcKv`Kr `8`8!}aKD|P,A~8Ppf| FN!A(,AT8P;0,@@8`XKa``g^c8(8p8 99<XK`,@|Kp`8| 8Ku%`bX8ccKu`Kq`K<|{8`XKa)``g^c8(8pax8 99<K`,@Kp`8| 8Kt`bX8$ccgcKu1`Kpi`8`8!}aK`8`8!}aK$~, "p@|8@f| FN!A(,A8P;0,@@8`XK```g^c8(8 p8 99<XK`,@Kn`8| 8Ksq`bX8ccKt`KoM`K|{8`XK_u``g^c8(8pax8 99<KA`,@KnM`8| 8Kr`bX8$ccgcKs}`Kn`8`8!}aK8Tf| FN!A(,A(8P;0,@@8`XK^``g^c8(8(p8 99<XK]`,@PKmi`8| 8)Kq`bX8ccKr`Km`K|{8`XK]``g^c8(80pax8 99<K`,@xKl`8| 81Kqe`bX8$ccgcKr`Km=`8`8!}aK48P8`XK]M``g;08(c8p8 99<]K`,b@AL,@Kl`8| 8Kp`bX8ccK `Kl`K,AKk`bX88cKv`KlM`K AsetData__10NISEL_IMPLFiPCv|`8`c!QA(8KA(,>9@b24, :?4,Ab@,@K[}`8 8~ K` `bX808,c4:K``K[`848(, A88`9`! ;|}.8c(|@A8!}N 848K8, Ab@,@K A\*resetMsg__Q2_10NISEL_IMPL13CB_FUNCS_IMPLFvcTN @ ,selectMsg__Q2_10NISEL_IMPL13CB_FUNCS_IMPLFUi|,|!qxAx$8 ||axKeA(|,A8bXcTc8`d| @t8b8x$|p|xEcx.|(P"$pcAD |@8;$(88(+@@@,#A,#"A,#4@Pax8KＱA(,>AcxcK6`8!}N ax8KeA(8!}N ax8 K9A(Kax8K!A(Ktax8K A(K\ax8KA(K@ax8KA(K(ax8K﻽A(8!}N `8KﻑA(8!}N A84dumpEntryMsg__Q2_10NISEL_IMPL13CB_FUNCS_IMPLFP4FILEic\N @getError__10NISEL_IMPLFv0cKD0cK\0cK40cKl0cKD0cK|0cK489`8b`8h9;@8p8x;8Ԁ9"Ԉ9BԐd N @ho__sinit80000000_x_2fsapmnt_2fis0174_2fa_2f722_5fEXT_5fREL_2frs6000_5f64_2fgenopt_2fkrn_2fsi_2fsixxsel_2ecpp__Fv|`8`T>!qA(H|}y8Acce| EN!A(,@(8!8`}N 8|c8f| FN!A(c8!}N 8`8!}N A SiSelNewSet|;;Ԙ88!AaA(8`xKAyA(ap,#@@`,A c8!}N KS`8a8~ KXI`bX8cKX`KT)`c8!}N 8{H {py@b@,@`Kxce| EN!A(,A,c88f| FN!A(;8!c}K (AxcreateSet__10SISEL_IMPLFPUc8,$@ 8`N H+d @ SiSelDestroySet|!T>8A(h| HN!A(|c8!p}N ALSiSelSet|!T>8A(h| HN!A(|c8!p}N AL SiSelSetAbs|!T>A(f| FN!A(|c8!p}N AH SiSelClear|!A(d| DN!A(|c8!p}N AD SiSelClearSet|!8A( f| FN!A(|c8!p}N AH SiSelRemove|!A((d| DN!A(|c8!p}N ADSiSelRemoveAll|!|A(0f| FN!A(|c8!p}N AH SiSelSelect|!A(8d| DN!A(|c8!p}N ADSiSelStartLoop|#!A()@ i| IN!A(|c8!p}N AD SiSelNext|!A(Hf| FN!A(|c8!p}N AD SiSelMode|!A(Pf| FN!A(|c8!p}N AD SiSelStat|!A(Xd| DN!A(Tc>8!p}N AD getMaxSockNo|!A(`e| EN!A(Tc>8!p}N ADisMember|!A(hf| FN!A(|c8!p}N ADgetData|!A(pf| FN!A(|c8!p}N ADsetData|!A(xe| EN!A(8!p}N A@dump8X8N @__ct__5SISELFv`8bX|x!8@cx8!N cK6A(c8!}N A\__dt__5SISELFvN @1regCBFunc__10SISEL_SPECFPQ2_10SISEL_SPEC8CB_FUNCS|!`eK88`88!p}N A<__ct__10SISEL_SPECFv|``8888!Kq{@c8!}H cK5-A(c8!}N Ax__dt__10SISEL_SPECFv|!`eK8٠8`88!p}N A<__ct__10SISEL_IMPLFvc!T>|A(e| EN!A(|c8!p}N ALinit__10SISEL_IMPLFUic!T>|A(T>h| HN!A(|c8!p}N AP#set__10SISEL_IMPLFPC7SI_SOCKUcPCvT2c!T>|A(f| FN!A(|c8!p}N AL clear__10SISEL_IMPLFPC7SI_SOCKUcc!|A(d| DN!A(|c8!p}N AHclearSet__10SISEL_IMPLFvc!T>|A( f| FN!A(|c8!p}N AL!remove__10SISEL_IMPLFPC7SI_SOCKUcc!|A((d| DN!A(|c8!p}N AHremoveAll__10SISEL_IMPLFvc|!|A(0f| FN!A(|c8!p}N ALselect__10SISEL_IMPLFiPUic!|A(8d| DN!A(|c8!p}N AHstartLoop__10SISEL_IMPLFvc!|A(#)@ i| IN!A(|c8!p}N AH(next__10SISEL_IMPLFPUcN21PPC7SI_SOCKPPCvc!|A(Hf| FN!A(|c8!p}N AH#getMode__10SISEL_IMPLFPC7SI_SOCKPUcc!|A(Pf| FN!A(|c8!p}N AH#getStat__10SISEL_IMPLFPC7SI_SOCKPUcc!|A(Xd| DN!A(Tc>8!p}N AHgetMaxSockNo__10SISEL_IMPLFvc!|A(`e| EN!A(Tc>8!p}N AH!isMember__10SISEL_IMPLFPC7SI_SOCKc!|A(hf| FN!A(|c8!p}N AH$getData__10SISEL_IMPLFPC7SI_SOCKPPCvc!|A(pf| FN!A(|c8!p}N AH#setData__10SISEL_IMPLFPC7SI_SOCKPCvc!|A(xe| EN!A(8!p}N ADdump__10SISEL_IMPLFP4FILE|`|#y;Ԙ8!!a8}aAt, A, A, Atb@,@DK=`8<8 KBa`bX8xcKC`K>=`8`8!}N b8caA(!1A(@b@,@TK7` 8bX98Ԙca8cKBa`8K8`8`8!}N 8;@|`(||(x|xHKA(,# @b@,@HK6`88~ K;`bX8Ԙ8cK<)`K7a`8`8!}AaN x.x$|` PK=A(0,#@\b@,@K6Y`88~ K:`bX8Ԙ8cK;`K6`K\88`88  H``|b@,@ cKuA(,#@@Xb@,@K5`8~ 8K:!`bX8ԘW>88Ԙ8cK>M`[K4`K Ainit__10SISEL_POLLFUi|``aA`T>!!AcP8pA(H%`,A8Prb@c8c(|c"@,<@ 8 @bHc|x@bPc|x@bXc|x,@48!8`}!AaN K2`8 XHPbX8Ԙ%c|9|@8|H8,/'A9-@h8-@D9 w8LK!cP!18pA(H]`,@b@,@$8!8`}N K']`bX8Ԙ8tc0K2`K'`8`8!}KPr8(e"H`,A@,@L|K&`8O8~ K+a`bX8Ԙ8cc0K,`K'9`8`8!}aN  \|ey|P8|t%W$>A`e| EN!A(8|@@b@,@88`8!}!AaN K%` 8bXc8Ԙ80c0K0i`8K&`8`8!}K88b@{&.{(H8|.h0P0|*,@t,=A$088|!*0|8K xx !*K `|@@cH8`8!}KK$` 8bXc8Ԙ8Tc0K/]`8K% `KD`KH "A!remove__10SISEL_POLLFPC7SI_SOCKUc`;@c|aA!8cT|>!1,A(@8;bԘBX; `:(|@@0{.{$|P|(*, A<````!8T>|@@x.xH| P|(*, @@{.{$|P|(*, @8```!8T>|@@x.xH| P| *, A@p|`yA,ccf| FN!A({.{$0{.{$|(P|P}2}#:8p|8*)|1*( | *|*P |"H)`,APrH`,@P 8p|`H `,@p,@8|8T|>T>K\K!` z8ccK,`b #K"i`88|T>T|>K |~,@@K!`c88 K&-`z8cK&`K" `8`8!}!AaN |,@K!`c88~ K%`z8cK&M`K!`Kx,@lK `c8z8~ K%Y`z 8t|ƲK%`K!5`K(|@Ad8|@AX,@LK e`c88} K$`z8ccK%`K `88`8!}8KK`bX8Ԙ8cK*`K m`K A `optimizeSet__10SISEL_POLLFv|`c|`y!A(A d| DN!A(8P`(He`,A@,@h|K`88~ K#`bX8Ԙ8tcc8K$-`Ke`8`8!}N 8`8!}N H 9P888HQ`,@8b@8,@8!8`}N K1` 8bX8Ԙ8c8K(`8K`8`8!}N @,@ |K`88~ K"M`bX8Ԙ8|cc8K"`K%`8`8!}K8P`(H`,AK, ADremoveAll__10SISEL_POLLFv`|aA`|!@8!Q(,@@;`````! c8t8pK-`,A, ;[`y@W[>(A,;AX,@KM`88| K `bX8ԘF88c@K!u`K`,À,@K`88 K }`X8bԘ8x8r@cK5``gc8 ccK `K1`8`8!}!AaN 8`8!}!AaK, @,@0,=@ 8`Kt8`8!}K|K`bX8Ԙt8(c@K%`Ka`,=At8`8!}K ,A\KczW`?A|K$Ky`b 8bXc8Ԙ8c@K%)`8K`K| Aselect__10SISEL_POLLFiPUi8@(,@ 8`N H @$startLoop__10SISEL_POLLFv`,(|aA`~`!`aA!xp8!xA(Ac(|@@;@,AA{w${c.H"@~P:;ԘX:bPXB```!~ :;|c.,#A(x~0|*~0|*>(~|`yA(cd(e| EN!A(~ `|c.|`9@h|` 9@Lp|` 9@Ԡ,=|8|t8x@xx gA~ ,<|c.|8|t8x@xx }A,~ |c.|8|t8x@xx |,@ ,:AV;>::|@::A, @b@,@l88`0`8! }(px!Aa!AaN K` 8bX8Ԙ8cPK!y`8K)`KP8`08! }px!KXKY` 9@oPF }}&.|H8|H8|H9,/$Ah@X9-@49 -8`cg9@wK `8b Ky`K\9 p8`cg9@wK `K9r@K@X9-@49 -8`cg9@-K i`8b K`K9 p8`cg9@-K 9`K9r@K,<AK,@8`08! }KK` {g$oP8|:K`K`8`08! }K,@8`08! }KK` {g$oP8|:Ki`K!`8`08! }KT,@PKY`8 {g$oP8Ԑ |:K `8b K`8`08! }px!K{w${c.H"@~P:;ԘX:bPXB``!~ :;|c.,#A~0|*>(~|`yA(cd(e| EN!A(~ `|c.|`9@h|` 9@lp|` 9@,=|8|t8x@xx gA~ ,<|c.|8|t8x@xx }A,~ |c.|8|t8x@xx |,@,,:AV;>::|@:@(KKm` 9@oPF }}&.|H8|H8|H9,/$Ad@T9-@09 -8`cg9@wK`b K`KT9 p8`cg9@wK`K9r@K@T9-@09 -8`cg9@-K`b K1`K9 p8`cg9@-KU`K9r@K,<AKA{w${c."@;Ԙ~P:XBP::`X"```!~ :|c.,#Ax~0|*~0|*(~|`yA(cd(e| EN!A(~ `|c.|9@4h|9@p|9@D,=A$|8|t8x@xx },<A,~ |c.|8|t8x@xx |,@0,:AV>::|@::@KK` BH9`oPf }}&.|H8|H8|H9,/$Ad@T9-@09 -8`cg9@wKU`b cK`KL9 p8`cg9@wK)`K9r@K@T9-@09 -8`cg9@-K`b cK`K9 p8`cg9@-K`K9r@K{w${c."@;Ԙ~P:XBP:`HX"````!~ :|c.,#A~0|*(~|`yA(cd(e| EN!A(~ `|c.|9@h|9@Lp|9@,=A$|8|t8x@xx },<A,~ |c.|8|t8x@xx |,@,,:A V>::|@:@4KK y` 9@oPF }}&.|H8|H8|H9,/$Ad@T9-@09 -8`cg9@wK`b cK `KT9 p8`cg9@wK`K9r@K@T9-@09 -8`cg9@-K`b cK =`K9 p8`cg9@-Ka`K9r@K A (next__10SISEL_POLLFPUcN21PPC7SI_SOCKPPCv|``cP`!q8pH`,AP8`HrP8(|*}|"|8|t8x`|09@`XT>`| 9@$8!}N 8!}N T>X`| 9@Kb@,@8`8!}KK `bX8Ԙ8tcXK`K Y`8`8!}N A#getMode__10SISEL_POLLFPC7SI_SOCKPUc|``cP`!q8pH`,AP8`HrP8(|*}|"|8|t8x`|09@XT>`|89@Hb@,@8`8!}HK e`bX8Ԙ8tc`K!`K `8`8!}N T>X`|89@(T>``@|89@DH$T>``@|89@ h| 9@4H `h| 9@p| 9A `8!}N A#getStat__10SISEL_POLLFPC7SI_SOCKPUc|``a``cP`!a8pH`,AP8`HrP8(|*}|"|8|t8x`|09@dXT>`|89@$T>``@|89@h|09@p|09@ 0,;| P|t|x.xH|8P|0*A,0| P|t8|x.xH|(P|8*8!}aN ` ,;0| P|t|x.xH|8P|0*AK|`h|09@KT>``@|89@KT>X`|89@Kb@,@8`8!}K$K`bX8Ԙ8tchKm`K%`8`8!}aK A4getStatEx__10SISEL_POLLFPC7SI_SOCKPUcPPC7SI_SOCKPPCvcN @getMaxSockNo__10SISEL_POLLFv|cP!8pHm`8|48T8!}N A<!isMember__10SISEL_POLLFPC7SI_SOCK|``cP`!q8pH`,@b@,@$8`8!}N K`bX8Ԙ8tcpK`KI`8`8!}N Pr8`0 88(|*|"| P|t|x.xH| P|8*KD A$getData__10SISEL_POLLFPC7SI_SOCKPPCv|``cP`!q8pHu`,@b@,@$8`8!}N Ku`bX8Ԙ8tcxK 1`K`8`8!}N Pr8`0 88(|*|"| P|t|x.xH| P9*KH A #setData__10SISEL_POLLFPC7SI_SOCKPCv|``aAc!aA!xp!A(8 KdA(8 (*aKdA(a8 xKdA(a8 KdA(|`yA,80f| FN!A(a8 Kd]A(,Ax, Al;;;`;@; ;:```!::`0 P8|~F*~&*H`, A,P8(|*|"|P|t~`0|*, A0|Px||t~",A|@:|.bH9-}C~F~'~~i|(9A9iP8-l~k(9A8pbXK9`-~L(9A9`o}.:-|`9A:i~c`9:`-A:`p~C`9:@-A:@op: -d|c`9A: Ehp:-|c`9A:H`o9-|c`9A9N8 pxbaaaA!Kb]A(|`yA,b0f| FN!A(a8 KbA(8;8c|@@(:;;9;Z|@;{;Aa8 KaA(8,=A`!0a8 0|Px||t|*|KaA(,=@a8 KaqA(8!}px!Aa!AaN a8 (Ka A(8!}px!K Apdump__10SISEL_POLLFP4FILE|@@c xH|c"N 8`N @$getSocketNo__10SISEL_POLLFUi|``cP`!q8pH`,@b@,@$8`8!}N K`bX8Ԙ8tcK`K`8`8!}N Pr8` 8(|*|"| P|t|K\ A(getSocketPos__10SISEL_POLLFPC7SI_SOCKPUi|``8b@!q8P,#@H,#AH`@KA( ,#@0,#@pc88KA{@(c8!}N cKA(c8!}KKIA(c88K{@KK%A(0,#A`K@K A( ,#@K4HI`,A\@,@L|}K`88| Kq`bX8Ԙ8tccK`KI`H,#@Kp A__dt__10SISEL_POLLFv|`T>aA(!@!!A(@,@TK` 8bX98Ԙca8cK`8Ki`8`8!}N 8;||x|x||H}A(,@,@HK]`88~ K`bX8Ԙ8 4cK` `K`8`8!}!AaN x.x$|dKA(?,#}@X,@K`88~ K=`bX8Ԙ8cK_]`K`KTx.x$|H`x$K_!A(,#}@`,@K)`88~ K`bX8Ԙ8 Xx$|cK^`K`K88`88 | aaHս``z,@cCKAA(,#}0@T,@LKa`8| 8 K`bX8ԘWF>88Ԙ8cK!`K`K A8init__11SISEL_EPOLLFUi|}&aA`?C!`T>`T>!z@8pA(H5`.`wAtz@rb@c8c(|c"%y|A,@LK%`8]8 K`bX8Ԙ8 lcKM`K`8` 8!|} !AaN ;BԘ,<@ 8~ @`@`@`8|48T@{$M8 $*88H5A(,AAb,@bX,@DK`B 8b{c8 (K`8KA`{K05``dcxe| EN!A(;`,AAPcc |8!} !AaN cc8 f| FN!A(Kcc8 f| FN!A(cccch| HN!A(|c 8!|} K$,@PbcKI`B8 8z K`bX8 bbcgcKu`K`;`K,@,@8` |KK` 8bX8-9-cpT (A8rTz(@xA<9 w8LKQ`8K`8` |K9 -8LK`8K`8` |K9pA9 w8LK`KK` 8bX,68cA88A`8 cc(K`8K1`K:M8x8xz|HA(,A\b,, @AX,AK-` 8bXcc(88 cK`K`KK` 8bXbc8 cK`KI`Kh,@P@\K` 8bXbc8 ԐcKA`K`K@KA`8 8u K`bX8 b8bcKm`K`KԀK8tccHA,@tb@z;BԘx.x$|#*,@8|`yAte| EN!A(KKu` 8bXt8(cK%`8K`K A8!|} N C $set__11SISEL_EPOLLFPC7SI_SOCKUcPCvT2|``!q,AX|@Axb@,@LKY` 8bX8Ԙ8cK `8K`8`8!}N `' c@HA`,Ax@,@L|K]`8 8~ K`bX8Ԙ8ccK`K`8`8!}N 8`8!}N | @@(8x.x$}"|BKb@,@dK`8 8~ K%`bX8Ԙ8܀cK`K`8`8!}K88`8!N b@,@PK` 8bX8Ԙ8cK`8Ku`K8`8!N A#add__11SISEL_EPOLLFPC7SI_SOCKPCvPUi|}&aA`},!`|``!1|NA(@{c$8 *H,@88p8prtcHA(,Ab@D, ,@X@K`B 8bXcf8 cKM`8K`b@H,@X@K=`B 8bXcf8 ԐcK`8K`b@HX@K`"8 8y Ku`bX8 8cGcK`KM`H`b@,APK`B 8bXcfc88 cK=`8K`x8x8z|}H QA(,A,,@b, @lb@,@K` 8bXcf8 cK`8KU`b@,A4H,@lb@,@K` 8bXcf8 ԐcK5`8K`b@,AHL,@b,@b@,@HK` 8bXcf8 (cK`8Ke`bXcK#U``dcxe| EN!A(8`8!|} Hb@,@PbKQ`8 8~ K`bX8 cccK}`K`8`8!|} Hb@,AxK` 8bX,,8cA88A`8A`8 cfcKe`8K`8`8!|} !AaN C0;modifyEpollFD__11SISEL_EPOLLFPCQ2_11SISEL_EPOLL5FD_ELiT2PCc|`?aA``!!1}@8pA(H5`,@lb@,A8KU`bX8Ԙ8tcK`K`8`8!}N @rd8(|*"|Ab@,@LK`88 KM`bX8Ԙ8 lcK`K!`8`8!}N  @8cT<|!.@8`|8@8`|8;bԘ;@8x8Axz|HA(,Ab@$, ,@T@K`" 8bXbc8 cKm`YK!`b@H,@T@Ka`" 8bXbc8 ԐcK`YK`b@HX@K`8 8x K`bX8 b8c'cK=`Ku`H\b@,ALK߹`" 8bXcc88 cKe`YK`888HyA(@,A$b,,@@DK!` 8bXbc8 (cK`^K߉`bXcKy``dcxe| EN!A(8`8!}!AH@HKށ`8 8 K `bX8 b8ccK`K`8`8!}!AH(,ALK` 8bXcc88 cK`_Kq`b@,AKݹ` 8bX8-9-cpT (A8rTz(@ A4H 9pA(9 w8LK-`_K`H$9 -8LK `_Kݽ`8`8!}!AaN A !clear__11SISEL_EPOLLFPC7SI_SOCKUc`|aA!aA!xp!, A(Ad;@?#b;:BX:: 9 `!y|.,$@;:(:(;(|@Ab@,@`8` 8!}px!Aa!AaN Km` 8bX8Ԙ8cK!`8K`K`88Ԙ88p8|.y~c~#pr!tHA(,A\,, @AX`e| EN!A(~(``,#A0:````!| @A`wc |`y@:Ԙ8|@@8@ 8,@88`; 8x8|*z!xz|HA(,A(b@,, @@A,@b@,@D8`8!}!AaN K` 8bXc8TcKީ`?K]`K|Kӱ` 8bXccH88 cK]`?K`K Ke` 8bXcc8 cK`?K`b@K,@T@K ` 8bXcc8 ԐcK`?Ku`b@KtA8`8!}KKҩ`b8 8c K5`bXc8c8 cK`K `8`8!}K(b@KKA` 8bXc80cK`8Kҡ`K8 b@ ^ ,AK` 8bXc8TcK܉`8K9`Kb@:Ԙ,@ ,7 @ (Kt KlK]` 8bX(78ԐcA88 K`8Kѱ`K`K A "remove__11SISEL_EPOLLFPC7SI_SOCKUc|`|c!q|`yA(A0 d| DN!A(8? (|HA(@,@P,@DK9`8g8} K`bX8Ԙ8 cK7`KС`|HA(|,Ax.x$|H`@H`,A,@p|Kϡ`88~ K-`bX8Ԙ8tccK`K`8`8!}N 8`8!}K89@888H`,Al,@|K`88~ Ki`bX8Ԙ8|ccK `KA`8`8!}K`,@8`8!}KKe` 8bX8Ԙ8cK`8K`8`8!}KĀ,@lK`8u8 K}`bX8Ԙ8 4cK5`KU`8`8!}KP8`8!}K,8? (|HA(@,@DK AremoveAll__11SISEL_EPOLLFv`?b@|aA`;!`aA!!~,@t~(8;@,#(A$8``!`dc |`y @; ````!:cdcHA(`u,Tt>A,A~, @:YVY>(A,9A\b@,@LK`"88y Ke`bX8Ԙ~F88cK`K9`,6Ab@,@lKy`88 K`X8Ԙ8pc8KX``g8 cccKЁ`K˹`8`8!}Aa!AaN |@@`b@,@Kʩ`88~ K5`bX8Ԙ8 bfcK`K `KP, @b@,@,4A ; ";``!{@ x$|x$~*, @|b@,@@K`8y 8 K΁`bX8Ԙ8 cK.`K]`;Z|:@A,=A8`8!}K , ATb@,@Km`8y 8 K`bX8Ԙ8 K8,,+@:A<: K4:@:@K A: KK%`B 8bX8Ԙ8cK`8Kȅ`KH A(select__11SISEL_EPOLLFiPUi8`N @startLoop__11SISEL_EPOLLFv`}Cy|aA`}`!``aA!x8!A(A?#(,A@:,ATA:Ԙ:`:@X 4 `! (8x,# @,@e| EN!A(T>|` AAA@T,;~xxv A,:T~xxv AT~xxv ,@,6AKhKĥ`pؒO|PpT xTz(+||&t|BT>@x9-@T9 -A(8`9@wK`b cK`Kt8`9@-K`b cKĩ`KP9 pA8`9@wK`K9r@K,:AK,@8`8!}KKé`p8Km`K%`8`8!}Kd,@8`8!}KDKI`p8K `K`8`8!}K,@8`8!}KK`p8 Kͭ`Ke`8`8!}K:Ԙ::`XB > ```! (8x,# @X,@e| EN!A(T>|` AAHAT,;~xxv A,:T~xxv AT~xxv ,@,6A8K,KI`rp|PpxT (Tz+||&t|BT>@p9-@L9 -A$8`9@wK`Ku`Kx8`9@-Kˡ`KU`KX9 pA8`9@wKy`K9r@K,:AKA:Ԙ::`XB < `! (8x,# @X,@e| EN!A(T>|` AtAA,;AT~xxv ,:AT~xxv ,@,6AK8K%`rp|PpxT (Tz+||&t|BT>@p9-@L9 -A$8`9@wKɝ`KQ`Kx8`9@-K}`K1`KX9 pA8`9@wKU`K9r@K:Ԙ;:Xb ^ ````! (8x,# @X,@e| EN!A(T>|` A\AA,;AT~xxv ,:AT~xxv ,@,6AK@K `p|PpxT (Tz+||&t|BT>@p9-@L9 -A$8`9@wKDž`K9`Kx8`9@-Ke`K`KX9 pA8`9@wK=`K9r@K A )next__11SISEL_EPOLLFPUcN21PPC7SI_SOCKPPCv|`?`!q~@8pH`,A ~@rc8c(|c"~|Ab@,@lK`8 8} K`bX8Ԙ8 lcK`K`8`8!}N 8`8!}N 8`}T|TT8xx T|xKb@,@8`8!}KlK`bX8Ԙ8tcKU`K `8`8!}N A$getMode__11SISEL_EPOLLFPC7SI_SOCKPUc|`?`!q~@8pH`,AH~@rc8c(|c"~|Ab@,A8`Hb@,@8`8!}HK]`bX8Ԙ8tcK`K`8`8!}N K `8 8} K`bX8Ԙ8 lcK1`Ki`8`8!}N 8T|`T`T8x`x T|dx~x Tc>|` @tb@c,@K=`8 8 K`bX8Ԙ8 cKi`K``@}x` T>|` @`HA8`8!}N `@}x` T>|` @K Ax$getStat__11SISEL_EPOLLFPC7SI_SOCKPUc|?`aA``!`!Q|@8pH`,AH|@rc8c(c"<y|Ab@,A8`Hb@,@,A8!8`}N Kq`bX8Ԙ8tcK-`K`8`A8!}N K`8 +8 K`bX8Ԙ8 lcK=`Ku`8`8!}!AaH8T|`T`T8x`x T|dxyx Tc>|` @tb@c,@KE`B8 A8z K`bX8Ԙ8 cKq`K``@yx Tc>|` AlAh|*,=Ap8`8!}!AaN `@yx Tc>|` @`,=|*@8`K A5getStatEx__11SISEL_EPOLLFPC7SI_SOCKPUcPPC7SI_SOCKPPCvcN @getMaxSockNo__11SISEL_EPOLLFv|!;Ԉ|!q|@A(@b@,@pK}` 8bXc8Ԙ8c K)`8K`8`8!}N 8`x8!N 888 ` `$K(`8 K(`8 K(`x.x$|` PKLmA(`(,#@b@,@hK`8 m8 K`bX8Ԙ8c K`K`8`8!}N 8`8!}N x.x$|(PH`,#AHe| EN!A(8`8!}N 8`8!}N ADinit__12SISEL_SELECTFUi|}&aA``!`T>!Q,A(A@8bԈ|@0`(x.x$| P|8*, @| @Ab@,@LK` 8bX8Ԙ8c(KM`8K`8`p8!}N {.{$|(P``8}P`!*`(8c|A*`"|&A `(T(4T88c| P#.`"`(88|#.`(|+.`"8c|@A 8b@,@|`yA(ce| EN!A(,=@ N@(@ @ NAAA,@@8`8!|} !AaN K` 8Xc8 8Ԙ(xK&`Tz>c8 K%`Ty>c8 K%`T`>,:,/9@p9-@\8r@9pcccf9 w8LK!`8K`8`8!|} K 8-@K9-@\8r@9pcccf9 -8LK`8Ke`8`8!|} K8-@K8 cK$-`K\8 cK$`AKD8 cK$`AAK(8 cK$E`K8 cK$1`@K8 cK$`@@KK`B 8bX8Ԙ8 ܐc(K`8Ke`K4b@K\b@,@PK` 8bX8Ԙ8Ԉ8 c(KI`8K`8`p8!}K C %set__12SISEL_SELECTFPC7SI_SOCKUcPCvT2|}&aA`!`!Q,A`8bԈc|@`(x.x$| P|0*, @xb@,ATKa`bX8Ԙ8tc0K`K`8`!x8!}N 8`!x8!N | NA@8 c#K!`Ab@,ALK`8 X8 8Ԙc#0K!`T{>8 c#K!`Tz>c#8 K!`T`>,;,/:@9-@|8r@9pccc9 w8LK `8b K`8`8!|} !AaN 8-AK9-@8r@X9pccc9 -8LK}`8b K)`8`8!|} Ktccc9 -8LK-`8b K`8`8!|} K$8-@9pKT8 c#K`b@,AhKAK8 c#K`AAKb@,@K` 8bX8Ԙ8Ԉ8 c0KU`8K`8`!x8!}K0b@,@K C"clear__12SISEL_SELECTFPC7SI_SOCKUc|`8c !K `8 K`8 K`b@,@8`8!}HXK` 8bX8Ԙ8c8K9`8K`8`8!}N AclearSet__12SISEL_SELECTFv|`T>aA`!a,A(A8bԈc|@`(x.x$| P|(*, @b@,@$8`Ap8!}N KE`bX8Ԙ8tc@K`K`8`Ap8!}K8|`yA(ce| EN!A(`({.{$P;`|c`|&@h`"`(|dc|#A8Te(4Tc8|(P|+.,>A0` W>| @ `(T(4T88c| P|".` 8 cCK!`8 cCK`8 cCK`80 cCK`8@ cCK`8P cCK``(@c*,@08!8`}AaN K` 8bX8Ԙ8 c@K5`8K`8`8!}AKT(48cT8|(P|+.`(||%A8cT(4T8| P|#.Kb@,@pK` 8bX8Ԙ8Ԉ8 c@Ky`8K)`8`Ap8!}K A|#remove__12SISEL_SELECTFPC7SI_SOCKUc|`c|`y!A(A d| DN!A(888 ` `$K`8 K`8 K``(8Ԉx.x$|(PH`b@,@8`8!}N K]` 8bX8Ԙ8cHK`8K`8`8!}N 888 ` `$K)`8 K`8 K``(8Ԉx.x$|(PH`b@,A(K< AremoveAll__12SISEL_SELECTFv```b|a؀8d?!aTeT|@A`8 80 Ku`b8?TT|@A`8 8@ KA`b8?TT|@A`8 8P K ``"@` ,@p8p`!80 8@ 8P cg9p9!tK`Td>,A8,|4`|T~`$@},@HK` 8bX8Ԙ8cPK`8K}`p, @,@$8p8;,$A,@lK`8 8 K%`X8bԘ8x8vPcK``gc8ccK`K`8`8!}aN , @,@,>A pcKK`bX8Ԙp8(cPK`KI`KK`bX8Ԙ80cPK]`K`K,@,@ ;KHKM`bX8Ԙcf8TcPK `K`;K K` 8bXcf8Ԙ8cPK`8Kq`KL Aselect__12SISEL_SELECTFiPUi`"@` ,@ 8`N Hg @$startLoop__12SISEL_SELECTFv``|}&aA!`aaA|#y`!xp!A(A 8,A 8,A 8c` 8`;Al; A A,%A@:ԘX`!`({d.{f$| P888apt: 80 |*.` apt|Ke`T`>, @8`; : s8ap8@ K9`T`>, @8`; : r8ap8P K `T`>, @8`; ~,@|`yA(cd(e| EN!A(`({`.{d$|P,<|(*A`(|c*`$, A,9A@` |;@, @b@,@|8,<A8`0*8! |} px!Aa!AaN Km` 8bX8Ԙ8Аc`K!`8K`KDb8ap8K`,@,@DK`8 u8`bK`8b Ka`8`0*8! |} KK` 58ap980 `K`To>8ap8@ K`Tn>8ap8P K`T`>`$,#@h9W,/8rA8-,.9wA9-, 9 eA9 -b#8bbK`b : #K`KX9WK,1@K8@:ԘX```!`({d.{f$| P888apt: 80 |*.` apt|K`T`>, @8`; : s8ap8@ K`T`>, @8`; : r8ap8P Km`T`>, @: V >, @x,@|`yA(cd(e| EN!A(`({`.{d$|P,<|(*A`(|c*`$, A,9A` |;A`K8ap8KM`,A8ap8@ Ka`Tn>8ap8P KM`T`>`$,#@h9W,/8rA8-,.9wA9-, 9 eA9 -b#8bbKq`b : #K`K9WK,%AT@:ԘXb```!`({d.{f$| P888apt80 |*.` apt|K i`Te>8ap88@ |txтK I`T`>, @8`; : r8ap8P K `T`>, @8`; ~,@|`yA(cd(e| EN!A(`({`.{d$|P,<|(*A`(|c*`$, A,9AP` |;AKЈ8ap8K`,AKK` 58ap980 `K )`To>8ap8@ K `Tn>8ap8P K `T`>`$,#@h9W,/8rA8-,.9wA9-, 9 eA9 -b#8bbK%`b : #K`K9WK,1@Kx@;:ԘXb``!`({d.{f$| P888apt80 |*.` apt|K `Te>8ap88@ |txтK `T`>, @8`; : r8ap8P K `T`>, @: V >, @x,@|`yA(cd(e| EN!A(`({`.{d$|P,<|(*A`(|c*`$, A,9A` |;AK̈8ap8K`,AKK` 58ap80 `K `To>8ap8@ K `Tn>8ap8P K `T`>`$,#@h9W,/8rA8-,.9wA9-, 9 eA9 -b#8bbK`b : #K`K9WKA\@:ԘXB`!`({d.{f$| P888apt: 80 |*.` apt|K`T`>, @8`; : s8ap8@ K`T`>, @: V1>8ap8P K`T`>, @,>A8; ,@|`yA(cd(e| EN!A(`({`.{d$|P,<|(*A`(|c*`$, A,9A` |;AtK8ap8K a`,APKKM` 58ap980 `K`To>8ap8@ Ku`Tn>8ap8P Ka`T`>`$,#@h9W,/8rA8-,.9wA9-, 9 eA9 -b#8bbK`b : #K1`K9WK,1@Kx@:`:ԘXB``!`({d.{f$| P88t8ap80 |*.` apt|Ky`Tq>8ap8@ Ke`T`>,1. 8ap8P LBNBKA`T`>, @,>A8; ,@|`yA(cd(e| EN!A(`({`.{d$|P,<|(*A`(|c*`$, A,9Al` |;A0K܈8ap8K `,A KK ` 58ap80 `eKI`To>8ap8@ K5`Tn>8ap8P K!`T`>`$,#@h9W,/8rA8-,.9wA9-, 9 eA9 -b#8bbKE`b : #K`K9WK@K C*next__12SISEL_SELECTFPUcN21PPC7SI_SOCKPPCv|```!q,A48bԈc|@`(x.x$| P|(*, @b@,AXK~u`bX8Ԙ8tchK1`K~`8`8!}N 8`x8!N 8c8 KY`T`>, `@Иc8 K1`T`>, `@h~8 cK `T`>, `@~8`8!}KH8`8!}N 8 cK`T`>, `@~8`8!}K8 cKe`T`>, `@K4b@,@K|` 8bX8Ԙ8Ԉ8 chK}`8K}-`KDb@,@4K At%getMode__12SISEL_SELECTFPC7SI_SOCKPUc|```!a,A|8bԈc|@`(x.x$| P|(*, @b@,AXK{`bX8Ԙ8tcpKq`K|)`8`8!}N 8`8!N 8`$, @d8ap8pK`,`@@~8`8!}K8`8!}Kh80 cK-`T`>~, ``@c8P K`T`>, `@D~8@ cK`T`>, `@x~8`8!}Kܘ8@ cK`T`>, `@8~8`8!}K~8P cK]`T`>, `@KXb@,@PKy` 8bX8Ԙ8Ԉ8 cpKu`8Kz%`Kb@,@K A%getStat__12SISEL_SELECTFPC7SI_SOCKPUc|``a```!Q,A8bԈc|@ `(x.x$| P|(*, @b@,A`Kx`bX8Ԙ8tcxKa`Ky`8`8!}aN 8`a8!N 8`$, @8ap8pK`,`@@T~`(,<x.x$| P|(*A$`(x.x$|P|c*8`K,K80 ccK`T`>~, ``@cc8P K`T`>, `@4~8@ ccK`T`>, `@~K48@ ccKe`T`>, `@X~K~8P ccK5`T`>, `@Kxb@,@8Kv` 8bX8Ԙ8Ԉ8 cxKM`8Kv`Kb@,@K A6getStatEx__12SISEL_SELECTFPC7SI_SOCKPUcPPC7SI_SOCKPPCvcN @getMaxSockNo__12SISEL_SELECTFv,A88Ԉ| @(c`(x.x$| P|(*|t8xN 8`N @H#isMember__12SISEL_SELECTFPC7SI_SOCK|`!,A48Ԉ| @`(x.x$|` P||*, @tb@,ATKt`bX8Ԙ8tcKY`Ku`8`8!}N 8`x8!N 8`x8!N b@,@Kt` 8bX8Ԙ8Ԉ8 cK~`8Ktm`8`8!}K\b@,@8K Ah&getData__12SISEL_SELECTFPC7SI_SOCKPPCv|`!,A08Ԉ| @c`(x.x$|0P| *, @tb@,ATKr`bX8Ԙ8tcK}`KsU`8`8!}N 8`x8!N 88`x8!|!*N b@,@KrY` 8bX8Ԙ8Ԉ8 cK}`8Kr`8`8!}K\b@,@8K Ad%setData__12SISEL_SELECTFPC7SI_SOCKPCv``|aAc!aA!!A(8K A(`$9^, A9^` ;c|(@9?`"a8KԽA(a8 xKԭA(a8xKԝA(|`yA,80f| FN!A(a8 KYA(,AX;bԈ, A$;@````!`(|`|8@;|7@:8a8 Kq`Tt>8a8 K]`Ts>8a8 KI`Tr>8a80 K5`Tq>8a8@ K!`Tp>8a8P K `,48rT`>~~~A8-,39@wA9@-,29`eA9`-,19rA9-,0;wA;-, 8eA8-8pAxc%ac*aKA(|`yA,c%0f| FN!A(a8 KҕA(8;8c|@@;Z{|@AHP8!@}!Aa!AaN P8!@|aN P8!@}N Adump__12SISEL_SELECTFP4FILE8bԈ|@A 8`N |N @ getSocketNo__12SISEL_SELECTFUi|`!,A,8Ԉ| @c`(x.x$| P|c8*,#@tb@,ATKm`bX8Ԙ8tcKw`Kmu`8`8!}N 8`x8!N 8`x8!N b@,@Kl}` 8bX8Ԙ8Ԉ8 cKw%`8Kl`8`8!}K`b@,@!Q|@A(@b@,@PKju` 8bXc8Ԙ8cKu!`8Kj`8`8!}N ;;`|8 || x|` `8`(K`8 K `8 K``0, A8`88HH``}b@,@4cK9A(,#`H@b@,@HKiU`88 Km`bX8ԘW>88Ԙ8cKq`|Kg`Kx.x$|dKA(`0,#@8b@,@Kf`88~ KkY`bX8Ԙ8cKk`Kg1`Kx A<init__12SISEL_SEL_NTFUi|}&aA``!`T>c`X!A8pA(HX`,AX@ NA,AA,=@@@@,@<8`8!|} !AaN Keq`8 Xc#8 8ԘK`T{>c#8 K`Tz>c#8 Ky`T`>,;,/:@t9-@`8r@9pccc9 w8LKo`8b Ke]`8`8!|} K 8-@K9-@`8r@9pccc9 -8LKoA`8b Kd`8`8!|} K8-@K8 c#K`KX8 c#K`@K@8 c#K`@@K$8 c#Km`K8 c#KY`AK8 c#KA`AAKc8tc$H,@@,@P|`yA(te| EN!A(y|AH8K8 c#K`Tz>c#8 K`T`>,;,/:@9-@|8r@9pccc9 w8LKg`8b K]`8`8!|} !AaN 8-AK9-@8r@X9pccc9 -8LKgi`8b K]`8`8!|} Ktccc9 -8LKg`8b K\`8`8!|} K$8-@9pKT8 c#K`b@,AhKAK8 c#K`AAK C"clear__12SISEL_SEL_NTFPC7SI_SOCKUc|`8c !Kމ`8 K}`8 Kq`b@,@8`8!}HXK[` 8bX8Ԙ8cKe`8K[i`8`8!}N AclearSet__12SISEL_SEL_NTFv|``aAT>!!Ac`X8pA(HL`,@b@,@$8!8`}N KY`bX8Ԙ8tcKd`KZM`8`8!}K`Xr8(e"HI5`,A@,@L|KYQ`88~ K]`bX8Ԙ8ccK^}`KY`8`8!}aN `0\|Px|gy8 | |&t 2W$>A`e| EN!A(z ,#@`8z,#A 8 @8|@@ 8 cK9`8 cK)`8 cK`80 cK `8@ cK`8P cK`,@<8!8`}!AaN KW` 8bX8Ԙ8 cKbM`8KW`8`8!}K`@8`_`@||.,@$,=@` | @@` KKV` 8bXc8Ԙ8TcKa`8KWY`Kz,#AH  K<`K A #remove__12SISEL_SEL_NTFPC7SI_SOCKUc|`c|`y!A(A$ d| DN!A(88 ` `8`(K`8 K`8 K``XH;`,A@,@h|KU`8 8~ KZ!`bX8Ԙ8tccKZ`KU`8`8!}N 8`8!}N `P`09`X888H:`,@8b@`@,@8!8`}N KT` 8bX8Ԙ8cK_y`8KU)`8`8!}N @,@ |KTU`88~ KX`bX8Ԙ8|ccKY`KT`8`8!}K88 ` `8`(K`8 K`8 K``XH9`,AK AremoveAll__12SISEL_SEL_NTFv```c|a8c?Te!aT|@A`8 80 KKu`8c?TTe|@A`8 8@ KKE`8c?TTe|@A`8 8P KK``8@` ,@x8p```!80 8@ 8P cg9p9!tK`Td>,A8,|4`|T~`(@},@HKR` 8bX8Ԙ8cK\`8KR}`p, @,@$8p8;,$A,@lKQ`8_8 KV%`X8bԘ8x8vcK``gc8ccKV`KQ`8`8!}aN , @,@,>A pcKKP`bX8Ԙp8(cK[`KQI`KKP`bX8Ԙ80cK[]`KQ`K,@,@ ;KHKPM`bX8Ԙcf8TcK[ `KP`;K KP` 8bXcf8Ԙ8cKZ`8KPq`KD Aselect__12SISEL_SEL_NTFiPUi`8@` ,@ 8`N H&@ @$startLoop__12SISEL_SEL_NTFv|#y`~|}&aA!```aaA!xp!A(A 8,A 8,A 8#` /9A ;A A h.(A,%A@:ԘXb ````!` 88app:@80 t|Ki`T`>, @8`;:@8ap8@ K=`T`>, @8`;:@|8ap8P K`T`>, @8`;},@~|`yADV `0|Px||&t(|2T>e| EN!A(yz`(, A,8A<>`  y@, @b@,@x8A8`0*8! |} px!Aa!AaN KLy` 8bX8Ԙ8АcKW-`8KL`KHB8ap8K!`,@,@8ap8@ K`Tn>8ap8P K`T`>~`(,#@d9V,/8rbA8-,.9wA9-, 9 eA9 -bC8b%KU`:@SKK`Kl9VK,2@KL@:ԘXb  ````!` 88app:@80 t|K`T`>, @8`;:@8ap8@ KϽ`T`>, @8`;:@|8ap8P Kϑ`T`>, @:@V@>, @|w,@~|`yA@`0|Px||&t(|2T>e| EN!A(yz`(, A,8A>`  yAKB8ap8Ku`,AXKKIa`T58ap:80 KΝ`To>8ap8@ KΉ`Tn>8ap8P Ku`T`>~`(,#@d9V,/8rbA8-,.9wA9-, 9 eA9 -bC8b%KS`:@SKII`K9VK,%AP@:ԘXb A````!` 88app:@80 t|K͙`T`>, @8`;:@8ap8@ Km`T`>, @8`;:@|8ap8P KA`T`>, @8`;},@~|`yADV `0|Px||&t(|2T>e| EN!A(~`(,#A ,8At>`  y@;@K48ap8K-`,@K KG`T58ap:80 KU`To>8ap8@ KA`Tn>8ap8P K-`T`>~`(,#@d9V,/8rbA8-,.9wA9-, 9 eA9 -bC8b%KQQ`:@SKG`K9VK,2@K@:ԘXb A` ```!` 88app:@80 t|KI`T`>, @8`;:@8ap8@ K`T`>, @8`;:@|8ap8P K`T`>, @:@V@>, @tw,@~|`yA@`0|Px||&t(|2T>e| EN!A(~`(,#A,8A$>`  y@K8ap8K`,@KKD`T58ap:80 K `To>8ap8@ K`Tn>8ap8P K`T`>~`(,#@d9V,/8rbA8-,.9wA9-, 9 eA9 -bC8b%KO`:@SKD`K9VK@:ԘXb  ``!` 88app80 t|K`Te>8ap88@ |txтK`T`>, @8`;:@|8ap8P K`T`>, @,=A8;,@~|`yA@`0|Px||&t(|2T>e| EN!A(,:A yz`(, A ,8A>`  y@.:KB8ap8K̥`,AKKB`T58ap:80 K`To>8ap8@ Kǹ`Tn>8ap8P Kǥ`T`>~`(,#@d9V,/8rbA8-,.9wA9-, 9 eA9 -bC8b%KL`:@SKBy`K9VK,2@KtAT@:ԘXb  ```!` 88app:@80 t|K`T`>, @8`;:@8ap8@ KƝ`T`>, @:@VR>8ap8P Ky`T`>, @,=A8;,@~|`yA@`0|Px||&t(|2T>e| EN!A(,:A yz`(, A,8A>`  y@KB8ap8KQ`,A4KK@=`T58ap:80 Ky`To>8ap8@ Ke`Tn>8ap8P KQ`T`>~`(,#@d9V,/8rbA8-,.9wA9-, 9 eA9 -bC8b%KJu`:@SK@%`K9VK,2@Kx@:ԘXb  ``!` 88app80 t|K}`Tr>8ap8@ Ki`T`>,2. 8ap8P LBNBKE`T`>, @,=A8;,@~|`yA@`0|Px||&t(|2T>e| EN!A(,:A yz`(, A,8Ad>`  y@Kt8ap8K!`,AKK> `T58ap:80 KI`To>8ap8@ K5`Tn>8ap8P K!`T`>~`(,#@d9V,/8rbA8-,.9wA9-, 9 eA9 -bC8b%KHE`:@SK=`K9VK@K C*next__12SISEL_SEL_NTFPUcN21PPC7SI_SOCKPPCv|``c`X`!q8pH/u`,@b@,@$8`8!}N K, `@Иc8 KI`T`>, `@h}8 cK!`T`>, `@}8`8!}K 8`8!}N 8 cK`T`>, `@}8`8!}K8 cK}`T`>, `@K4 A%getMode__12SISEL_SEL_NTFPC7SI_SOCKPUc|``c`X`!a8pH-U`,AP8`(, @8ax8xKY`,`@@~H`b@,@8`8!}HLK:`bX8Ԙ8tcKD`K:`8`8!}N H80 cK`T`>~, ``@0c8P K`T`>, `@`H,~8P cK`T`>, `@4~8@ cK`T`>, `@<~H88@ cKe`T`>, `@ ~H8`8!}N A%getStat__12SISEL_SEL_NTFPC7SI_SOCKPUc|``a``c`X`!Q8pH+`,AP8`(, @8ax8xK `,`@@}Hdb@,@8`8!}HK7`bX8Ԙ8tcKB`K89`8`8!}aH@H80 cK`T`>}, ``@0c8P K`T`>, `@`H,}8P cKi`T`>, `@4}8@ cKA`T`>, `@<}H88@ cK`T`>, `@ }H`Xr,;c8(|"8| *A8c|(*8`8!}aN AX6getStatEx__12SISEL_SEL_NTFPC7SI_SOCKPUcPPC7SI_SOCKPPCvcN @getMaxSockNo__12SISEL_SEL_NTFv|c`X!8pH(-`8|48T8!}N A<#isMember__12SISEL_SEL_NTFPC7SI_SOCK|``c`X`!q8pH'`,@b@,@$8`8!}N K4`bX8Ԙ8tcK?Q`K5 `8`8!}N `Xr8`8(8|*| *Kh A&getData__12SISEL_SEL_NTFPC7SI_SOCKPPCv|``c`X`!q8pH&U`,@b@,@$8`8!}N K3U`bX8Ԙ8tcK>`K3`8`8!}N `Xr8`8(8|*!*Kl A%setData__12SISEL_SEL_NTFPC7SI_SOCKPCv``|aAc!aA!x!A(8KA(` , At`0 |Px| |&t|``8, AD`0 |Px|(|&t|"`@, A`0 |Px|0|&t|*`(9~,%A9~|ia|8|paxK%A(a8 xKA(a8KA(|`yA,80f| FN!A(a8 KA(,A(, A;~ <;````!`0; ;:8|``0`X|H#=`,`0A4`Xc8c(|c"||` Pxd|cؒ|c&t~"|` ,$A0| Px|ؒ|&t$*,A| @; c,#A0|Px|ؒ|&t,A|@;,|~@8@`8a8 K`Ts>8a8 K`Tr>8a8 K`Tq>8a80 K`Tp>8a8@ K`To>8a8P K`,39@rT`>~~( ~A9@-,29`wA9`-,19eA9-,0; rA; -,/;wA;-, 8eA8-8pAxbeaba!K]A(|`yA,be0f| FN!A(a8 KA(8;8c|@@;(|@Alp8!`}x!Aa!AaN b@Kp8!`}N 8K8K8`K Adump__12SISEL_SEL_NTFP4FILE|@@c`0x.xH|"|c*N 8`N @,getSocketNo__12SISEL_SEL_NTFUi|``c`X`!q8pHu`,@b@,@$8`8!}N K,u`bX8Ԙ8tcK71`K,`8`8!}N `Xr8``0 8(|*|"| Px|0|&t|"KL A*getSocketPos__12SISEL_SEL_NTFPC7SI_SOCKPUi!`f|Kq8ܘ88Ԑ`8` `(`0`8`@`H8!p`P`X}N Al__ct__12SISEL_SEL_NTFv|``8bܘ!q8`X,#@`P,#AH``HKuA(`0,#AxKaA(c88K{@(c8!}N cK1A(c8!}Kc88Ky{@K`HKA(`0,#@\KH `,A\@,@L|}K)`88| K.5`bX8Ԙ8tccK.`K* ``P,#@Kp A__dt__12SISEL_SEL_NTFv|!K)`b 8X8Ԙ8HfK3`8b K)u`8`8!p}N Ah%startLoop__12SISEL_SEL_NTFv@AF134_120|!K(Q` 8bX8Ԙ8HcXK3`8K(`8`8!}N Al$startLoop__12SISEL_SELECTFv@AF135_99|!K'` 8bX8Ԙ8HcHK2E`8K'`8`8!}N Al"startLoop__10SISEL_POLLFv@AF136_57|!`88A(f| FN!A(8`8!p}N APSiSelDestroySet@AF137_4xd8p A$|2|d|cp`M |cN ||`:p`M K @H FsGetAdmSize| P|xd8dN @ FsYetFree|xd;aA(&`!8!APW>A(@,' A,<T>A`z<||`|P|x`v)```!|||;Z\N!A(;|x`v)|>@Ac8!}!AaN |``!|;|8cC ca8!N T>,<AK`8!N A FsInitx`|N @ FiIGetMaxStackSzp,@<0|`A0$@r|N |cN "@LFiIGetMaxNodes8`0N @ FiIGetKeySz8`88| 8`8`! 8 , A `8C  , AN 8` N @\ FiIAllocIdxHd888$| ````! 8 , A8C 8`N x.8|"8d(DN @XFiIAllocSharedIdxHd8N @ FiIFreeIdxHdc8|4T~N @ FiICheckIdxHd|!|`h|a#`K`d8`dK`k}8` K`h}JaCKa$K`ea#aDK| Bxc$|8!p}|"8e N A FiGetAdmSize8$,4<DLT\N @( FiINodeInit8 :||"<8`}:8|9. ,'Ap``!`|}:}c8.| PA8i(,)A})}I.|8.|PA@ J}c9. H8 H,'@x 08`|N $,4<DLT\ F}c9. D8 DK|8.|PAK}e8.,+Af8,'AK8i(,)AK, @D FiIRemoveTree|}&aA`p`!1@,A|,|A pAa@8dapxxcF!Alaq,#ATar,#AT>T>H?$ @ FiOpenIndex,#@ 8`N H< @ FiCloseIndex,#@ 8`N T>H;l @ FiAttachIndex,#@ 8`N H: @ FiDetachIndex0bx |8`N @( FiDestroy89@aA!aA!#c, }iZAi >}iZk,;A>;@{ 9k9; ;)$; ;8cb,V:t~~ɢ|A :&~i|~T@c:`!T:5:|21A OBBA:C |@| (@pf9Jav9kv,;@lG8`!Aa!AaN 8`8 !| PAahk8` @|A.g H8 H8`,>A J!. H8 H,,A F}!. D8 D!AaN 9$}'}GR P?`.c{|(P(g. ,8@0    8`8 Kh8 ;G ``!'~B|@lȮW.,8AD~Ȯ:|A.,8A$`!:|A.,8@KAK,@#~;`;D9;9````!;9;Z|7@;{C c|@8`K0lc,8}`|c`A8g b`.|@4````!`.,8 A|b`.|AAh|g`.|@\ 8$U8|5@|. .|i.  |8@,`Kg D8cg D|c}.},@|.g D8 DK(|g;@g.{ZU;$C.  A\;|$$Ю# W$D .,8AL}g"k |9A8````!D* .,8A}g"k |9@ 8}).,%Ak|d).,$AT8||!.W|5@| . !.  A |5@`KK  }gK|@8`K;`|@8`K @ FiInsert9@|a|"}, | @HH J| P8`|1. H8 H8aN ; }%J9I$W}RX.,=A@|Rf |XA0``!}P.,=A|Rf |X@,=A9E 9e9$;`,=A .,&|A1.8,A<),?|JF UJlQ.A}EZ8e &}eZ}}X U9k$Z}jX.,+}kA<|Z |,A,`!}cX.,+}kA|Z |,@8e 9e 9?,=A .g,#|cA8.},.*fe F|.e D8 DK蓦Kԑ( e F|.e D8 DKĈ|>@ 8`xx  J| P|1. H8 HKKp8`N @FiRemove`|8 !0.,>A<9 9%$`````!}jJ}R|`@}D`UJP.,>A`}`}gP|`AP.,>A$`!}gP|`A(P.,>@8`px8!N AK|8`8!}N |R|2`|:`H,@8`8!}K A4 FiFindExactT>9T>aA!#|J% :f |J,;}I.fA8=`9 9%$9E ;Dcav,}J}| @LeW .,8Ac;@ؓ8`W`.,>Aal}jX?XA`.,>A4````!}X| AXX.,>@`8k,;@D8`!AaN 8`8k,;AK.,>A(```! |8A.,>AK8K9`cL)@l;````!;9|8@ 9kC |@g8`K7X|?`@|7LZB@| AK8`aN @ FiFindLongestPathOldT>9 T>aA!C|RfF :G' |R,9}&Q.'Ah8=9& 9F$9f ;|a,?}R|@&W?~.,5~Ac9@8W|(@WW>.,=@`,=A 8`8,,9@x8`!AaN ,=a}`>`@ AK.,=A0```!`|Ad`.,=@`8,,9A\KW~>.,=A$K|.,=A`!~|5A.,=AK8K9;~cު@~;```!;;|5@<9C `|(@|A}`|;`@ (8`Ka}`4|,@|4LZB@|(AK<8`!AaN @ FiFindLongestPathT?M T>T>U>H$N @ FiIDisplayRec|`}0`!ax8P KiUA(cc88-!xKa8`8!}N A FiDisplayT?"08@ 8@ 8DN T>H"@4 FiIAnalyzeRec8|`;0c!Ac98p8ptx|K~,@H!p$H,@!t$L,@!x$P,@!|  $T,@!00$X,@X!@@$\,@(!PP$`,@!``$d,@!pp$h,@!$l,@h!$p,@8!$t,@!$x,@!  $|,@!00$,@x!@@$8` 488, AL88`||8., A,```!8c}8.||B|8., @|8.|$|@~ 2 JK9,~ . FK)0~ * BK4  $,( 0| P$| P|(@P|c P|@@<||@08!<8`}N 8`8!}KKKt|KDxKtKpKlKhKTdK$`K\KXKTKdPK4LKHK"AH FiAnalyze88`N @ FiGetPstat|!`|d8` K`i}KKع|J8d8!p}N AD FiLGetAdmSizep`A 8`N T>T>T>U>H @$FiLInit8`N @ FiLDestroya؁c ,+A ,@܉#8$` 8;d8}kcl}IZ;```!9;|=@|@=@d8C |A4}gX.,+@88`aN 8`aN L3A|AK8}fA(````!|0., |A@0.K88`N @LFiLFind98||8., LA`9|9`9HC}:}IH.,?@H}I.8|!.88`H}9.88`N }#R9C| P$|(P(9.  h,%|@ 88`H | ). 88`N @ FiLInsert8 |, A88|B|'a*} Cy}A}EA.'g,)AH}%}f).|).8|).888`N c |).8|).888`N ,)A}%}f).|).Kt8`N @ FiLRemove|`aA!!108~xKcIA( ,$A;;$;ax|8(|ߺ|2@2K]-A(8z;@,@X;#c`!KcA(,ax@808.K\A(;Z|@;9cKax84K\A(;|.,$@T8`8!}!AaN 80cK\]A(;Z|@;9cK8 A | FiLDisplay8|p A|:|c8c0N |c8c0N @0 FtGetAdmSize|}&a,`~```T>!Q@l88apK\`8`8p,$A<q,$A$r,$A s,$At,$A܈u,$AĈv,$Aw,$A8x,$A|y,$Adz,$AL{,$A4|,$A},$A~,$A숁,$A,$pt|"xx |:x||3x|*x|x}:x|#yAHs@$px8pA  |80<|Ґ80`~8@$|%0@A,@h| 488|8T >|*9@} ````!} 1890}`B}e!.|*EC |980||"8e|!.8!} |aN 8`8!|} K8`8!|} K8`8!|} K888o8 |"| ```!8C K088K8 8K8 8K8 8K8 8K8 8K8K88 K|88 Kp88 Kd88 KX88 KL88K@88K48K,8`a8!N CFtInit8,A 8`N H @( FtRebuild8,A 8`N H @( FtRebuild288#8, @h$|})9f}f|2`!&F, ,AX#&}G)}KR,)})A$}CI.C8|2C 8`N C8|2C KAԁ#}G),)}+R@#`K$`8|2C \K @ FtAutoRebuild0 x |!8`N @( FtDestroy8|N @ FiHshIGetTabszp`A 8`N T>T>T>H$ @ FiHshInit|!80|`p!@AL|BKYT`9xc$A( |c|)|8d08!p}N |)|8d0KKT`9xc$AK AFiHshGetAdmSize`8|,8!q@8B@,````!T(4|2x8|:xC T(4c|2x|*x|||(P|x$*yA|cc~(`!H,ccA8yA ~(K8`8!}N 8~08!}N 8`x8!N c||c)|P|x$*yAKH A\ FiHshFind``8d`aA!|,8!Q@Ĉ8cB@$`!T(4|*x8c|2xT>C T(4|x|xT>|+||PxH;*yAHccx(```!H,ccAyA x(K |#y@88`8!}!AaN 880d 8`($ |*,&@L|*(,&A(K|(8!}Kl|*(,&A(K8`8!}!AaK, |#y@4K||c!|PxH;*yAK A8 FiHshInsert8,&A ,%@,&@D,%A  8`N ( 8 8`N ,%A K,&AK @ FiHshRemovec(8c0N @ FiHshFirst8`N @ FiHshNext|!`d,|APKYd8080p9`9 9!J@A,|R@d}cI*d |@(``!9)d9}cI*d |ATh9xg$A h8|g| ,@P|f8P|`| ```!|"|1*|fC 8`8!p||:}dN 8`8!p}gN | 8,@K|cTh9xg$AKX,@K8`8!pN AtFiHshInit@AF52_45``c$|aAT>;!|;@|:~!!~|{P:A(x``!~|{x`u ^N!A(,|;Z|A8v,#|c@X|:@~۲A8`8!}!AaN |.K8`,$@bvKb8Kt A dFtRebuild2@AF53_41``c$|aAT>;!|;@|:~!1~|{P:A(```!~|{`u ^N!A(,|;Z|A8v,#|c@X|:@~۲A8`8!}!AaN |.K8`,$@bvKb8Kt A `FtRebuild@AF54_40|`|aa>|;c 8!a8c c8 c 8 K|P8` cK``cK`e|`cc8Ke|P8`8!}aN AFiLInit@AF55_32|}&aA|9 `8<!`| .y),||@H@{da?8@,|'$.*|%.| .8|!.$;(8,0|44,89(<,@U;A;{,D/HA;{,L/PA;{~T,.XA;{^\/.`A;{8p>A;{,/ A;{}:A;{,. A;{cDA;{/.A;{A;{A;{A;{A;{A````!Ka8<8p?8?Da|"Bc8:ha@~axAha@`ȁ?D& |} @` $C $ȡ.ȡx8!._Aa0(!0$*?DN @>cha:8@~K@8b088@8D8!N "CFiIAnalyzeRec@AF56_28|`|aA`~!T>a|x!10,@a5a#8<|:``!KDqA(:b8<|6@AbcE8@KDIA(<|`|A;,:@h{&|`c``!KJA(,b@808.KCA(;|:@@{&|`cKb84KCA(8!}!AaN 80cKCeA(;|:@@{&|`cK;;_ c, Ahc8c|```!ceb|خKc|.c8c, |@Ka5cEa#8@KBA(<|`|A\Kd A dFiIDisplayRec@AF57_26!|axKQ,8`AaxK8`8!}N A<FiDetachIndex@AF58_18`g`!`| 4`9@8c,,}A`| .|XA0````!} .,,}A`| .|X@9@K,#A,ciaC8!p}N 9@8!paC}N 8`8!pN AFiAttachIndex@AF59_17`|} 48!q,#@<, A8`x8!N ccK,@|}|, A8|!.|,%AT8c|!. B!. @$8 @8$K8`8!}N  4 Bc!. @$8 @8$K8`8!}N c|d,#AKT|c8!}N 8|c898|.|(@(|d.,#A||cT>|.|(AU>|d.,#A ||cT>|.|(@K, @XKh AFiCloseIndex@AF60_16|`i,``!@`K,#A@8 4;8,&|A<}(.| XA(``!|(.,&|A }(.| X@`;, @x @8 @|| (., |A98|";}i!.  4$,$|AD|!.$ 48$c#Chc8!}N 8 4$K8| ). @8 @K18`8!}N 8`8!}N K,#AK AFiOpenIndex@AF61_15xA( L| N A( L| N A( L| N A( L| N ;ߠ|!a, A8PX8`cKȡ``g\8((c8'8,99=8Kzu`b@,@\K}`8},8(K `8PKܹ`K`8`8!}N 8`8!}K088@`KW`,A@ax,@`K`(828,KU`bX8lxcK`K1`ax8!}N 8!}N b08@K`|88!8`}N A NiILHInit__Fv8ߠ8`0deN @NiILHRelease__Fv``T>a;bߠ|!A, A{;| @@<|0c||(8|T>K`88`T>|!|@A8PX8`cK``g"(c8(px[8,8a99)Kw`b@,@pK`"(8b8i,KY`"(c8K`K1`8`8!}aN 8`8!}aK|0c||(8|T>K̍`88`T>|!|@A|KK,A@a,@hK`(8S8,Ke`bX8xcK `KA`aa8!}N a8!}N {;|@@ K ANiIGetLocalName__FPcUi||~y`a!A;, @(@~ ,#A, @ (A@ , A, A@Hb 8cKm`T|>8aKU`,<A8PX8`K ``g;ߠ8(b(c8p8,99;\Kt`b@,@dK`8{,8Km`a88aK_-``hc8(ccK`K%`8``8!P}aN 8a8c8K`,A8ac8.8K`b@,@48aK`8``8!P}N K` 88a8ߠ8a K^)``h(cc9!8P Ka`8K`K`8aK!`8``8!P}N b 8cKi`;8c8T|>8aK)`Kc88.8K`b@,@$`8!P8`}N Kϵ` 88bߠ8(8Ki`8K`8``8!P}K8PX8`cK%``g;ߠ8((c8v8,99=^Kq`b@,@K`8},8vKӍ`|8K3`Kq`8``8!P}aKL AP&NiILocalCheck__FPC11NI_NODEADDRPP4FILE8A( L| N |}&a|#y`~/``!aA(,|AA$8!||N cK$A(`}ccH]`|||{@ccceH~|}@4c|8!} aN ccceH,@@ |خ|||K|خ|8!|} KccceH~|}A\K,@$A|8!N @8`8!N Cstrfcmp,,8| |*LF BAd`, AH| , @<8|&@A0```!88, @`|$@@|c0P8|N 8`N @strflen|}&a|+y`~/!aAP,/AD|@<|A@,LFA 8!||N 8`8!N ``K`}caK`|||{@ccceH~|}@4c|8!} aN ccceH,@@ |خ|||K|خ|8!|} KccceH~|}A\K,@/@LZAKĈ8!|N Cstrffcmp,#|P@|txтN T>H @ strfeql||y`aA`!!QAP,%|A$|0|Acc@cc%H,A48`8!}!AaN ||PA4|P|H)Tc>8!}!AaK|~HTc>8!}!AaKczyc%H,@TKcccH8!|`4}aT~N txт8!N |P|t8!xтN Astrffeql88|8c,A |i`!8, @C 8`N 8`N @D strfempty||#y,a``!a@PA ,A8!N |8 H `8!}N ,A@c|cKv `||{|Apc@4cK `8!}aN ecK`8!}aK`|ccceK`||P8 |H `8!}aK| Alstrfcpy|`,%``}!qA| |@T`K`|@|P||8 |H `8!}N `K`|A8!}K,@x8!N |8 H `8!}N Astrffcpy888|T>8,A,|```!8| A8C 8`N |c2N @XstrfchrT>| |d|,%A`!8c| @C 8`N 8`N @DstrfallT>| |d|,%A`!8c| @C 8`N 8`N @DstrfallR ,|`|!qh(@`~``@``!|P~,p`L+BA\c8K{A(,@4;;c|?@A8!}N ~|K|Kx8!N 8c@ | `!| 8cC x8!N Amemtr,|L 8c8| ``!8|(8cC N @<memctr|8||2`| @`!8P , @X@(888!}|N 8cK`888!}|K|(, @8g|# @A,``!88, @0`|% @@|dP8px88!|N PAL8cK`Kl A strzcpy8,@h8|88} ````!9'D8, ,*LFAG88C `}( |N 8`N @|strz2cpy8,@h8|88} ````!9'D8, ,*LFAG88C `}( |N 8`N @| strz2cpyR|9|}&B```!q , @|eHP8|@|,|@Lc`cK `,=8|A 88!}N 8,'|@x8!N ,,A@@(88,=|!A8K,=A8K|8`c|KQ`Ka#|0, @@9)|)(@A```!8c8, @`|$(@AK|eHP8|@DK Astrz3cpy`d, M 8 , _A 8, M , _@蘤8, M , _AKN @`strca_`d`e, ,_AdA,8, A`!88, @8 , _L ```!8, _AN 8, A$``!8`8, @8|$@8 `8,_L3BM |$@8,_L M ``!8|$@8,_L @Kd @strct_|& @A| P|*}:|%@@89$|HP|#@@|'`f%@`| @<9%9E)@@,`!(9f8|X@(*@9JAM 8c@8`N N M 8c@K8|#@@| P|@|````!M 8c@K @ UcaFindUca|```!qKA(`}cKA(|=@A@|}P|, A8, `e|A4A|#@8c@8`8!}N 8,'A````!8|@@8,'AKAK8!}N A UcsFindRevUcs|& @A| P|*}:|%@@89$|HP|#@@|'`f%@`| @<9%9E)@@,`!(9f8|X@(*@9JAM 8c@8`N N M 8c@K8|#@@| P|@|````!M 8c@K @ MemFindMem|& @A| P|*|"|%@@8e&`|@`|)X@<9%9E|@@,`!(98|)`@0|@9JAA|$@8@8`N `N AK|@A|%@``!8A|@AK @ MemFindRevMem|`|#y|!qA|Ky`}cK A(|c@T|>!qA((@;(H `((A ,>A|;0, @4H`8`H `8cH}`H`@,@(8!}N K9`8b84cK`K`,AK`8bH ``gc9c88tK`Ki`,A\K`8b84cK}`K5`8!}K08`H`8cHY`H`@,AK8b0p8!}cN H `|@@P;0, @KT;H `,>(AAK$ A4Rng_PseudoRandomInit|`~T>;\8!AH1`p`b@@,@`KQ`88K`8b88@cK`K`8`8!}N 8`8!}N 8,=A8apa8a``!H `c8,<A|@|@|||(8|T>K`|PaT>H`,=8A8p8aK|8`8!}N ||(8|T>K]`aH`Kb@,@dK`88KQ`8b8T8@cK`K1`8`8!}K`8`8!}K<8`8!}N ARng_PseudoRandom|T>8!qax8`KcaxK8!}N ADRng_PseudoRandomConvenience`T>;0|!, A,>A8`8p8at;````!HA`{({pt8ax8xd9%y%8x}!.(A;8at8p(=@A8ax8x8c89H.`|,@4,=|@A(c|@8h|||(8|T>K`|P|8ahT>H`,>@8ax.,@`88x8`x$|Px| ``!|'8C 8t@8!0xd}dN 88H`8`@8!0}K|8h|8|*T>K`|8ahH`K0b@,@dKE`838K`8b88cKy`K`8`@8!0}K,8`@8!0}K;|).8at8p(=@@K8ax.,@K|H `},>AKT ARng_RealRandom8dN @ Rng_SetTracefile`|aAW>8b0!T>!Q, @p8~8(; xe$8~(|Px.,@,>(>0>8>@>H>P>X>`>h>p>x>>>>| ````!|/8C >%8~$8 xddx$8c&$%%%%%%%%%%%%%%%%H1|@@4|P8at8;|t;(8p`;[````!H{tp|y"xd8x|!.(A;8at8p|=@A{`;08`|8T>KmA(Tc>H )A((@<#;;(```!KA(|;x|~!.|<@A}8!}!AaN ;|.8at8p|=@@LK8`;0KA(Tc>H }A((@KT88H`cHK|@AH#{#d|P|~x8c(H`H|@|@A @|KHcHeK4c8!N AiRng_FillEntropyPool|!``H QTe>808`,%@8!p}H8`8!p}N APiRng_SetPrngStrength|!H T`>808`, @d8!p}N A8iRng_GetPrngStrength|``a;!aK=A(T`N 8 H88b8 8 8apH}A(Kh Apfclock1|8b!88cH8ࠀdH8!p}N A< init_globals|``!HHݐ~8`8!}N AH pfget5_adjust|`8b`8!HyHѐ~H88`8!}N A` pfinit_clock;|aA!a8!Hx$H <P`|`?@; ;: h`!88bࠒH`u8ax8pKA(8zIH uH`t8p8aKA(88axH V>V>|@||| PTf>|e"8@0x>Hx.xW>|P|`"|38x||t|`|#@Ts>Hi`u8ax8pKA(8zIHHI`t8p8aKA(88axH IV>V>|@||| PTf>|e"8@|x>Hx.xVu>|P|`"|38x||t|`|3ATu>H`t8ax8pKYA(8zIH%H`s8a8pK9A(88axHV>Ve>8|||@|0PTh>8|e28@x>Hx.x|P|`*|C8x||t||5@bT>`8|T(@`H`u8ax8pKA(8zIHUH`t8a8pKiA(88axH;|@@|P|8|cP|`p|c(8|dx| P|@+A@ `bA@888c`|T(@L8!}a!AaN 8!}aKbc8!}aK|P|cPKK|(Px>HK@|(Px>HK|(Px>HK A 4 adjust_clock;|8!qx$```!H`}H HHHHHHHHHHHHHHHHHHH|@H|P@|P|c8(@TT>;|`||c 8|(?T>A`(8`AT~8!}N c;W>(?@K(@K A$clock_null_time|`;;!q~H(@4H~ 8`8!}N ~H~ 8`8!}N A pfset_adjust|;!, @ K݀8!}N x8!N ALpfget2_clks_per_mu10|!Ku8c<`| T8!p}N A4pfget1_clks_per_mu8b!|, Ac8!pN K8b8!p}cN ADpfget4_clk_null_time10|!Ku8c<`| T8!p}N A4pfget3_clk_null_time8ࠀ8`N @pfget6_adjust10;|~ !,#A(A8c| CN!A(Tc>8!}N 8P8@H`d~ 8HH~ c| CN!A(K Apfclock|!Q8ax8pKA(8p8a;`!KA(;8a8p(?A8aKA(8ax8H<b8!8M}|cTcѾN Adelay_of_gettimeofday|`!a8p8axK A(8p``!8aKA(88axH]8p|@@8!}N Ah delay_usec=8B@|@9&x6dT>@XU&>xȢ|8Px˃x.} @Pxtd|"|PP|JxM}'BxMx6d|c P|2|P|c|T>N yCx6dyF|8P|fPx.yFtd|@P|c2yHM|BxMyC6d|8P||P|d|T>N @ timeval_diff8bXN @ PfGetSapClock||!aaxcK`~axKA(aP,#AK`,@$;pc8!}N aP8K`,c@K-8!}KxPx8g8KA(c8!}K APfGetDefClockOrEnv|!q8p8axKA(xxx|Pxt|f:xM|"x6|f|*T>8!}N A`pfclock2N @ PfDebugClock|``!a8p8axKEA(xa~8!}N ATpfclock38`N @PfClock2Interval8P,!,|@(8p 8e$K8`8!p}N AK8`K`df 8e$K8`8!p}N A| PfSetClock8b|c(,#!A(A4c| CN!A(Tc>8!}N 8P8Ka`d8e(8Ke(c| CN!A(K APfStatisticClock8`88X(|$@M 8`N @ PfGetStatisticClock8P,!,|@(8p(8eK8`8!p}N (AK8`K `df(8eK8`8!p}N A|PfSetStatisticClock`,;|0!q,A(AA,,Ah8`A 8!}N 8`K5c| CN!A(Tc>8!}N KY8!}N }0c| CN!A(Tc>8!}N 8P8~@K`d}08~Ka,AK A0PfRuntimeClock|!,,A|8,AdA,d0`dbP8cK8`8!p}N 8`K``dPe08fK8`8!p}N 8bpd0K8`K8d0K APfSetRuntimeClock8`88X0|$@M 8`N @ PfGetRuntimeClock,,A8`AN HHK @ PfIntervalSize|!K8bࠀc8!p}N A(PfClock1Interval|c`8H4 @PfTime|``|c!KA(?8@|;,%@,88`8!}N |(@H|P@$|P|88`K8`K,%AK APfTime2|@HP| P@,x|P|d8T>|(@L 8`N T>x| @L K @P pfclock_diff|!8 8apHA(8ap8 HA(txxdxd|Px$|g0Px|"xd|g0Px|Pxtd|g0Px]$|"xM}|8!|d*N A pfnanoclock8b(Pdp|`|PxB|"xBN @(PfNanoClockInterval8`N @PfNanoClockResolution8A( L| N @A( L| N ,#@ 8`N T>H , @haInitT?@ 8`N H @haUpdate,#@ 8`N H  @haFinal|T>T>U>!aax|K,@axcK9,A 8!}N axKM,,@,=A0@axH8!|c}N axHE,=,LFAK A haHashAll,#@ 8`N H P @haHexEncodeDigestx8|y|84!qA98|fx B@0````! |Ґx 8C | p ;d}%Ґ9Ap8888$9 YpH`,@(c}p8!N ;8!c}K8`8!N AhaBase64EncodeDigestT?8A9 x,;9@a 9;;A}CH| 8 89B@d``!UJ>9W>U>9|0@}KP}E9|Hy 9T>}K8}EAU>|`}CH;;C UH>|0@8W>T >8|@|9|cHTc>|k|eQAT>|aN aN c;}CH;C 8K| 8B@8B@P```!|PT>|8|ax(}#Px 8|ygU)>}(H}%T>8C |PT>|8|ax(|Px T>|0|T>x|PT>T>| |a|PT>||`K @haHexEncodeBlob,,$A8(8/&8A8LDAt8(``!(x A\y($}@*} N ,(S/C/(cAP/(MA@A4@(88,(A|% @A8c8K8`N 8K8K,(m/sAA@K(%@̈,%d/%DLZBA($/$-@ 8c@`,$5@N @K,%/%AD@t,(AA ,(a@`8@<#,)-@0`h88cK,(HA,(h@$K,(1/(2/5.3AAdA49%@|$H@@ԡ#Ci)51iJ2}+Sy@`N 9%|$H@@#Ci)38iJ4}+Sy@`N 9%|$H@@|#Ci)25iJ6}+Sy@d`N |% @@T`N ,%/%AD8@T,(c/(CLZBA@@ `iC,*-@8c8 K,(r/(RLZBAK9%,(3@|$H@@С#,)32@` N @haGetAlgorithm8```| @P`|0` | A0|AA 8`N bx8ctN bx8cdN bx8clN |(`A(|Abx@8c\N bx8cTN bx8cPN @haGetAlgorithmName`;b89|8x$`ydc.x$8!q,@(|(P x (08@HPX`hp| ``!|/8C 888cƥxcdx$|0cƥcǥ0|8Ac|AA`8`A 8!}N 8xH,`T`?|@ē8!}K8xH=`T~>,>A8!}K8xHZ`Kcc |ALA(8`@<8xHm`K8xHn`T~>Kp8xH|`T~>KP8c8H`ccåcĥ|| AXK A haInit@AF10_1`;|cĥcǥ80cɥ8cc!|8c @$x| |HA@H|8xc@H|@HA;xcp8!N 808KYc8!}H$|P@HHN K c8!}K A8haHexEncodeDigest@AF11_5`;|cåcĥc cƥ|c!cȥ@| At|(AHA$;8!}N 88Hk`bxK88Hl``~bxK88Hz``~bxK|0|@AhA@;AKd88H)]`x|c8!}KD88H:-``~bxK88Hf)`bxK AphaFinal@AF12_3|,,$!@ ;8!}N T>;A܀ccc|0Alc|@AP|0A4;AK8cH*A`|c8!}N 8cH;``Kp8cHVi`K`|8cc A@|0A$|8A ;K88cHi`K(8cHmA``K8cH{-``K A$haUpdate@AF13_2||y;}&aA!a^```aaAa3!!@@||xx|a!|Aa8!N ,,//A|2||H|#@U:_|(:9|8|@@x:s8|3@@`|%@:RT&T|6pT|*T>|:}T | |0|@|H:1AcDb#bKd`8`~6Kpzd8|P|"|| @@T98TT&|(@|0@ЈT>|T|0| :%8c@ (#Ad|P|8!} !Aa!AaN b#cDbKc`~6|P|K|8KH8zd8~9~``!8T&T| 6pTT>}B}8J}KT |0|8| X|P8C KlcKt:K(8b0(K 8b08K8b0 K C haEncBase64SB||y;}&aA!a^```aaAa3!!@@||xx|a!|Aa8!N ,,AA08`a!Aa8!N ;008|xBxd|2H@A*&@,'@L8`Aa!Aa8!} N cCKEA(`v|8|ے||| @@X8`8!|Aa} !AaN c18`|xBxd| Q@8x|~*:@ :`8`T&TT}6p|"T>|2||H|#@U:_|(:9|8|@@x:s8|3@@`|%@:RT&T|6pT|*T>|:}T | |0|@|H:1AcDb#bK_`8`~6Kpzd8|P|"|| @@X9$8TT&|)@|0@ЈT>|T|0| :%8c@ (#Ad|P|8!} !Aa!AaN b#cDbK^`~6|P|K|8KH8zd8~9~``!8T&T| 6pTT>}B}7J}KT |0|8| X|P8C KhcKp:K$;0K C haEncBase64UC8b0aA|c,#8!a8p8h| @D`! 8 C 8ah| ````! 8c C 8ah| ````! 8c C 8ah| ````! 8c C 8ah| ````! 8c C 8ah| ````! 8c C 8ah| ````! 8c C 8ah| ````! 8c C 8ah| ````! 8c C 8`9B08p8p8p9p9!pJ j,+A90|dY(08@9;;;9|eᮈ|f)|g)|h)|i),&Ap;p;ap;Ap9!p8p`!9k8c|d1;;;9 9J|zA|{)|g)|i)||),&@808``X,?AHP;p `*h;p9pJp8899)9J```!|}9|}f8|lYg8|lYi9)|~Yj9J|~Y8c8,?@8908ap8p8pa8p9p9!p9Ap9apx,>A;;````!||8ap|8p|8p|8p|9p| 9!p;| 9Ap;| 9ap9,>@8808c|:}B|2ppppppKX`88p8KX`88p8KX`88p8KX`88p8KX`88p8KX`88p8KX`88p8KXq`88p8KX]`88b0 8! }AaN 8! N Aha_initialize_rtables`a>8b0|aA;c!``aaX``c!!, A,,,//AAAAX;,8Ac8!}!AaN b8ccD,;9 8@zz,|Al@8p89i```!9(xd;9(}#H})t, A9GU>}&Y.Ad8apctx||*@Uj:@U 6V02}&pyJ yk ~p}JbGz ~b}kgc8C h, @(A`||$0@@8(@|0@@ptT:|&px |:@LxT 6xc |p|8cz@|P| @ ;K8| PK,`||<@@|(|t,A ;K;K;KptT:|&px |2`K,%Ap;K, ,LFAC HKi?88p99`9@B@````!9}#H(;8})t, A Ue>|,@}'Q.pA\8!tcAxa|U:U5 6@,UV02})&py z }Jpz },J(}khc}5R(99e&xdC h;(|H|t, At8Ue>}'Q.A8p8Atax||&@T:@UF 6}J&pUg02x x |R}kpc|Zx | K, A, A;K8, @9e&xdC KH@8p89i`!9(xd;9(}#H})t, A|9GU>}&Y.Ad8apctx||*@Uj:@U 6V02}&pyJ yk ~p}JbGz ~b}kgc8C hK, ,AAC PKi?88p99`9@B@``!9}#H(;8})t, AUe>|,@}'Q.pA\8!tcAxa|U:U5 6@UV02})&py z }Jpz },J(}khc}5R(99e&xdC h;(|H|t, A<8Ue>}'Q.A8p8Atax||&@T:@HK, A, Ah;K b8cKlb8cK`bKXKK A  haDecBase64SB`a>8b0|aA;c!``aaX``c!!, A,,AAX;,8Ac8!}!AaN b8ccD,;9 8@zz,|Al@8p89i```!9(xd;9(}#H})t, A9GU>}&Y.Ad8apctx||*@Uj:@U 6V02}&pyJ yk ~p}JbGz ~b}kgc8C h, @(A`||$0@@8(@|0@@ptT:|&px |:@LxT 6xc |p|8cz@|P| @ ;K8| PK,`||<@@|(|t,A ;K;K;KptT:|&px |2`K,%Ap;K, ,LFAC HKi?88p99`9@B@````!9}#H(;8})t, A Ue>|,@}'Q.pA\8!tcAxa|U:U5 6@,UV02})&py z }Jpz },J(}khc}5R(99e&xdC h;(|H|t, At8Ue>}'Q.A8p8Atax||&@T:@UF 6}J&pUg02x x |R}kpc|Zx | K, A, A;K8, @9e&xdC KH@8p89i`!9(xd;9(}#H})t, A|9GU>}&Y.Ad8apctx||*@Uj:@U 6V02}&pyJ yk ~p}JbGz ~b}kgc8C hK, ,AAC PKi?88p99`9@B@``!9}#H(;8})t, AUe>|,@}'Q.pA\8!tcAxa|U:U5 6@UV02})&py z }Jpz },J(}khc}5R(99e&xdC h;(|H|t, A<8Ue>}'Q.A8p8Atax||&@T:@HK, A, Ah;K b8cKlKK A  haDecBase64UCa?;9"0|aA`}`!`aaY`!A` , A8`,,A|AL;,9cA8!}!AaN 8ce,<@zz,8|A\@8p99=```!i9)|lyd}dXUl>}kt, Al8c}Q.|%@,AX8Apatc@<8;UJ 6}kRh9C ,@ ;K|(PK;K8C pK8p99=``!i9)|lyd}dXUl>}kt, AX8c}Q.|%@,A88Apatc@8;UJ 6}kRh9C KP8C KD, A;K@89@8p99=```!i9)|lyd}dXUl>}kt, AX8c}Q.|%@,A88Apatc@8;UJ 6}kRh9C K8C K, AT8C |K8`9!p9[9`B@t``!|0yd,8%@T>|t,A}A.pA8tc@89kU 6;|B9J|h8cC |0yd%@,8T>|t,A| 1.pA8t8`@;T 6| K9k|h8cC 4K8KKKh A  haDecBase16SBa?;9"0|aA`}`!`aaY`!A` , A8`, @cd,<@zz,8|Aa@88p99=``!i9)|lyd}hXUl>}kt, A8c}Q.|$@,A8Apatc@|8;UJ 6}kRg8C ,@L;,9cA8!}!AaN | PK;K8C 0K88p99=`!i9)|lyd}fXUl>}kt, AX8c}Q.|$@,A88Apatc@8;UJ 6}kRh9C K8C K, A;K89 a@8p899=````!i9)|lyd}hXUl>}kt, AX8c}Q.|$@,A88Apatc@8;UJ 6}kRg8C KP8C KD, AD8C |K09p88`9[9`B@p`!|(y)d,8$@T>|t,A}I.!pA8tc@(9kU) 6;|J9J|i8cC |(y'd$@,8T>|t,A|9.pAt8t8`@;T 6| KP9k|i8cC 4K;KTƄ>dT>ef``TF>T>hU>j$ig kH8!}N 8`(|)(,@@$`!8(||~!(,@AcHQ8(,8@<```!8(|c|(,8Ac$``K AhaSHA256PadMessage||y,a`!aAA@,$A88lcp;,;T>, ,@@```!,;(8(|c| 8 ,@|$8($,@/@`pAHA8{;pT{>, A8`8!}aN cHAK(,@AAK|cax8!N 8`axp8!N 8`8!N A haSHA256InputaA!aA!xp,1-05T4TˀT.TTT6C/!|Kx2U@.|+xT@.};xX`}kx|xh#3U@.|Sxx79}[xpp|xẀx}hKx (0p (@x8<8PHAT`t08TIHLTECDTQ}xTMUPUJWT#YTUTX:UBWHTW3x@PW})SxXhx{x=@~x~x>FT@.~sxTTJN|[xR|;xVT@.ZU@.C;c?U@.CW@.GCKW@.V@.#OSU@.T@.WC[|#x}3x#]\}Kxxaax x~ x}x|x|x|Sx|a|[xU|x|x}xa`^fcgTʀh} xTi}xeU@.xbT|xU_V dT|#x8/Tj}J[xccW@.}xxW@.k|3xT@.|Sx|cxx|+x|[x|x9 |x;!p88``!x xy 8 x8`P.|(.xxd8 WlTt}@.Wh$Tp"W|~}x|8.Wx TWT |SxT}jx}xx|*x}FZx}*x|B|:|:|!.8C lx xy' 9 yxd 9)~X.P.;?y,c#`VlWt.y.Vh$Wp"V|~~׻xVx WVW xWx~x~xx]x~xa.9;p|(8``!y T{dT}~xT>~T80[xTѾ~..x~xT Zx}xܲU\~]xU[UZU})xU^P*U[ZxU^}]2x{xx}\08J} 8~xJxai``|a`aF}^9|(8C Dy T{dTc }qxT>~T80~xCTѾ~sx9..T UR~~xUQ~֫xUUU~xUSP*UP~RxUQ~x7}W2x~֢x~x!~Ux}S08A})}8~x}8J~yxa|J79}9J!|J||2|*(|B |Z}LRC|:Aa8! N @haSHA256ProcessMessageBlock|`|#yaA!!QAԀp, @8`l, TF>AlT>T>TF>T>T>TF>T> T>  TF> T> T> TF>T>T>TF>T>T>TF>T>T>TF>T>T>8!N cKb;@8`d`e`f`g_ l`j`}`|cZ```TF>`xh J```a,h|h!|)|1|9|Q}}:08@HPX?`T>T`>~TF>T`>T`>~TF>T`> T`> ~ TF>  T`>  T`> ~TF>T`>T`>~8`TF>T>8!}!AT>aTF>T>T>TF>T>T>N |8!N 8`8!N AhaSHA256Result@AF6_2,#8A08@`H8`N 8`N @D haSHA1Reset,#@ 8`N H0 @ haSHA1Result8 8; |9,7|`8!A8|!,8@0````!8||!,8A耣```TF>`XTF>TƄ>YT>\T>U>]^Z[_H8!}N 8|1,@@,```!8||),@AHU8,8@@````!8||!,8A耣``K AhaSHA1PadMessage||y,a`!aAA@,$A88`cd; ;T>, ,@@```!,;8|c|8,@|8,@/@`dAHA8{;dT{>, A8`8!}aN cHAK,@AAK|cax8!N 8`axd8!N 8`8!N A haSHA1InputaA!aA!xp %$)T(T̀-!T,TT10T؀TT54TT98TЀT=<A#"}Jx}xTT@c&TT*#.U)@.2#6xTU:>Uk@.W@.cBC#W9@.x'+V@.~xc/C3V1@.~{x7;|#x|3x?CW@.W@.!})Sx|CxFW{@.}jcxx,x~x~.}]Bx|x|x||Z|2T|*T|;xT(4T.|Rx|[x}+x|} b}BU }*U)|KxU (4U .| :x})[x|bx}*J}K}IRT*T}&3xW(4W.|x})Sx} Zx|J|"|"U|*U T(4|KxT.Aa}#x}$2x`"xWW*xW(4JxW.|xx}B|T|BT|*;xT(4|xT.x}x}\R} BW}RW}*})SxU (4}>:xU.|x}Jx}~Z}]RT}JZT}J*3xUK(4|JxU].}x}kx}b|ZU |bU|*}hCxT(4} 2xT.}Lbx}kx}}iZUI}kbUJ}k*}9SxUi(4*BxUl.|Rx})cx|"}&JT|"T*|;xW(4|xW.}f2x|Kx||"|Uf!}D*Uha |CxU\(4U[.}:xxx{|PW;*WxW<(4W;.bxx}[x|};J|JUI|*UJ})SxT(4T.};x}JxJBT}>JT| "}xT (4}:xT.|x})x}^R}&JT})RT|"|SxT(4|BxT.| Rx})x}JZ}'JT})RT | "|SxT (4|2xT .|Rx})[x}Jb}(JT})RT|"}SxT(4} :xT.| Rx})[x}J|JT |RT|"} x#C :|"c| | B|*!Aa!A a(08@H8!P | :N @DhaSHA1ProcessMessageBlock|`|#yaA!!QAЀd, @8``, TF>AT>T>TF>T>T>TF>T> T>  TF> T> T> TF>T>T>8!N cK; 88`8!````?````bhhhTF>hx khh{ha9 \}|)|1|9|A} Y})}Y!$,4<D?L_TT>T>TF>T>T>TF>T> T>  TF> T> T> TF>T>T>AaN |8!N 8`8!N AhaSHA1Result@AF6_2,#8M 8@N @( haMD5Init|`T?aA`}```!aaؐA\,#T8AP,$AH}T~|Tx|@W~@ @8|*|0@AT>|}cE8cK`c8H! 8c|";d@cd|@@4```!H8z@8Tz>;{@ccd|@A|P|8}T>Ki`8!}AaN |}c8cK-`8!}aN @||0@AK8!N A haMD5Update|`8@aA!aA!xp!8ap_ Hb=@$ 8xpx9Jp?`G|#xt}|}=|Bc{*|HP}~aXE2`WY>~ahWZ809x^8x8x~|:}BUe>U`&|Cx|H888x}x'}J}(RU(U)}Kx}'B|H8^Hx}x}I"}Z}hbUhUk}[x}iB}(X8|Xx}cx|*}}U>~?IU80C#9!}cx} }l@8})@x}Kx}>#x}Ue>U`&})cxJ} 8}kx},[x=`k},R=i|2aTɋ; "aTƈ})3x|J8} x|Kx}*:Cp~2}IR~:!U^~{BULAcx~z}8xxJ\W\>~WZ80x~8{xWx}Rw[W[e>WZ`&yx|8~xWx~ZW:W:W9Wx[y8x6xb=W=W9xW8{x~x=vzW>~W80cwx}8ZxxWWe>W`&Zx~z8xXx!WW~Qx}~x8|xxcx}x#~zrWWQxD~~8~xx~0x~}В> &^~N:qZQVQ.=DVP(4:NS~1x=!~7a}8~.x}x}UWMWH,Zx~8xUsx}U~ښVtVp"Ux]~68Ux!~׻x~~~עW>W~x8xx~z}W}.W{(4x[8xwxGwr~VMVH,tx}8|x~x~,~7W7tW9p"~x~{8~yxxW>Wx|8xcxC<W6.W4(4/~ϣx~~z~o8~x}x=EZ:O}~+~=goVM9VH,}x~z8~xx3WtWp"9x~8x3{x}3~ْV٣>V֠3x<~83x~ԣx~J~ԊvWv.W{(4~xy8vxx~`WMWH,x98x#6xF6z=K~rVtVp"4x>m=:a"{8x|x~|W>W{xx;x# 0W'>W 6x{x[zxWz]~WxX(cRxC(~r~L~xx~~ΚV>Vaϩx?(~~x~sx}~E~/:~V/~?V1}x~/~sx~x}}Ȋz}W}'>W{ 6x}~x~4x~ݲ~kW]~WX(~x~x{x~AUWV>WZ~xVuxx~rr4#8W5~W9~x5~xUxT~~V'>V 6SxS~x9x~~GW]~WX(x=xYxCH}:W>W{x;xx;c@ `#PXW~W?~x:|~?C*~pxx}c~/?e[~NV/'>V1 69Y}x~<~|x~x~oW]~WX({xW>~x~4x~>|W>WxW>~x}~UWX~WZxW>[8xx;W;6>oW902{xW>y8]x}J|*WUWP*|x*W>8y*x|b}U|~Ux |cx}*U>|8x}*|C|TTx| T >}8|xp}[Rcx*r}PhW66W402.b~ӣx:~O|>NT>:U~e+8}*x|R}EUEUUJP*|Sx|*T>|c8~lRx*} B}HUH|~UJx }Sx|BT >}H8|Bx|R} }UU}cx|BT>}+8}L*x}kB|b|*|T6T02|+x|2T>|S8} 2x|!}F UFU}*cUJP*|Sx|2T>|C8|Bx|"}U|~Ux |Cx|"T>|+8|*x|Z}UU|Cx}*U>|38|*x||b}EUE6UJ02|Sx|ZT>} #8|"| Rx})Z=`*|J?a}һ|ƲTUTP*}J3x|R|*T>} 8|2 } x| "|T|~Tx |#x|||C8|*}%x|:|`T`Tc|x|d| 8!p}px!Aa!AaN A haMD5Transform,#M HN @ haMD5FinalT?8899 89@8A9k}kt}k9k}iB@B@``!0.)x(}d0.9;;8Uk>}cA0.U>W>}cI}$0.xdx U+F>}cQW>W>C }d0.}c)x(8}d0.9;Uk>}cA}d0.T>Ug>|I|0.xdU>TF>|QW>|0.|)|0.T>|A|0.T>|I|0.TF>|QN N @4haEncodeT?89A88|t98|}D@98|B@h```!U>T>}d@8xdx(U`@.9i|0|8}Jxx 9TƀT8|x}Fx|A.}DHUh>C U>|@T>xdT@.}@x|(|8TT|#x|#x|A.N N @haDecode||#y8!qaA8ap8KYc8pT8x(8 x 8A`K)c88pKac8K 88| x ``! |1Ґx 8cC  8!|1}N 8!N AhaMD5Final@AF7_4,#8M N @ haCRC32InitT?M 88,#8M ,$8 M | |(x|(8B@0``!T>|*xT|(.|x8C T>|*xT|(.|x|N @ haCRC32Update,,#M 8M TF>T>T>cdN @H haCRC32Final,#8A\@8@HPHPX` (hp088`N 8`N @p haSHA384Reset,#@ 8`N H 0 @haSHA384ResultP8T8;T9,o||`8!qA8P|!P,p@$`!8P||!P,pAH````x H@xF x c@a x"aya}ajĘxFyy)ykF { { yJ"yFșy#ʙca͛ΙCϘИҘHH8!}N 8P|1P,@(``!8P||)P,AHU8P,p@````!8P||!P,pAH```K AhaSHA384PadMessage||y,a`!aAA@,$A88Ԁc;T;T>, ,@@```!,;P8P|c|@,8@@H,8HAdP,AHA8{;T{>, A8`8!}aN cHAK؀P,AAK|cax8!N 8`ax8!N 8`8!N A haSHA384InputaA!a!!xpx (0 (8@08HP@HX`PXhp`hxpx99G8T8' A} !9 (G0 A(8G@0A8HGP@AH88XG`PAXhGp`AhxGpAxGAGAGAGAGAGA`!y$Hx 9'9U+>U >;;W>W>;gX;PWj>W>{ރ}@}&H{E{;x}FP}fXyU)CxW>UJKxUk@.SxU8}K[x}@8}hCx}9*C `y$}H9?9'8U+>T>89'T>U)>;X9gPW>Uk>{|(}&H{Ey9x}FP}fXxU)+xU>UJ|KxUi@.|Sx8} }`}IKx8}(Cx}9*8`!xHxHx 9E y_Hy,$9E}@*`}$0*yGH8y y т*}`*y?y>}JZxyhy)x}Rx}*Zx}(}jb} Z}9*8C xHxH x 9 #(CyHyx$c8|0**;`OxH8a0xxт~**{{Zxxh{~x|xx|ƪ||)*i88p|H8``!x 8x{\$xp~xxx9x{~**Vx{Rx{{ xP8}8~xZxca=`|Za{aLc8|H8C tx 8x#cx$xp( ~׺xx0xZx8P|0*{|0*{~zxRx|{ |2xP8|*}8ax|~"x||xA|Z|*|"|||Ra|b!|2 |:(|J0|8!8N @ haSHA384ProcessMessageBlock|`|#y!AL, @,, A8`88.|dp8|x$|p| 8| *8}88```!|6y$|px` 8U'8}8D8|0*C |6y$ 88!}8|0*|6N K8P8| x ``! |Ґx 8cC 8 8|Ґ@HK|px8!N 8`px8!N A|haSHA384Result@AF6_2,#8A\@8@HPHPX` (hp088`N 8`N @p haSHA512Reset,#@ 8`N H 0 @haSHA512ResultP8T8;T9,o||`8!qA8P|!P,p@$`!8P||!P,pAH````x H@xF x c@a x"aya}ajĘxFyy)ykF { { yJ"yFșy#ʙca͛ΙCϘИҘHH8!}N 8P|1P,@(``!8P||)P,AHU8P,p@````!8P||!P,pAH```K AhaSHA512PadMessage||y,a`!aAA@,$A88Ԁc;T;T>, ,@@```!,;P8P|c|@,8@@H,8HAdP,AHA8{;T{>, A8`8!}aN cHAK؀P,AAK|cax8!N 8`ax8!N 8`8!N A haSHA512InputaA!a!!xpx (0 (8@08HP@HX`PXhp`hxpx99G8T8' A} !9 (G0 A(8G@0A8HGP@AH88XG`PAXhGp`AhxGpAxGAGAGAGAGAGA`!y$Hx 9'9U+>U >;;W>W>;gX;PWj>W>{ރ}@}&H{E{;x}FP}fXyU)CxW>UJKxUk@.SxU8}K[x}@8}hCx}9*C `y$}H9?9'8U+>T>89'T>U)>;X9gPW>Uk>{|(}&H{Ey9x}FP}fXxU)+xU>UJ|KxUi@.|Sx8} }`}IKx8}(Cx}9*8`!xHxHx 9E y_Hy,$9E}@*`}$0*yGH8y y т*}`*y?y>}JZxyhy)x}Rx}*Zx}(}jb} Z}9*8C xHxH x 9 #(CyHyx$c8|0**;`OxH8a0xxт~**{{Zxxh{~x|xx|ƪ||)*i88p|H8``!x 8x{\$xp~xxx9x{~**Vx{Rx{{ xP8}8~xZxca=`|Za{aLc8|H8C tx 8x#cx$xp( ~׺xx0xZx8P|0*{|0*{~zxRx|{ |2xP8|*}8ax|~"x||xA|Z|*|"|||Ra|b!|2 |:(|J0|8!8N @ haSHA512ProcessMessageBlock|`|#y!AL, @,, A8`88>|dp8|x$|p| 8| *8}88```!|6y$|px` 8U'8}8D8|0*C |6y$ 88!}8|0*|6N K8P8| x ``! |Ґx 8cC 8 8|Ґ@HK|px8!N 8`px8!N A|haSHA512Result@AF6_2A( L| N A( L| N A( L| N (@ 8`N T>Hk, @rsecedv1_encode_default_v1(@ 8`N T>Hn @rsecddv1_decode_default_v1T`?<`A|,$8Ah|0T~}2xd}&8P|P8`,,/A4|2@9N `@9N N N 8`N 8`N @rseceb64l_encbase64_length(,$A|8T`AhT>,%9#|PU(>AH|0,&=@,8`|@88, =@ N N `8`N 8`N 8`N 8`N @rsecdb64l_decbase64_length||y```T>!aA(,+A|(@A8tacA8tK%,|PP@HcT>ae|`|t| @AH`8`9>8`} 888c9@, @x A|@}J8| B@B@```!|.|dPP8'|xdp!rT>T }fHep!qT&U)>}`J}fXeq!rTU)Ѿ}`J|X!rU)|H8C |.|dPP|prT>T| pqT&T>|"| qrTTѾ|"| rT| 8yd||.89?ap|hPr"8cJ|P(apTc|feapqTc&T>|c"|feaqrTcTѾ|c"|fearTc|fe@8=8`(cpT8|(pT&|(;@8`8=8`p8T>T}|(pqT&T>|2|(qT|(t8!N t8`8!}K(A`t8`8!}Kc(@K8`8!}K8`8!}N 8`8!N 8`8!N Arseceb64_encode_base64,#@ 8`N T>Hel @rsecdb64_decode_base64|}&a9(`T>T>`c8!!h| `e```!88|8@C c| ```!8c8|(@C |*y;(Ax.=pxA<8pA(%A,x8A( A888aK`,;A8apaq8vcz!U 6}}lRxAwaqU>|bxvT6|xzT>}x}T6} xT>xT6}@xwT>}`xH`8ax8cH`8a8cH`8!|} aN 8ap8cH`8ax8cHe`8a8cHm`8!|} KA`88acKe`,;AKh@088ax8KA`,A8( AK88axK`,AK8apccK`8A(%AK;88b`888cH`(=p.=xAKL C RSecPEncrypt|}&a9(`T>T>`c8!!h| `e```!88|8@C c| ```!8c8|(@C |*y;(Ax.=pxA<8pA(%A,x8A( A888aK=`,;A8aaq8vcz!U 6}}lRxAwaqU>|bxvT6|xzT>}x}T6} xT>xT6}@xwT>}`xH1`8ax8cH9`8ap8cH`8!|} aN 8a8cH`8ax8cH`8ap8cH`8!|} KA`88acKԥ`,;AKh@088ax8Kԁ`,A8( AK88axKY`,AK8apccK9`8A(%AK;88b`888cH`(=p.=xAKL C RSecPDecrypt99@i|aA9 9`^!9(;k;;};q;`aA;@:@V!: :9xp8958C; &!;N::):::`pAr9@ԙ!qas99fta9 u9`A9!: :@Ϛ9+a :IA9@ uvwaA!a!99 Pa!AaA9@|A988A9A9@y!9 ę9;Q8Ę87A9@!9 _a9`M9n888A9@@!9 F89D88A9@-a9`0!9 9889h9әA:*9d: 8p™A8v!řa9 9@ڙ9›Ι9`;՘8`";Y9̙!ęAǚ9@:a̙9`9Xϙ!Л9Ka;`9]Aӛ;+:aڙ;9a;`98`^ٛ;;9-a;`; 9a:;؛蛁9ta;`ڙ9A8`;;7;a;`K9ۙ9;:a;a;`9י9}ݘ8`W;a;`9 9:a;`a8`99a;`ܙ9.a;`ua;`a;`: w;@B$A ; b;a :94! : A;@ܛ!;M:!; 9c/! : ٛA;@!;9؛!8`P; Ӛ(! A;@0:+!0;f:ș29k: Y?A;@=a 9D!"8`; %1;':z3A;@-9l!5: 9:AAa:@b9؛A;@%&,A#;@{A-a)!.46A*!7: e8::ɘ;@BC9&D!Q::99NUA[]:0:`R:N`:JE9L9i:Κaq:` S:Ga:3F9M9hm:: auT:b:ZG9ΙO:`9ǚ!s: nV:d:™H9:ߚawPc:@:` W:e:I9"_9klX:Bf:bJ9mpr!t: ֚Y:욡g:ڙKv:h9axZ:j:y\:8o:^:z9A:@:`3|}9|!~9A:@a{:`˙99NA:@9ۛ9A:@h9 a9ߚA:@9ÙAa9A:@9 9yA:@L99-A:@O9ř9A:@V9TA:@H9AA:@'9A:@9A:@G9PA:@99ؙ99Ǚ9&: I8A!9::@_9A̚!: ?8m9:A:@ϙ9К!: 89:A:@9!0C$8@+9#8!P8DaQ%8y,9JI8HR8AST&84-9VJ8U8[Y'8e.9 K8V89(8o/9qL8W8)29ޘ78٘M8ƘX8j39㘁88fN849:859Ԙ<869=899L@8;>9A?9<B90E9F9G9H9``8c8a9j!q9 9@Krva8an9`Jdt8_8VAZ9@\9 b8ϙa9`!gu8A[9@]9e8a9`=w^9옡{8f8 a9`AkA_9#|8h8-a9`tA}8ęi8a9`a~l8ea9`Fm8ao8[p8s8Ox8?y8z8ޘ8i8Ř88E8+9`8ۛ!A89@89a9` 8y8KA9@9 ,8da9`]88SA9@?8AÙa9`I8nA9@08˜șa9`8"A9@!a9`8RA9@a9`ݘ8A9@ϙa9`84A9@Fa9`8A9@)a9`n8A9@>a9`8$Aa9`əa9`a9`}a9`a9`a8 8Aܙ!8@A9!9@ߘ888晁9[Aޙᘡ8t8x8ۛ!8O887!aΘ8Ә88ܘ8˜ژ8*☡8888ژ8=8888<8F888f8֘88|88 8888t88p;8i8)9 HA  9@94;_8A!9 ٙ9;8;8!9 BA 9@(8; 8)79n! 9 E*8ϛ;9!8OA89r! !9 ;'"808:9X#8;!A$,/%&8?;Ø1!2a3A5'+8j;a6<-8v4;՘.9;;;5=;J>;?A9 ˜P9@;RaSXa!D9 әAT9@@;!E9 A_9@ B;!F9 A`9@C!G9 wAb9@m!H9 Ap9@c!I9 As9@!J9 ʙAt9@!K9 !L9 !M9 Y!N9 3!O9 !Q9 9!R9 !U9 0!V9 !W9 #!Y9 !Z9 ![9 !\9 ?!]9 !^!c9 =!d9 !e9 6!f9 !g9 >!h9 !i9 !j9 !k9 t!l9 -!m9 n!n9 !o9 !q9 !rAu9@;gvA;L;`HaAw9@f;i;a;`Ax9@n; a;`;Ay9@e;ݛa;`!Az9@I;Gaa;`ޛA{9@E;)a;`VA|9@;ܛaA}9@;A~9@;͙A9@-;A9@;A9@d;MA9@G;A9@Û;A9@K;A9@;A9@A9@:A;`7;^Ƙ;;Mř!8`a;`;Ǜ;;ԛ!јa8`̛a;`?;o;a;a8`ٛa;`;ě;;aיaa;1a;`;;䛡a;`曡;t;;՛a;`;;\;ћa;`;;ߛڛa;`ܛ;N;a;`;Л؛a;|a囡;.;B;⛡8`[;f;!;ޙaa8`9;T;;  a8`c;P;;xa8`Û;;a8`؛;;a8`;ԛ ;a8`); ;Oa8`;! ; a8`;a8`+;a8`>;Øa8`;a8`ě;a8`a8`8a8`5a8` a8`a8`Fa8`aa8`a8` a 8`$;(A,;; a2@a!8`-;L;!<; șa?Ba"8`.;!=; AEHaIa#8`Ǜ/;!>; $J!LATa%8`0;k!A; Xa&8`1;!S; Ra'8`43;֛!U; ۘa)8`雁4;!Va*8`w;|a+aC8`ڛ5;ŘaD8`@6;}aF8`Û7;aG8`8;IaK8`Z9;aM8`:YaN8`DaO8`uaP8`)aQ8`aRaW8`EaZ8`;}!![\; 1dja]8`n;ak!; ]u!va^8`So;!; a_8`p;!; &a`8`&q;!aa8`r;ab8`+s;cac8`t;ae8`1x;af8`!y;Oag8`z;ah8`{;ai8`j|; al8`䛁};ama8`V~;a8`;a8`;a8`A;a8`;Ha8`a8`a;a!8`֚; Aa;a8`(a!; !;a8`a!; ;ma8` !; šÛ;a8`!; ;Ҙa8`כ!; P;a8`;a8`;Ga8`՛;a8`;fa8` ;Sa8`ݛ;.a8`ۛ;a8`T;a8`aa8`);a8`0a8`a8`˜a8`a8`Fa˛!; ]a8`;2Кa;!͘a8`ś;ʛ!; 5!;͘a8`!;'!; ڛ0;њa8`fћ!; B;ߛ;a8`ћ!ۛ;ڛ!; W;ra8`՛;!; l;Ea8`;!; Ka8`r!; Ϙa8`!; ֘a8`!; 6a8` !; xa8`!; ca8`!; a8`!; %a8`!a8`a8`Ia8`Иa;a 8`Q;֚;i a a 8`;; a8`;?/;AA#a8`V;Λ1;=a8`5;77;ua8`O;ٛ8;a8`I;9;Na8`;K:;aa$8` ;;;Ҙa%8`!;<;ݘa&8`(";R>a'8`ě,;oa(8`h-;a)8`.?a*8`a+a28`a38`a48`a58`a6AA; aO;I;|aC8`aVYa]B;śc;ꛁ@aS8`$Z;abD; d;LaT8`Gg[sE;e;1aU8`›lAt;@F;4f;[aW8`Gh;H;aX8`Zi;rI;a\8`j;qJ;a^8`՛k;Ka_8`L;\m;a8`M;n;a8`>N;țo;a`8`2P;p;0a8`hQ;q;aaRr;euAv:Na8`;@-;w|{a8`~:Ax;@Aaa8`:AyAz;@ǘa8`!: aA};@Ϙa8`:AA~;@a8`:<A;@a8`:nA;@ a8`:GAa8`:a8`:1a8`@:laa8`q:a8`ؚ:a8`:a8`:ߘa8`:5a8`ܘa:;@Ea8`;RÛ!Ț:}A;@՘a8`ޛ;aҘ֚:A;@ۘaƛ;a8`ښ:A;@;јa8`☁:ڛA;@}Ԙ;a8`:9A;@y;a8`Ú:bA;@;*a8`:қA;@{;a8`:KA:::š:Y:I:a:W:6:: :ɘaa8``:::`g:?:wa8`ך::Ka:`^:٘a8`D:]:a:`:oa8`:":&a!:`ݚa8`:T:a":`B a8`K:嚡: a$:`T A  :a8`:4aa%:`M:!a:#&A'( :a/:5::S:9]:`A.0: :Ԙ6:>Kak:`Q7:o:Oa~:`dF:R)a*:`G:a+:`H:a,:`I:a-:`՚J:@a1:`N:da2:`P:'a3:`Q:a4:`~R:a5T:Ga8:`[U:a9:`V:ʚa;:`W:ta<:`X:ۚa=:`Y:a?:`<Z:a@:`[:aA:`\:aB:`^:aC:`}_aD:`aEaL:`aM:ab:`]!`::!cf: aad:`Z:̛gw:!mapaej:ar:`ǚz:Λal:ah:`{:b!䚁n:aia}|a:`}q:Ӛ:a:`s:?:ؚa:`ݚt:a:`u:Fa:`*v:a:`dx:8a:`Hya:a:`:Ța՚:::暁::|::@:l:㚁Ś:`=:: &:!a:`:r:B!a:`A:: a:`К::ךa:`E:8:a:`::ta:`::a:`[:a:`O:a:`:>aa̚::`:ua:`:a:`x:a:`:a:` :ɚa:`a˚a:`њa:`ٚa:`5!:: : 盡:*:@a:`:k!: ::A:@ך⚡:Κa:`К:!ۚ!隡:!: a:`:E:4a !#: +:aܚ:隁ߚa/:`#!C: ?::;P:ښa=:`ș!O: ::ҚaF:`!!:Ӛa::T:횡:::P:ʚ:n: A :@t:`!:E:G$:: (a,aa?:`DAA:@::a!: r:` :`A:@,:1:a4:`A:@! : ֚ :<:a5:`:AA>:@!!!-: Ӛa7:`A:A":@Ě*0!2a8:`A%:@ 369a:aD:`A&:@;A@BaE:` LA':@aG:`A):@^aH:`A+:@aI:`gA.:@aJ:`A1aK!Q:ym8ON: k;:`;AR:[Y:n8!S: ٛ};aM:`8FhZ: 8!T: ;GaX:_:n8!W;!: a:`̚a:08;[8!: i:V:8Pa;w:`ݚ!: o:ߚ:^8ꛁUq8!V\:!]!^`abd:refgjl:fprsuc:`aa8: !:,Atz9`88a{:`ʘ8v:隁:"a: 1a9`Ϙ8aa:`w:!:S88a:`a9`x:L:]|8~a:` y: :(8TAa:`Ě:z:58ۚa:`:!A8a:`aA8a:`(!aŘ8FȚa:`˚ʘ8 a:a9`8!: 8ט8K:\a9`$ߚ!8d: 8V9ƚ:ja9`A!8: L8ә8 :ʙa9`!8: <87::a9`89)! 8: :a9`88!!:~9ٚ:Y̚!͙aՙטٚ:xژۛ!ݚ:}ޛ!⚁:ꚁ:': :Ϛ89`a a$8o8c?aJA :`9K8Ba9`q:J8 8a%:`a9`8Ø蘡 8 ;`8aa9`>88a9`88t88ؚa':`ia#9`<88@9㘡8a(9`՘B8G8I혡8ڙa)9`a&FIa+9`LaMQa,9`a19`oa59`*a69`Йa79`a>9`_aER89`Af98jrx8;`Fy~TaV8&8XY9`;9ĘZa[8:@q\_8;`aac88dAg9`;;T:>iajln:`9aqt8:@8;`-A9@;g.A2888;9`;A]; :`b;@.;"A*-/: 0A34a9:=ACDaHNOPaUAWA^eahkmoApsuAv{9|!A9@; :38D9f:@!: 8E:;`9h8:ޘ8;R9!ax:`u9`z!~9 }SwA!Aayza{|a}!!( A( @T!A a    ( 0! 8A @a H P X ` h8! pN `8a8H`8ap88HF`88ap88 xHF`8` 8! p}px!Aa!AaN A;rsecgl_get_likeys9@9`|aA9 ;@!;u8P99,;;aA;`;@/!; ;:xp:1:M8o:h!1:.:`L:@x: :9̙Arat9@rva;9`I!q9 \9%8;ՙAa9@9`ps9|;uwaA!aA!!a9 A9@ϙaa9`a `8mA;'`8a8!: 8;988!8`8:@雡ƙ: 4;;;`ǘ8I8&a98lA!:@F: ͛ʛaȘ8r8`ЛИ;`;Z:`A;ژ88!89ašA: 8`˛ԙA:@;a֙a;@k;a;`; jřǛ;"!͘aΘњAҘӛ;Gaכ!;`; A;@9!ޛ;:a!:p8A;@9;3::8A;@9k; ;::A;@9>!;:88A;@ʙ9 ; ;f:e:] 9A:{AA89v!:89a::٘9њ:Қ ::M  8g9+ 9)9@9 ::":1:A$(89ؚ::D#::.:%+89@H::k-:v0:*9%,8<::*3:4:898ٙ@:Ś:&6:9E=8:-AB':y9@:7:~ :9 !2:O:b)/85::Z8i>8#?9&:;:A:AC9@ۚ1<:˚F9`M8/:MNO9IA`9@H8Ș8WaϚA:@`a8`Ța:`!: 8̚A:@a8`֚!: ͘8LΚA:@qa8`YЙҘ8 !Ӛ՘a8`8.aa8`8a8`8Raݘ88T8ܘ8J8ޘ8888Ř8887888`39 8(8a;gA!:C9@a!8`9 n8A;=;A9@a8`$!9 Ș8 ;aa8`k!9 8   ;a8`!9 u8 aa8`!9 8ݙAA%*a 8`X!9 ٘86a 8`u!9 8a8`4!9 a8`T!9 a8`! 9 a!!!W9 8!"9 !#9 !$9 i!&9 g!'9 ͙!)9 1A7899@8U,;eE;ԙ!+9 YH8A<9@zC8ݚ@A;!-9 $I8ZA=9@ǘD8BZ;!.9 J8YA>9@#F8ARa\!/9 ǘK8 A?GAS9@8I!09 *L8Jj;z;A[9@Ę8!29 M8A]9@^!39 N8\!49 O8!59 P8d!69 Q8!89 T8!:9 V8!;X8Y8 A`e8a9@n9dl;8p8Ab9@ 9v;8q8Ac9@ڙ9~8+r8cAf9@9ڛA^8Rs8Ag9@a8&t8Ah9@X_8u8Ai9@ޘow88Ak9@x8昡8'AmA{9@y88A|9@Ϙ}8 86A8878!89,8;z;9ę9;8<9֛;998Ù;9 998A;v99&8A;99 8!!;998;9ę98Й9ћҙ9]8998:ϙ9Z89(;/9;8;䛡;9>;38ƛ֙Aޛՙ9u;^8n;l9;8٘9 ;68ҙ9h;! 9И;49m;9V;'9y;g9O99c99 9 9! 9= 999k9^;L8;9;kj;!"(;$78ݙ9 ;4-;Q+;p?8u9%;d!0A;;;E8 9;ia2a4@;JI8T94&;98a:F;Z89؛_;a<CR;s8[ 90f;ng;H$8>!/B#'8)8*8꘡,38 .8A18586898=8'>;NX8aDG;;.K^H;@Y88LQ;ck;ӚAaJ[86S;V;ܛM;՛h\8FiT;y;O;řan]8rU;;Pw`8*vW;!x;ߘb8;hԘdp8ۛ;c8+;,e8;јl8;cm8;o8;q8{;똡t8;u;z{;X;A;AA}A;@ޛ|;z;s!;!A;@s~;蛡;_!A;@;;F!aA;@];=;1a!A;@;ۛ;AA;@;Л;A;;;;L;;;O;x;w;/;-;ٛ;5;;y;F;Ǜ;\͛;;@ܛ;&a;ޛ:v;;A;`L;'A;@K;";қ;Ӛ-.:_;{A;@1;ۛ;V;a;`X3:A;@>2;͛Ǜ;;[6;Fљ֚ӛ;՛A;;@Uaߛޛ;⛁;G;A曁;;;K;6;%;3 ;0;;!;8/;k9;) 8;:YAꛡ!;`;O8:;a;`;8: ;Sa;:'8;; !혁(8+ :Л;ڛ;a*88̚$;:+;H;8 a:<8d;/",5;B ;4:=8E>;;r#;);>7;:^I:>f;r}:O;8!R?:W:g;~:t;8H:[:̛l;:m;;`!wX:M^:p;Y:D@;9 ښ\:]a:v;ҚJB|:s`:j:;CKU:}b:en:X;FAGLk:q:-EAMNaPo: :O!Su:[::A:zD!9 A_8ÚATAm;`9@A:@ja9`5!Yh8Ad!9 9@AV;.Ay:@i8ac!9 AAx8:a9`!!9 wa;瘁z8;ܛA;:9@a:W;`r{8ƛ;*:ɛ;Q!QaZA]8AeaAs8!a!8!8aaA9`888Ș8;љ;^;֚A;:!ݘ: ;`&aĘ89Sƛ:;ț:@: ˚̛aϘ8)9@Ԛ9`8ؚA;;/Aߚ!;@b;Ø!9 ;#89::!a:``;`͙89ۚ:=;?AA:@\: !98a영:aaaA!ΙÙЙ՘;@n9@9@!; 89 x9:A㚁9`8;y;!A;AA! ! yaz{|}~(0( A( @T@HP!XA`ahpx!Aa8!N 8a 8H`8ap8 8H%9`88ap8c8 xH%`; 8!8`}px!Aa!AaN A!hrsecgls_get_likeys_sapinst|T>88!q 8pap8b`H$-`8ap8cH"5`8`}ap8!N Ap!rsecedv1_encode_default_v1@AF11_1|`(a`j`!aA ,%AT>88paaDpK-,@;`8b`89A8%;88} |`@ },<=@d;```!8|>HA48C 8`8!}aN ,@|pAA4T:|T:| Pc;|@,@ *9JALp 8`K,|&p@D,;*xT 6KxA9JAKAp 8`KD,|p@D,;*x T02}'xA9JAKpAp 8`K,x@L|3xAp 8`KW>Kp8`8! }N 8`8!N 8`8!N ALrsecdb64_decode_base64@AF12_6|T>88!q 8pap8b`H `8ap8cH `8`}ap8!N Ap!rsecddv1_decode_default_v1@AF13_28`8 aA!aA!xp!:b0`$| ZYX90WV[UTSRQ3PSOsNMLKJIsHSG3FEDCBAs@N?.>=<`!}pP,A}P,A}P,A}P,A}P,Ap}P,A\}P,AH}P,A4}P,A }P,A }P,A}P,A}P,A}P,A}P,A}P,A}P,A}`P,Al}XP,AX}PP,AD}HP,A0}@P,A}8P,A}0P,A}(P,A}P,A}xP,A}xP,A}xP,A}xP,Al}xP,AT}xP,@ 9p8c8C X8`(8@809 99D|e8xdx6dxE|Z| |2|R`!|pxy ST}lx9`8}`} @ep!}+`0@q!}?`0[x@r!}?`0}kx@s!}?`0}kxg8C 8c(#AL!Aa !(A0a8@HPX8!`N @pK\9K9K9K9K9K9K9K9K9K9Kx9Kp9Kh9K`9KX9KP9KH9K@9 K89 K09 K(9 K 9 K9K9K9K9K9K9K9K9K9K @spinit``b|aA.!a,@ 88x$8|P 88xdx$x° (08@HPX`hp} ```!|8cC 888xcdx$8`808@88`8|gx>$B|8^| y $|}ZcB@d```!;j|pWj:x`{p}k8U:|@$}DRP8, AhX}`.jcx}HYI9)C 9J8UI:|p}Jpx`Wk:}(|P@$}$JH8, A}H8}eX.}I[x}(9A08c(#A8!}AaN 8c8H`K Apperminit`,;0|!,AxAd, A8!}N 8 (8K88`K88!}N px8!N K,8AK| A encode_init89#aA!0!| Gx ```! | QҐx G 9)C 䐩 908o85}kQҐ8`9H9i*| 889)U*})p})}ER}$H}>P8(99)},pU)H``!}J949*;H},p}dXWU)}~88C }}eJ9J:04}Lp;}@UIWF8}X8}g90}EJ;4|@9)U(|P84890= *88T88a>g99!;p| `!}[B,;@| @}J9}]PI9)C 9W97}9J9JPB@I9);jB@|````!UI,=خy9)AD(HXz:{${Pخ\@PY{<d.pxCٮ9;jC U ,=y ADX}]R}=Jy=$y<}xW>%%|;x}3xTx|beTx|xxe{~ x|x|x}x}x})x%}xW>}JCxE&})CxW>}kKxeF'}JKx%}Sxe|;xE3xeTx|Txe|b}xcx{ cx|cx|cx} x}x})x%}x}Ix%%}x}hxGW>} SxE}?[x%|;x}3xTx|beTx|xxe{~ x|x|x}x}x})x%}xW>}JCxE&})CxW>}kKxeF'}JKx%}Sxe|;xe3xETx|TxE|b}xcx{ x|x|x}x}x})x%}x}hxeW>'}Kx%}]xx}kxe|;xE3xeTx|Txe|x}xe{ }x|cx|cx} x}x})x%}xW>}JxE&} xU>}kxeF}@xExe|xxcU`x|dUgx|:|;xxe|x}x|x}(x|x%a}Hx|x|CxE|Cx|3x|3x|xc|`x}#xeN @permuteT`at8%xswTF>ppu|paq|FprFpvc8apK8!}!Aa!AaN c88pKatvcu!qpArTcT@.sTU)TwUJ@.|c});x}Sx|||+x|g;x|c3x}Kx|+x|+x|cxK)|~8{x`xK`z9|cx8`vK`wx8K`x~x8 Kx{xx8(KZx9xCx80K`xtxâx88K`w6xCx8@K`ux~x8HKu`tSx~Úx8PKax8X{x~CxKM~x8`9x~cxK9~x8hxcxK%~x8pZx#xK`x8xx`~K xWF>t8CxaswcT`F>p|gpq|cFparpuFpv8apK8!}Aa!AaN A do_encode_v1|``aA``!aA!!(8x8pK8xa|~}!yxAzTcT@.T{U)TUJ@.|c}(Cx|Sx|| |3x|e+x|cKx}&3x|Cx|3x|cxKE8p|{Zcx`wK-`y8h|cx`uK`v~x8`K`w~x8XK{xZx8PcxK9xx8H#xK`wSx8@cxK`vx88#xK`tqx80~cxK`s2x8(~xK}8 ~xZx~#xKi8~xx~CxKU8~x{xCxKA8~`x9xxK-c@xcx`KxWF>a|%x{p}8TF>x|pay|FpzFp~c8axK,<Acc8Kp8!}!Aa!AaN A do_decode_v1|;`aAT>`0T>!a8`puqwxy}K(<8A 8aKS`88aK(A8c|tc8a8p|;x$```!K;;c8a8p|?@A|{P88T?A,8a8xx8Kc8xcEK5`8!P}AaN ,:@A `8!P}N 8acKR`88aK(AK Arsecebv1__encode_block_v1|;`aAT>`0T>!a8`puqwxy}K(<8A 8aKQ`88aK(A8;|t8a8p|;x$````!;xcKA;8a8p|?@A|{P88T?A$8a8x8Kc8xcEKU`8!P}AaN ,:@A `8!P}N 8acKP`88aK(AK Arsecdbv1__decode_block_v1|T>`~(?T>8!QxpA 8,?p@8H8apccKP `8,?A(%Ad8apx8cK8ax8cKu8ap8cK8!}N ,?Al88axKO}`8ap8cK98ax8cK8ap8cK8!}N (%A8ap8xcKK( Axrsecte__t_encryptiC|T>`~(?T>8!QxpA 8,?p@8H8apccKNI`8,?A(%Ad8apx8cK8ax8cK8ap8cK8!}N ,?Al88axKM`8ap8cKY8ax8cKe8ap8cK18!}N (%A8ap8xcKK( Axrsectd__t_decryptiC;`|aAT>`0(=`{T>!Apquywx}A@,=@888aKL]`8`K8a8KY8a8KM(A8z|@|ctc8x|cx|$;cc@d8ac8K8ac8K8ac8Km;x|?@@;{$c|P8x|@A8K8ac8K%8ac8KU8ac8K;x|?@@$;{$c|P8x|@@K8||P88cTz?AL8a8pp8K8a8p8K8a8p8Kc8pcEK8!}AaN ,:@8!}K8(%AD88a8KJ`8`Kߩ8a8K}8a8Kq(AK$,=@8K8acdcKJ1`,=A8(%AK8K Arsecte__t_encryptoC|;T>aA`(=0`{`!1T>puqwxA,8,=x@888aKII`8`Kq8x8aKE88aK9(A\8c|t8a8c|x$;f``!K8ac8Ka8ac8K{$8a8|P| @@;|?@@;cK||P88cTz?AL8a8pp8K8a8p8K8a8p8Kc8pcEKY8!}AaN c88K!;8a8|?@@P;cK,:@L8!}K(%AL88a8KG`8`Kܵ8x8aK݉88aK}(AKD,=@8K8axccdKG5`8,=A(%AK Arsectd__t_decryptoC,$@ 8`N Tc>T>T>U>U)>H\ @( haHMACAll,$@ 8`N Tc>T>H  @ haHMACInit,#@ 8`N T>HL @ haHMACUpdate,%@ 8`N Tc>T>H @ haHMACFinal|``T>!apxap|d8apK`T|>p,|@@@0ccKD`cP8!@}H8apADccKD`|}p|PT>H`cP8!@}HcK˹`,T|>@l8apK`T|>,@Tc8`tKD-`atp|@@;Pc8!@}H(|P|~T>H`cP8!@}N AhaIHMAC_DetermineKey0|`h`T>9 `8!`T>9Apa`9K,h`@  8!}N Ap haHMACAll_MD5|`h`T>9 `8!`T>9Apa`9KA,`h@r 8!}N AxhaHMACAll_SHA1|`h`T>9 `8!`T>9Apa`9K,`h@px 8!}N AhaHMACAll_SHA256|`h`T>9 `8!`T>9Apa`9K,`h@,px ( 8!}N AhaHMACAll_SHA384|9`T>`T>`d!a9Ap`9 K),8@H8`| ````!8 ; C  8!}N AhaHMACAll_SHA512||a^aAaT>!T>a9U>a!8acKƕ`T`>,@$8a|`ۖ8|(A,A(|P,;T>; T>@Acx::cc8K,@lac8K),@T:s8apVF>p8V>8V>qV>rK,@8`88K,@8at8ceK>`8a8ceK>u`c4c8tcec99 9AK,8@8atceK>1` c#8t{% B@,8`!8c|(8t|(|x|)xe C 8a|(:|(|4@|x|)Ah8|@|{T`>@hbe|~8K=`|7@A8` 8!}a!AaN ceK:;cc8K),c@Da8KQ,:@,s8apVF>p8V>q8V>V>rK,8@8`8K=,8@8atceK<`8a8ceK<`cec8tc6c99 9A`!K,8@|8atceK@ be|~K<`|5@@XKceKa 8!}!AaN A8`!cc8K,c@a8K,;9@!s8apW F>p8W&>q8W8>W >rKm,8@|8`8K,8@d8atceK; `8a8ceK:`8|@8|T>@ be|~K:`|9@@$K ceKa 8!|!AaN ```!cc8KQ,c@a8Ky,;9@!s8apW F>p8W&>q8W8>W >rK=,8@L8`8Ke,8@48atceK9`8a8ceK9`8|@8|T>@ be|~K9`|9@@K ceK8` 8!}!AaN ` 8!}!AN A haPBKDF2T>||3y!@(8`08! }N ,?8A|~ccK`,T`>@c8cK``,@8o8,%AL8h6p|(@@0``!888h6|(@A8pcKE`T`>08! `}K$ AhaHMACInit@AF12_2|T~>``T>!K`,T`>A(``8!P}N 88apK7`88, AH8h\|@@,`!888h\|@Ac K`T`?@Xc8K`,T`>@8c8pcK`,T`>@cK`T`>,@,>A,=Ad8b88|:@x ````! |g1Ґx d8C 萤 `|1ҐKcK`,T`>@xKcK`,T`>@\Kd AhaHMACFinal@AF13_4|!,%T>A , @8`8!pN `d``K`Tc>8!p}N AThaHMACUpdate@AF14_3|,&!ax@8`8!N ,*T>AT>,?A ,%@8`8!N A|c`U>U=>aFKi,A 8!}N axcKu,@ccK8!}N AhaHMACAll@AF15_1PA( L| N |`($`}! A,$8A\($88a,@ @ K `8ac8Ky`8p8aKi`cp| P,@@,=AK9A((# `~A|e8ac8#K}`8aK`W>8a8K`8ac8K`8p8aK`8`p| P,@ P8!@}N a `8K-`8`P8!@}N a `c8K`8`P8!@}N 8`(P8!@}N a `8KÝ`8`(P8!@}N a``8Ki`8`(P8!@}N a``8lK1`8`(P8!@}N a``8PK`8`(P8!@}N 88`(88!@ N ArsecssfsParseKeyCompound|}&aA`,#!```!ޱAh8bx8K}A(|zyA8a;!88 cFK영A(8|",#|xx@,5N@D,#A(, A, A, @t;9|9@@ AT:`!:y;9,##|A:A:|9@@Ԉ, A A|KAt, @h:8:o```!8yv8:,#A`(@X:|$@`@@88ap8 K쌍A(,@$}, A8a}KgA(K88ap8KQA(,@(, A8aKfA(~K88ap8 KA(,@(z, Ap8azKfA(}K\88ap8KA(,@<~, A08a~KfYA(|K;!8a88 cFKQA(8,#@.~@K:K88ap|8|!K8a;!88 cFKA(8,#@.~K:.~KcCKA(,#@~,#@},#@x|,#@`88`!Z!`8!!P} |!AaN KA(KKA(KKA(KlKA(KT8a;!88 cFKA(8,#@b~.AK:KcCKA(8`!`!Z8!!P|} K48`!`8!!P}AaN bx8{0Kd5A(8{Kd%A(~8{KdA(}8{YKdA(|8`!`8!!P}aN C (GetSAPFileVersion2010-01-26BR*Tools support for Oracle 11g2010-04-29Error in BRSPACE for options -f|-file and -a5|-autoextend5BRSPACE support for index compression2010-07-28BR*Tools fail with segmentation fault (core dump)Rebuild of indexes after recovery fails with BR1179EParallel incremental backup on disk2010-08-25No incremental backup with patch 6 possible2010-10-06Oracle error messages at index compression2010-10-27BR*Tools support for eSourcing databases2010-11-24MISSING_STATISTICS alert straight after update statistics2011-01-27Long running time of BRCONNECT function 'check'Corrections in BR*Tools regarding Oracle 11g2011-03-02Core dump in BRARCHIVE during applying of archivelog files2011-05-04Syntax error in the 'keep' option in RMAN call2011-06-30Corrections in BR*Tools 7.20 patch 152011-07-28Corrections in BR*Tools 7.20 patch 162011-08-26BRBACKUP 7.20 EXT fails on Windows with BR0274E2011-09-07BR*Tools support for Oracle ASM and Exadata2011-10-28Corrections in BR*Tools 7.20 patch 19BR*Tools support for bigfile tablespaces2011-11-21Corrections in BR*Tools 7.20 patch 212012-01-10Online consistent backup with disk-copy and split-mirror2012-03-16Corrections in BR*Tools 7.20 patch 232012-05-25Corrections in BR*Tools 7.20 patch 242012-06-28Corrections in BR*Tools 7.20 patch 252012-09-12Corrections in BR*Tools 7.20 patch 26Support for secure storage in BR*Tools2012-10-25Corrections in BR*Tools 7.20 patch 282012-12-03Corrections in BR*Tools 7.20 patch 292013-01-31Corrections in BR*Tools 7.20 patch 302013-03-26Corrections in BR*Tools 7.20 patch 312013-05-28Corrections in BR*Tools 7.20 patch 322013-07-03Corrections in BR*Tools 7.20 patch 332013-09-05Corrections in BR*Tools 7.20 patch 342013-11-14Corrections in BR*Tools 7.20 patch 352014-02-24Corrections in BR*Tools 7.20 patch 362014-04-30Corrections in BR*Tools 7.20 patch 372014-06-25Corrections in BR*Tools 7.20 patch 382014-08-27Corrections in BR*Tools 7.20 patch 392014-10-29Corrections in BR*Tools 7.20 patch 402015-01-28Corrections in BR*Tools 7.20 patch 412015-03-25Corrections in BR*Tools 7.20 patch 42functionBRUSERSAP%fopen()fclose()freopen()fflush()remove()rename()fgetpos()fsetpos()fseek()ftell()fread()fwrite()fgets()fputs()fscanf()fprintf()fgetc()fputc()ungetc()gets()puts()getchar()putchar()scanf()printf()sscanf()sprintf()strtok()time()tmpnam()mktime()signal()sigset()system()getpwuid()setreuid()setregid()uname()putenv()fork()setsid()execl()popen()pclose()waitpid()wait()kill()stat()lstat()chmod()opendir()closedir()readdir()readlink()statfs()statvfs()mkdir()rmdir()getpass()symlink()open()close()read()write()pipe()dup2()truncate()tcgetattr()tcsetattr()gettimeofday()getgrnam()getgroups()_putenv()_spawnlp()_popen()_pclose()_stat64()_mkdir()_rmdir()_setmode()GetUserName()GetUserNameEx()GetComputerName()GetVersionEx()GetStdHandle()DuplicateHandle()CloseHandle()GetModuleHandle()GetProcAddress()SetConsoleCtrlHandler()GenerateConsoleCtrlEvent()CreateProcess()TerminateProcess()CreateThread()SuspendThread()ResumeThread()WaitForSingleObject()WaitForMultipleObjects()GetExitCodeProcess()OpenProcess()CreateFile()CreatePipe()ReadFile()WriteFile()GetFileSize()GetFileSizeEx()GetCompressedFileSize()GetFileAttributes()SetFilePointer()SetFilePointerEx()SetEndOfFile()FindFirstFile()FindNextFile()FindClose()GetTapeParameters()SetTapeParameters()SetTapePosition()WriteTapemark()PrepareTape()CreateTapePartition()EraseTape()DeviceIoControl()GetVolumeInformation()GetVolumePathName()GetDiskFreeSpaceEx()GetDiskFreeSpace()NetShareGetInfo()MultiByteToWideChar()WideCharToMultiByte()OpenSCManager()OpenService()CloseServiceHandle()StartService()ControlService()QueryServiceStatus()FormatMessage()RegOpenKeyEx()RegCloseKey()RegQueryValueEx()GetLogicaldriveStrings()GetNamedSecurityInfo()LookupAccountSid()LocalFree()NetLocalGroupGetMembers()NetApiBufferFree()dummy() %sBRARCHIVE %sBRARCHIVE completed successfullyBRARCHIVE erfolgreich beendetBRARCHIVE completed successfully with warningsBRARCHIVE completed successfully with warnings or non-fatal errorsBRARCHIVE erfolgreich mit Warnungen beendetBRARCHIVE erfolgreich mit Warnungen oder nicht-fatalen Fehlern beendetBRARCHIVE terminated with errorsBRARCHIVE mit Fehlern beendetStart of offline redolog processing: %s.%s %sStart der Offline-Redolog-Verarbeitung: %s.%s %sEnd of offline redolog processing: %s.%s %sEnde der Offline-Redolog-Verarbeitung: %s.%s %sOffline redolog processing for database instance: %sOffline redolog processing for database instances: %sOffline-Redolog-Verarbeitung fuer Datenbankinstanz: %sOffline-Redolog-Verarbeitung fuer Datenbankinstanzen: %sBRARCHIVE action ID: %sBRARCHIVE Aktions-ID: %sBRARCHIVE function ID: %sBRARCHIVE Funktions-ID: %s%d offline redolog file found for processing, size %4.3f MB%d offline redolog files found for processing, total size %4.3f MB%d Offline-Redolog-Datei zum Verarbeiten gefunden, Groesse %4.3f MB%d Offline-Redolog-Dateien zum Verarbeiten gefunden, Gesamtgroesse %4.3f MB%d next offline redolog file found for processing, size %4.3f MB%d next offline redolog files found for processing, total size %4.3f MB%d naechste Offline-Redolog-Datei zum Verarbeiten gefunden, Groesse %4.3f MB%d naechste Offline-Redolog-Dateien zum Verarbeiten gefunden, Gesamtgroesse %4.3f MBNo offline redolog files found for processingKeine Offline-Redolog-Dateien zum Verarbeiten gefunden%d of %d offline redolog file processed - %4.3f of %4.3f MB done%d of %d offline redolog files processed - %4.3f of %4.3f MB done%d von %d Offline-Redolog-Datei verarbeitet - %4.3f von %4.3f MB fertig%d von %d Offline-Redolog-Dateien verarbeitet - %4.3f von %4.3f MB fertigOffline redolog file %s deletedOffline-Redolog-Datei %s geloescht%d offline redolog file processed, size %4.3f MB%d offline redolog files processed, total size %4.3f MB%d Offline-Redolog-Datei verarbeitet, Groesse %4.3f MB%d Offline-Redolog-Dateien verarbeitet, Gesamtgroesse %4.3f MBOffline redolog file '%s' not foundOffline redolog file '%s' not found - it might be needed for recoveryOffline-Redolog-Datei '%s' nicht gefundenOffline-Redolog-Datei '%s' nicht gefunden - sie koennte fuer Wiederherstellung benoetigt werdenWaiting for the next offline redolog file...Waiting for the next %d offline redolog files...Warten auf die naechste Offline-Redolog-Datei...Warten auf die naechsten %d Offline-Redolog-Dateien...Volume size or disk capacity reached - not all offline redolog files will be savedDatentraegergroesse oder Plattenkapazitaet erreicht - nicht alle Offline-Redolog-Dateien werden gesichertBRARCHIVE currently running or was killedBRARCHIVE laeuft gerade oder wurde abgebrochenPlease delete file %s if BRARCHIVE was killedBitte Datei %s loeschen, wenn BRARCHIVE abgebrochen wurdeSetting of BRARCHIVE lock failedSetzen von BRARCHIVE-Sperre gescheitertThe current BRARCHIVE version uses a new BRARCHIVE log formatDiese BRARCHIVE-Version benutzt ein neues BRARCHIVE-ProtokollformatThe value '%s' of Oracle parameter log_archive_format can lead to redolog sequence overflow - please set it to '%s'Der Wert '%s' von Oracle-Parameter log_archive_format kann zu Redolog-Sequenz-Ueberlauf fuehren - bitte setzen Sie ihn auf '%s'Not enough backup devices for this functionNicht genug Sicherungsgeraete fuer diese FunktionBRARCHIVE started with option '%s' will be stopped nowBRARCHIVE gestartet mit Option '%s' wird jetzt gestopptBRARCHIVE started with option '%s' has been stoppedBRARCHIVE gestartet mit Option '%s' wurde gestopptBRARCHIVE started with option '%s' currently not runningBRARCHIVE gestartet mit Option '%s' laeuft gerade nichtStopping of BRARCHIVE started with option '%s' failedStoppen von BRARCHIVE gestartet mit Option '%s' gescheitertBRARCHIVE summary log '%s' not foundBRARCHIVE summary log '%s' not found - this will probably influence the volume managementSummarisches BRARCHIVE-Protokoll '%s' nicht gefundenSummarisches BRARCHIVE-Protokoll '%s' nicht gefunden - das wird wahrscheinlich die Datentraegerverwaltung beeinflussenProbably the redolog sequence number of database instance %s was resetWahrscheinlich wurde die Redolog-Sequenznummer der Datenbankinstanz %s zurueckgesetzt%d offline redolog file found of database instance %s%d offline redolog files found of database instance %s%d Offline-Redolog-Datei von Datenbankinstanz %s gefunden%d Offline-Redolog-Dateien von Datenbankinstanz %s gefundenArchive directory '%s' not foundArchivierungsverzeichnis '%s' nicht gefundenOffline redolog files will be copied from disk backupsOffline redolog files will be deleted from disk backupsOffline-Redolog-Dateien werden von Plattensicherungen kopiertOffline-Redolog-Dateien werden von Plattensicherungen geloeschtOffline redolog file %s already deleted by BRARCHIVEOffline-Redolog-Datei %s bereits von BRARCHIVE geloeschtThe current redolog sequence number %d of database instance %s is not greater than the sequence number %d of the last saved offline redo log fileThe current redolog sequence number %d of database instance %s is not greater than the sequence number %d of an already saved offline redo log fileDie aktuelle Redolog-Sequenznummer %d der Datenbankinstanz %s ist nicht groesser als die Sequenznummer %d der letzten gesicherten Offline-Rodo-Log-DateiDie aktuelle Redolog-Sequenznummer %d der Datenbankinstanz %s ist nicht groesser als die Sequenznummer %d einer bereits gesicherten Offline-Rodo-Log-DateiOffline redolog files starting with file %s are locked by BRBACKUP for an online consistent backupOffline-Redolog-Dateien beginnend mit Datei %s sind von BRBACKUP fuer eine konsistente Online-Sicherung gesperrtMaximum number %d of offline redolog files to be processed reachedMaximale Anzahl %d der zu verarbeitenden Offline-Redolog-Dateien erreichtLast offline redolog file %s will not be backed due to stopped database instance %sLast offline redolog file %s will not be backed due to connect error to database instance %sDie letzte Offline-Redolog-Datei %s wird wegen gestoppter Datenbankinstanz %s nicht gesichertDie letzte Offline-Redolog-Datei %s wird wegen Verbindungsfehler zur Datenbankinstanz %s nicht gesichertBRARCHIVE started with option '%s' will be suspended nowBRARCHIVE gestartet mit Option '%s' wird jetzt angehaltenBRARCHIVE started with option '%s' has been suspendedBRARCHIVE gestartet mit Option '%s' wurde angehaltenSuspension of BRARCHIVE started with option '%s' failedAnhalten von BRARCHIVE gestartet mit Option '%s' gescheitertBRARCHIVE suspended with option '%s' will be resumed nowBRARCHIVE angehalten mit Option '%s' wird jetzt wieder aufgenommenBRARCHIVE suspended with option '%s' has been resumedBRARCHIVE angehalten mit Option '%s' wurde wieder aufgenommenResumption of BRARCHIVE suspended with option '%s' failedWiederaufnahme von BRARCHIVE angehalten mit Option '%s' gescheitertBRARCHIVE started with option '%s' is not suspendedBRARCHIVE gestartet mit Option '%s' ist nicht angehaltenLine %d in %s rejected for %s because of different RMAN call typesZeile %d in %s aufgrund verschiedener RMAN-Aufruftypen fuer %s abgelehntArchive function: %sArchivierungsfunktion: %sLast %s run was probably killedLast %s run with function '%s' was probably killedLetzter %s-Lauf wurde wahrscheinlich abgebrochenLetzter %s-Lauf mit Funktion '%s' wurde wahrscheinlich abgebrochen'%s'BRBACKUP %sBRBACKUP completed successfullyBRBACKUP erfolgreich beendetBRBACKUP completed successfully with warningsBRBACKUP completed successfully with warnings or non-fatal errorsBRBACKUP erfolgreich mit Warnungen beendetBRBACKUP erfolgreich mit Warnungen oder nicht-fatalen Fehlern beendetBRBACKUP terminated with errorsBRBACKUP mit Fehlern beendetStart of database backup: %s.%s %sStart der Datenbanksicherung: %s.%s %sEnd of database backup: %s.%s %sEnde der Datenbanksicherung: %s.%s %sBackup of database: %sSicherung der Datenbank: %sBRBACKUP action ID: %sBRBACKUP Aktions-ID: %sBRBACKUP function ID: %sBRBACKUP Funktions-ID: %sTablespace for backup: %sTablespaces for backup: %sTablespace fuer Sicherung: %sTablespaces fuer Sicherung: %s%d file found for backup, size %4.3f MB%d files found for backup, total size %4.3f MB%d Datei zum Sichern gefunden, Groesse %4.3f MB%d Dateien zum Sichern gefunden, Gesamtgroesse %4.3f MB%d file/directory found for backup, size %4.3f MB%d files/directories found for backup, total size %4.3f MB%d Datei/Verzeichnis zum Sichern gefunden, Groesse %4.3f MB%d Dateien/Verzeichnisse zum Sichern gefunden, Gesamtgroesse %4.3f MB%d of %d file processed - %4.3f of %4.3f MB done%d of %d files processed - %4.3f of %4.3f MB done%d von %d Datei verarbeitet - %4.3f von %4.3f MB fertig%d von %d Dateien verarbeitet - %4.3f von %4.3f MB fertigDatabase instance %s will be shut down nowDatabase instance %s will be shut down now in mode '%s'Datenbankinstanz %s wird jetzt gestopptDatenbankinstanz %s wird jetzt in Modus '%s' gestopptTablespace '%s' not foundTablespace/file '%s' not foundTablespace '%s' nicht gefundenTablespace/Datei '%s' nicht gefundenFor online backup, the database must be in ARCHIVELOG modeFor %s, the database must be in ARCHIVELOG modeFuer Online-Sicherung muss die Datenbank im ARCHIVELOG-Modus seinFuer %s muss die Datenbank im ARCHIVELOG-Modus seinFor online backup, automatic archival must be ENABLEDFor online backup, automatic archival must be ENABLED for all database instancesFuer Online-Sicherung muss automatische Archivierung ENABLED seinFuer Online-Sicherung muss automatische Archivierung fuer alle Datenbankinstanzen ENABLED seinSAP system is running or SAP user is connected to database %s - database cannot be shut downSAP system is running or SAP user is connected to database instance %sSAP-System laeuft oder SAP-Benutzer ist mit Datenbank %s verbunden - Datenbank kann nicht gestoppt werdenSAP-System laeuft oder SAP-Benutzer ist mit Datenbankinstanz %s verbundenFile name %s not unique - backup/verification not possibleRestore file name %s not unique - restore not possibleDateiname %s nicht eindeutig - Sicherung/Verifikation nicht moeglichRestore-Dateiname %s nicht eindeutig - Zurueckladen nicht moeglichFile %s greater than volume size - trying to back it up anywayDatei %s groesser als Datentraegergroesse - es wird in jedem Fall versucht, sie zu sichernBRBACKUP currently running or was killedBRBACKUP laeuft gerade oder wurde abgebrochenPlease delete file %s if BRBACKUP was killedBitte Datei %s loeschen, wenn BRBACKUP abgebrochen wurdeSetting of BRBACKUP lock failedSetzen von BRBACKUP-Sperre gescheitertBRCONNECT call failedBRCONNECT-Aufruf gescheitertThe current BRBACKUP version uses a new BRBACKUP log formatDiese BRBACKUP-Version benutzt ein neues BRBACKUP-ProtokollformatNo data files found for RMAN backupKeine Datendateien zur RMAN-Sicherung gefundenDatabase file for backup: %sDatabase files for backup: %sDatenbankdatei fuer Sicherung: %sDatenbankdateien fuer Sicherung: %sNon-database file for backup: %sNon-database files for backup: %sNichtdatenbankdatei fuer Sicherung: %sNichtdatenbankdateien fuer Sicherung: %sDirectory for backup: %sDirectories for backup: %sVerzeichnis fuer Sicherung: %sVerzeichnisse fuer Sicherung: %sFile '%s' to be saved not foundFile '%s' to be deleted not foundZu sichernde Datei '%s' nicht gefundenZu loeschende Datei '%s' nicht gefundenDirectories will not be compressedVerzeichnisse werden nicht komprimiertBackups of directories will not be verifiedSicherungen von Verzeichnissen werden nicht verifiziertCompression rates out of date - run BRBACKUP with option '%s'Kompressionsraten veraltet - starten Sie BRBACKUP mit Option '%s'New file %s added to the database during the backup was not savedNeue, waehrend der Sicherung hinzugefuegte Datenbankdatei %s wurde nicht gesichert%d offline redolog file found for backup, size %4.3f MB%d offline redolog files found for backup, total size %4.3f MB%d Offline-Redolog-Datei zum Sichern gefunden, Groesse %4.3f MB%d Offline-Redolog-Dateien zum Sichern gefunden, Gesamtgroesse %4.3f MBVolume size limit reached - trying to back up offline redolog files anywayDatentraegergroesse erreicht - es wird in jedem Fall versucht, die Offline-Redolog-Dateien zu sichernRead only tablespace %s will not be savedRead-Only-Tablespace %s wird nicht gesichertFollowing disk backup will be copied: %sFolgende Plattensicherung wird kopiert: %sBackup %s must be a disk backupSicherung %s muss eine Plattensicherung seinFile %s to be copied is not included in the specified disk backupFile %s to be deleted is not included in the specified disk backupDie zu kopierende Datei %s ist in der angegebenen Plattensicherung nicht enthaltenDie zu loeschende Datei %s ist in der angegebenen Plattensicherung nicht enthalten%d file was already saved in: %s%d files were already saved in: %s%d Datei wurde bereits gesichert in: %s%d Dateien wurden bereits gesichert in: %sAll files were already saved in backup: %sAll data files were already saved in backups: %sAlle Dateien wurden bereits gesichert in Sicherung: %sAlle Dateien wurden bereits gesichert in Sicherungen: %sNo files found for backupNo files found for deletionKeine Dateien zum Sichern gefundenKeine Dateien zum Loeschen gefundenAll files will be copied to the new database home directory: %sAlle Dateien werden in das neue Datenbank-Home-Verzeichnis kopiert: %sVolume size exceeded by file %sDatentraegergroesse von Datei %s ueberschrittenDirectory %s cannot be saved on device type '%s'Verzeichnis %s kann nicht auf Geraetetyp '%s' gesichert werdenDisk backup file/directory %s deletedPlattensicherungsdatei/-verzeichnis %s geloeschtFollowing disk backup will be copied and deleted: %sFolgende Plattensicherung wird kopiert und geloescht: %sFollowing disk backup will be deleted (no backup): %sFolgende Plattensicherung wird geloescht (keine Sicherung): %sInternal error for '%s' at location %s-%dInternal info for '%s' at location %s-%dInterner Fehler fuer '%s' an der Stelle %s-%dInterne Info fuer '%s' an der Stelle %s-%dParametersParameterFollowing backup device will be used: %sFollowing backup devices will be used: %sFolgendes Sicherungsgeraet wird benutzt: %sFolgende Sicherungsgeraete werden benutzt: %sFollowing backup volume will be used: %sFollowing backup volumes will be used: %sFolgender Sicherungsdatentraeger wird benutzt: %sFolgende Sicherungsdatentraeger werden benutzt: %s%d scratch volume will be used%d scratch volumes will be used%d Scratchdatentraeger wird benutzt%d Scratchdatentraeger werden benutzt%d free backup volume found, %d required%d free backup volumes found, %d required%d freier Sicherungsdatentraeger gefunden, %d erforderlich%d freie Sicherungsdatentraeger gefunden, %d erforderlichFiles will be saved on disk in directory: %sFiles will be saved on disk in directories: %sDateien werden auf Platte gesichert in Verzeichnis: %sDateien werden auf Platte gesichert in Verzeichnissen: %sRemote backup device will be accessed through pipeAuf Remote-Sicherungsgeraet wird ueber Pipe zugegriffenAutomatic volume changing is activeAutomatischer Datentraegerwechsel ist aktivFiles will be saved by backup utility at file levelDateien werden von Backup-Utility auf Datei-EbeneBackup mode: %sModus der Sicherung: %sFiles will be compressedFiles will be compressed by brtoolsDateien werden komprimiertDateien werden mit brtools komprimiertFiles will not be compressedDateien werden nicht komprimiertFiles will be compressed by hardwareDateien werden mit Hardware komprimiertSoftware compression not supported for '%s'Software-Komprimierung nicht unterstuetzt fuer '%s'Compression rate for all files %5.4f:1Kompressionsrate fuer alle Dateien %5.4f:1%s before backup for database instance %s%s before backup for database instance %s/%s%s vor Backup fuer Datenbankinstanz %s%s vor Backup fuer Datenbankinstanz %s/%s%s after backup for database instance %s%s after backup for database instance %s/%s%s nach Backup fuer Datenbankinstanz %s%s nach Backup fuer Datenbankinstanz %s/%sTablespaces and data filesTablespaces und DatendateienRedolog filesRedolog-DateienControl filesSteuerdateienProcessing of log file %s failedVerarbeiten der Protokolldatei %s gescheitertLine %d in %s longer than %d charactersZeile %d in %s laenger als %d ZeichenFormat error found in line %d of %s at location %s-%dFormat error found in line %d of %s at location %s-%d - ignoring the lineFormatfehler gefunden in Zeile %d von %s an der Stelle %s-%dFormatfehler gefunden in Zeile %d von %s an der Stelle %s-%d - die Zeile wird ignoriertQuery option set - no processingAbfrageoption gesetzt - keine VerarbeitungCompression only - no backupCompression only - no backup/deletionNur Komprimierung - keine SicherungNur Komprimierung - keine Sicherung/LoeschungUnattended mode active - no operator confirmation requiredUnattended mode active - continuing processing with default reply '%s'Unbeaufsichtigter Modus aktiv - keine Operator-Bestaetigung erforderlichUnbeaufsichtigter Modus aktiv - Verarbeitung wird mit vorgegebener Antwort '%s' fortgesetztFill volume option set - waiting for offline redolog files possibleFill volume option set with value %d - waiting for offline redolog files possibleFill-Option gesetzt - Warten auf Offline-Redolog-Dateien moeglichFill-Option mit dem Wert %d gesetzt - Warten auf Offline-Redolog-Dateien moeglichOption '%s' ignored for '%s'Option '%s' ignoriert fuer '%s'Force option set - no label checking during initializationForce-Option gesetzt - keine Kennsatzpruefung bei InitialisierungBackup device type: %sSicherungsgeraetetyp: %sAll volumes get the name SCRATCHAlle Datentraeger bekommen den Namen SCRATCHShow option set - volume label will be displayed without initializationShow-Option gesetzt - Datentraegerkennsatz wird ohne Initialisierung angezeigtLabel of volume in device %s:Kennsatz von Datentraeger in Geraet %s:Unattended mode with 'force' active - no operator confirmation allowedUnattended mode with 'force' active - continuing processing with default reply '%s'Unbeaufsichtigter Modus mit 'force' aktiv - keine Operator-Bestaetigung erlaubtUnbeaufsichtigter Modus mit 'force' aktiv - Verarbeitung wird mit vorgegebener Antwort '%s' fortgesetztQuery with check option set - no processingAbfrage-mit-Pruefung-Option gesetzt - keine VerarbeitungVerify option set - double work to doVerify option with value '%s' set - double work to doVerify-Option gesetzt - doppelte Arbeit zu tunVerify-Option mit Wert '%s' gesetzt - doppelte Arbeit zu tunVerify option set - backup utility will be inquiredVerify option with value '%s' set - backup utility will be inquiredVerify-Option gesetzt - Backup-Utility wird abgefragtVerify-Option mit Wert '%s' gesetzt - Backup-Utility wird abgefragtNon-database fileNon-database filesNichtdatenbankdateiNichtdatenbankdateienDirectoryDirectoriesVerzeichnisVerzeichnisseNumber of parallel copy processes: %dAnzahl der parallelen Kopierprozesse: %dApply offline redolog option with delay %d minute activeApply offline redolog option with delay %d minutes activeApply-Offline-Redolog-Option mit Verzoegerung %d Minute aktivApply-Offline-Redolog-Option mit Verzoegerung %d Minuten aktivFiles will be switched to backup status during the backupDateien werden waehrend der Sicherung in Backup-Status versetztBackup type: %sSicherungstyp: %sFollowing backup volume name will be used: %sFollowing backup volume names will be used: %sFolgender Sicherungsdatentraegername wird benutzt: %sFolgende Sicherungsdatentraegernamen werden benutzt: %sAutomatic volume mounting is activeAutomatisches Datentraegerladen ist aktivOffline redolog fileOffline redolog filesOffline-Redolog-DateiOffline-Redolog-DateienVerify option set - verification of backup only, no restoreVerify option with value '%s' set - verification of backup onlyVerify-Option gesetzt - nur Verifikation der Sicherung, kein ZurueckladenVerify-Option mit Wert '%s' gesetzt - nur Verifikation der SicherungDBVERIFY will be used for verificationDBVERIFY wird fuer die Verifikation benutztOnly database verification using DBVERIFY - no backupNur Datenbankverifikation mittels DBVERIFY - keine SicherungNumber of files in save sets: %sAnzahl der Dateien in Savesets: %sEnvironment variable %s should not be setUmgebungsvariable %s sollte nicht gesetzt werdenEnvironment variable %s is not setUmgebungsvariable %s ist nicht gesetztUnknown option '%s' found at position %dUnbekannte Option '%s' an der Stelle %d gefundenUnexpected option value '%s' found at position %dUnerwarteter Optionswert '%s' an der Stelle %d gefundenNo value found for option '%s'No enough values/options found for function '%s'Kein Wert fuer Option '%s' gefundenZu wenig Werte/Optionen fuer Funktion '%s' gefundenIllegal value '%s' found for option '%s'Illegal value (subvalue of) '%s' found for option '%s'Unerlaubter Wert '%s' fuer Option '%s' gefundenUnerlaubter Wert (Unterwert von) '%s' fuer Option '%s' gefundenValue '%s' of option '%s' longer than %d charactersValue (subvalue of) '%s' of option '%s' longer than %d charactersWert '%s' von Option '%s' laenger als %d ZeichenWert (Unterwert von) '%s' von Option '%s' laenger als %d ZeichenError reading Oracle profile %sFehler beim Lesen des Oracle-Profils %sError reading BR*Tools profile %sFehler beim Lesen des BR*Tools-Profils %sUnexpected symbol '%s' found for parameter '%s'Unerwartetes Symbol '%s' fuer Parameter '%s' gefundenMore data expected in file %sMehr Daten in Datei %s erwartetParameter '%s' in file %s not supportedParameter '%s' in Datei %s nicht unterstuetztUnknown parameter '%s' found in BR*Tools profile %sUnbekannter Parameter '%s' in BR*Tools-Profil %s gefundenIllegal value '%s' found for parameter '%s'Unerlaubter Wert '%s' fuer Parameter '%s' gefundenParameter '%s' is not set in %sParameter '%s' ist in %s nicht gesetztParameter '%s' not found in file %s - default assumedParameter '%s' nicht in Datei %s gefunden - Standardwert angenommenUnexpected value '%s' found for parameter '%s'Unerwarteter Wert '%s' fuer Parameter '%s' gefundenPlease define only one value for parameter '%s'Please define only one value for parameter/option '%s' for function/action '%s'Bitte definieren Sie nur einen Wert fuer Parameter '%s'Bitte definieren Sie nur einen Wert fuer Parameter/Option '%s' fuer Funktion/Aktion '%s'Value '%s' of parameter/option '%s' ignored for '%s' - '%s' assumedWert '%s' von Parameter/Option '%s' wird ignoriert fuer '%s' - '%s' angenommenValue of parameter '%s' should contain multiple tokens and be enclosed in double quotesWert des Parameters '%s' sollte mehrere Tokens beinhalten und in Anfuehrungszeichen eingeschlossen seinValue '%s' of parameter '%s' longer than %d charactersValue (subvalue of) '%s' of parameter '%s' longer than %d charactersWert '%s' fuer Parameter '%s' laenger als %d ZeichenWert (Unterwert von) '%s' fuer Parameter '%s' laenger als %d ZeichenRoot directories %s and %s are on the same disk volumeRoot-Verzeichnisse %s und %s sind auf demselben PlattendatentraegerOption '%s' missing in parameter '%s'Option '%s' fehlt in Parameter '%s'Dollar character missing in parameter's valueDollarzeichen fehlt im ParameterwertCharacter 'K', 'M' or 'G' should directly follow the size dataZeichen 'K', 'M' oder 'G' sollte direkt der Groessenangabe folgenParameter 'read_fifo_cmd' not supported anymore, please use parameters 'remote_host' and optionally 'remote_user' insteadParameter 'read_fifo_cmd' nicht mehr unterstuetzt, bitte benutzen Sie stattdessen Parameter 'remote_host' und optional 'remote_user'Value %d of parameter/option '%s' smaller than value %d of parameter/option '%s'Wert %d von Parameter/Option '%s' kleiner als Wert %d von Parameter/Option '%s'Mandatory option '%s' not specified for '%s'Obligatorische Option '%s' nicht spezifiziert fuer '%s'Number of backup devices defined in parameters '%s' is not the sameAnzahl der in Parametern '%s' definierten Sicherungsgeraete ist nicht gleichBackup devices with and without rewind have the same addressSicherungsgeraete mit und ohne rewind haben die gleiche AdresseOption '%s' not supported for '%s'Option '%s' not supported yet for '%s'Option '%s' nicht unterstuetzt fuer '%s'Option '%s' noch nicht unterstuetzt fuer '%s'Checking parameter/option '%s' failedWarning by checking parameter/option '%s'Ueberpruefung von Parameter/Option '%s' gescheitertWarnung bei der Ueberpruefung von Parameter/Option '%s'Values '%s' of option '%s' not ascendingWerte '%s' von Option '%s' nicht aufsteigendMaximum %d values can be defined for parameter '%s'Maximal %d Werte koennen fuer Parameter '%s' definiert werdenFile %s defined in IFILE parameter not in %sIn IFILE-Parameter definierte Datei %s nicht in %sCompress directories %s and %s on the same disk volumeKomprimierungsverzeichnisse %s und %s auf demselben PlattendatentraegerValue %d of parameter/option '%s' smaller than %dValue %d of parameter/option '%s' smaller than %d for '%s'Wert %d von Parameter/Option '%s' kleiner als %dWert %d von Parameter/Option '%s' kleiner als %d fuer '%s'Value %d of parameter/option '%s' greater than %dValue %d of parameter/option '%s' greater than %d for '%s'Wert %d von Parameter/Option '%s' groesser als %dWert %d von Parameter/Option '%s' groesser als %d fuer '%s'Expiration period equal 0 - backup volumes could be immediately overwrittenSperrfrist gleich 0 - Sicherungsdatentraeger koennten sofort ueberschrieben werdenParameter '%s' in form '\\.\tapex' not supported anymore - please use '%s' insteadParameter '%s' in Form '\\.\tapex' nicht mehr unterstuetzt - bitte verwenden Sie statt dessen '%s'Value '%s' of parameter/option '%s' not supported for '%s'Wert '%s' von Parameter/Option '%s' nicht unterstuetzt fuer '%s'cpio block size in option -C is not a multiple of 512cpio-Blockgroesse in Option -C ist kein Vielfaches von 512Files to be saved are already compressedDie zu sichernden Dateien sind bereits komprimiertFirst offline redolog file %s to be saved which was found in line %d of %s is already compressedDie erste zu sichernde Offline-Redolog-Datei %s, die in Zeile %d von %s gefunden wurde, ist bereits komprimiertDirectory %s cannot be prepared for RMAN backupVerzeichnis %s kann nicht fuer RMAN-Sicherung vorbereitet werdenOriginal file %s was on raw disk - its copy on disk cannot be saved by backup utilityDie Originaldatei %s war auf Raw-Platte - ihre Kopie auf Platte kann vom Backup-Utility nicht gesichert werdenChained start not supported for '%s'Verketteter Start nicht unterstuetzt fuer '%s'Profiles saved successfullyProfile erfolgreich gesichertVolume label checked successfullyVolume labels checked successfullyDatentraegerkennsatz erfolgreich ueberprueftDatentraegerkennsaetze erfolgreich ueberprueftBR_TRACE: location %s-%d, %s: %sBR_TRACE: thread %d: location %s-%d, %s: %sBR_TRACE: Stelle %s-%d, %s: %sBR_TRACE: Thread %d: Stelle %s-%d, %s: %sCompressing %sKomprimierung von %sSaving %sCopying %sSicherung von %sKopieren von %sto %s ...to %s:%s ...auf %s ...auf %s:%s ...Percentage done: %3.2f%%, estimated end time: %d:%02dPercentage done: %3.2f%%, estimated end time: %s %02d:%02dProzentsatz fertig: %3.2f%%, geschaetztes Ende: %d:%02dProzentsatz fertig: %3.2f%%, geschaetztes Ende: %s %02d:%02dBackup volume initializationSicherungsdatentraeger-InitialisierungEnd of backup volume initializationEnde der Sicherungsdatentraeger-InitialisierungVolume in device: %s will be initialized with name: %sVolumes in devices: %s will be initialized with names: %sDatentraeger in Geraet: %s wird initialisiert mit Namen: %sDatentraeger in Geraeten: %s werden initialisiert mit Namen: %sVolume with name %s required in device %sDatentraeger mit Namen %s erforderlich in Geraet %sVolume in device %s has name %sDatentraeger in Geraet %s hat Namen %sPlease mount %s volume, if you have not already done soPlease mount %s volumes, if you have not already done soBitte montieren Sie %s-Datentraeger, wenn dies noch nicht getan wurdeVolume remount required - unattended mode not possibleDatentraegerwechsel erforderlich - unbeaufsichtigter Modus nicht moeglichPlease check the volume or the deviceUeberpruefen Sie bitte den Datentraeger oder das GeraetWinding tape volume in device %s failedSpulen von Banddatentraeger in Geraet %s gescheitertLabel on volume in device %s not foundKennsatz auf Datentraeger in Geraet %s nicht gefundenLabel on volume in device %s has wrong formatKennsatz auf Datentraeger in Geraet %s hat falsches FormatWrong volume %s found in device %s, expected: %sFalscher Datentraeger %s in Geraet %s gefunden, erwartet: %sLock period for volume %s in device %s not expiredSperrfrist fuer Datentraeger %s in Geraet %s nicht abgelaufenChecking label on volume in device %s failedKennsatzpruefung auf Datentraeger in Geraet %s gescheitertInitialization of volume %s in device %s failedInitialisierung von Datentraeger %s in Geraet %s gescheitertVolume in device %s is write-protectedDatentraeger in Geraet %s ist schreibgeschuetztWriting volume header files to %s failedSchreiben der Datentraegerkopfdateien auf %s gescheitertCopying %s to/from %s failed due to previous errorsKopieren von %s auf/von %s aufgrund frueherer Fehler gescheitertLast copy process failedLetzter Kopierprozess gescheitertCompressing %s to %s failed due to previous errorsKomprimieren von %s auf %s aufgrund frueherer Fehler gescheitertMaximum 255 backup devices can be usedMaximal 255 Sicherungsgeraete koennen benutzt werdenRewinding tape volume in device %s ...Winding tape volume in device %s ...Zurueckspulen von Banddatentraeger in Geraet %s ...Spulen von Banddatentraeger in Geraet %s ...Not enough disk space in %s for backup, missing at least %4.3f MBNot enough disk space in %s for backup of system database files, missing at least %4.3f MBNicht genug Plattenplatz in %s fuer Sicherung, es fehlen mindestens %4.3f MBNicht genug Plattenplatz in %s fuer Sicherung von System-Datenbankdateien, es fehlen mindestens %4.3f MBNot enough disk space in %s for compression, missing at least %4.3f MBNicht genug Plattenplatz in %s fuer Komprimierung, es fehlen mindestens %4.3f MBCalling backup utility with function '%s'...Backup-Utility wird aufgerufen mit Funktion '%s'...Backup utility called successfullyBackup-Utility erfolgreich aufgerufenBackup utility call failedAufruf von Backup-Utility gescheitert%d of %d file saved by backup utility%d of %d files saved by backup utility%d von %d Datei durch Backup-Utility gesichert%d von %d Dateien durch Backup-Utility gesichertBackup utility has reported an error while saving file %sBackup-Utility hat beim Sichern der Datei %s einen Fehler gemeldetUnknown file '%s' saved by backup utilityUnbekannte Datei '%s' durch Backup-Utility gesichertRecommended number of usages of volume %s exceededEmpfohlene Anzahl der Benutzungen von Datentraeger %s ueberschrittenPerhaps volume initialization with option '-i force' requiredVielleicht Datentraegerinitialisierung mit Option '-i force' erforderlichScratch volume required in device %sScratch-Datentraeger erforderlich in Geraet %scpio continuation volume required in device %scpio-Fortsetzungsdatentraeger erforderlich in Geraet %sNo label checking on cpio continuation volumeKeine Kennsatzpruefung auf cpio-FortsetzungsdatentraegerSize %1.0f of saved/restored data is different from the size %1.0f of file / save set %sGroesse %1.0f der gesicherten/zurueckgeladenen Daten ist verschieden von der Groesse %1.0f der Datei/Saveset %sChecking label on volume in device %sKennsatzpruefung auf Datentraeger in Geraet %sScratch volume in device %s will be renamed to %sScratch-Datentraeger in Geraet %s wird in %s umbenanntWrong creation date %s for volume %s in device %sFalsches Erstellungsdatum %s fuer Datentraeger %s in Geraet %sTrying to create remote directory %s:%s ...Es wird versucht, Remote-Verzeichnis %s:%s anzulegen...Directory %s will not be compressedDirectory %s cannot be compressedVerzeichnis %s wird nicht komprimiertVerzeichnis %s kann nicht komprimiert werdenBackup utility has reported an error for unknown file '%s'Backup-Utility hat fuer unbekannte Datei '%s' einen Fehler gemeldetNo backup utility ID or ID longer than %d charactersKeine Backup-Utility-ID oder ID laenger als %d ZeichenBR_TRACE: level %d, function %s entry with '%s'BR_TRACE: level %d, function %s entry with %dBR_TRACE: Ebene %d, Funktion %s Eingang mit '%s'BR_TRACE: Ebene %d, Funktion %s Eingang mit %dBR_TRACE: level %d, function %s exit with %dBR_TRACE: Ebene %d, Funktion %s Ausgang mit %dBR_TRACE: level %d, function %s exit with '%s'BR_TRACE: level %d, function %s exit with %pBR_TRACE: Ebene %d, Funktion %s Ausgang mit '%s'BR_TRACE: Ebene %d, Funktion %s Ausgang mit %pFunction %s failed at location %s-%dFunktion %s gescheitert an der Stelle %s-%dFunction %s failed for '%s' at location %s-%dFunktion %s gescheitert fuer '%s' an der Stelle %s-%derrno %d: %sMemory allocation of %d bytes of type '%s' failed at location %s-%dSpeicheranforderung von %d Bytes vom Typ '%s' gescheitert an der Stelle %s-%dCannot read from standard inputVon Standardeingabe kann nicht gelesen werdenEnter '%s' to continue, '%s' to cancel %s:Eingabe '%s' um fortzusetzen, '%s' um %s abzubrechen:Your reply: '%s'Ihre Antwort: '%s'Wrong reply: '%s'Falsche Antwort: '%s'Program execution will be continued...Programmausfuehrung wird fortgesetzt...%s cancelled by user%s vom Benutzer abgebrochen%s cancelled by signal %d%s durch Signal %d abgebrochenEnter database user name[/password]:Enter database user password (max. %d ASCII chars):Eingabe Datenbank-Benutzername[/Kennwort]:Eingabe Datenbank-Benutzer-Kennwort (max. %d ASCII-Zeichen):Enter password for database user '%s' (max. %d ASCII chars):Reenter password for database user '%s' (max. %d ASCII chars):Eingabe Kennwort fuer Datenbank-Benutzer '%s' (max. %d ASCII-Zeichen):Wiedereingabe Kennwort fuer Datenbank-Benutzer '%s' (max. %d ASCII-Zeichen):Entering user name/password failedEntering password failedEingabe von Benutzername/Kennwort gescheitertEingabe von Kennwort gescheitertExecution of program '%s' failedAusfuehrung des Programms '%s' gescheitertProgram '%s' interrupted, exit status: %xProgramm '%s' unterbrochen, Exit-Status: %xAsynchronous execution of program failedAsynchrone Ausfuehrung eines Programms gescheitertAsynchronous execution of program interrupted, exit status: %xAsynchrone Ausfuehrung eines Programms unterbrochen, Exit-Status: %xWait situation interrupted - probably cannot continueWartesituation unterbrochen - wahrscheinlich Fortsetzung nicht moeglichUnknown process with ID %d terminatedUnbekannter Prozess mit ID %d beendetReading from a pipe failed for '%s'Lesen von einer Pipe fuer '%s' gescheitertExecution of program '%s' through pipe failedAusfuehrung des Programms '%s' ueber Pipe gescheitertDetermination of file status for %s failedErmittlung von Dateistatus fuer %s gescheitertFile '%s' not foundDatei '%s' nicht gefundenFile %s is not a regular fileDatei %s ist keine normale DateiFile/directory %s is emptyDatei/Verzeichnis %s ist leerDetermination of disk volume status for %s failedErmittlung von Plattendatentraegerstatus fuer %s gescheitertCommand output of '%s':Command output of %s:'%s':Kommandoausgabe von '%s':Kommandoausgabe von %s:'%s':Return code from '%s': %dReturn code: %dReturn-Code von '%s': %dReturn-Code: %d%s time stamp: %s%s thread %d time stamp: %s%s-Zeitstempel: %s%s-Thread %d Zeitstempel: %s%s interrupted by signal %d%s durch Signal %d unterbrochenDirectory '%s' not foundVerzeichnis '%s' nicht gefundenCommand output buffer overflowUeberlauf des Kommandoausgabepuffers%s time stamp: %s, elapsed time: %s%s thread %d: time stamp: %s, elapsed time: %s%s-Zeitstempel: %s, verstrichene Zeit: %s%s-Thread %d: Zeitstempel: %s, verstrichene Zeit: %sThis action can take several seconds/minutes - be patient...Dieser Vorgang kann einige Sekunden/Minuten dauern - bitte um Geduld...Size %1.0f of file %s is different from Oracle file size %1.0fSize %1.0f of file %s is different from original file size %1.0fGroesse %1.0f der Datei %s ist verschieden von Oracle-Dateigroesse %1.0fGroesse %1.0f der Datei %s ist verschieden von Originaldateigroesse %1.0fPath '%s' not in file name '%s' - trying to use original full pathPfad '%s' nicht im Dateinamen '%s' - es wird versucht, die Original-Gesamtpfad zu benutzenYou can use option '%s' to copy such filesSie koennen Option '%s' benutzen, um solche Dateien zu kopieren%s will be started at the end of processing%s wird am Ende der Verarbeitung gestartetThis run was started by %sDieser Lauf wurde von %s gestartet%s (action ID %s) will be started with options '%s'%s will be started with options '%s'%s (Aktions-ID %s) wird gestartet mit Optionen '%s'%s wird gestartet mit Optionen '%s'Execution of %s finished with return code %dExecution of %s (action ID %s) finished with return code %dAusfuehrung von %s mit Return-Code %d beendetAusfuehrung von %s (Aktions-ID %s) mit Return-Code %d beendetStarting %s (action ID %s) failedStarting %s failedStarten von %s (Aktions-ID %s) gescheitertStarten von %s gescheitertMirror disks will be split nowSpiegelplatten werden jetzt abgespaltenSplitting mirror disks...Abspalten der Spiegelplatten...Split of mirror disks successfulAbspalten der Spiegelplatten erfolgreichResynchronizing mirror disks...Resynchronisation der Spiegelplatten...Resynchronization of mirror disks successfulResynchronisation der Spiegelplatten erfolgreichSplit/resynchronization of mirror disks failedAbspalten/Resynchronisation der Spiegelplatten gescheitertBR_TRACE: SQL code: %d, number of processed rows: %dBR_TRACE: thread %d: SQL code: %d, number of processed rows: %dBR_TRACE: SQL-Code: %d, Anzahl der verarbeiteten Zeilen: %dBR_TRACE: Thread %d: SQL-Code: %d, Anzahl der verarbeiteten Zeilen: %dSQL error %d at location %s-%d, SQL statement: '%s'SQL error %d in thread %d at location %s-%d, SQL statement: '%s'SQL-Fehler %d an der Stelle %s-%d, SQL-Anweisung: '%s'SQL-Fehler %d in Thread %d an der Stelle %s-%d, SQL-Anweisung: '%s'SQLPLUS call for database instance %s failedSQLPLUS-Aufruf fuer Datenbankinstanz %s gescheitertDetermination of Oracle version failedErmittlung der Oracle-Version gescheitertStarting and opening database instance %s ...Opening database instance %s ...Starten und Oeffnen der Datenbankinstanz %s ...Oeffnen der Datenbankinstanz %s ...Start and open of database instance %s successfulOpen of database instance %s successfulStarten und Oeffnen der Datenbankinstanz %s erfolgreichOeffnen der Datenbankinstanz %s erfolgreichStart and open of database instance %s failedOpen of database instance %s failedStarten und Oeffnen der Datenbankinstanz %s gescheitertOeffnen der Datenbankinstanz %s gescheitertShutting down database instance %s ...Stoppen der Datenbankinstanz %s ...Shutdown of database instance %s successfulStoppen der Datenbankinstanz %s erfolgreichShutdown of database instance %s failedStoppen der Datenbankinstanz %s gescheitertConnect to database instance %s failedVerbindungsaufbau zu Datenbankinstanz %s gescheitertConnect to database instance %s during online backup failedVerbindungsaufbau zu Datenbankinstanz %s waehrend Online-Sicherung gescheitertDatabase instance %s shutdown during online backupOracle service OracleService%s stopped during online backupDatenbankinstanz %s gestoppt waehrend Online-SicherungOracle-Service OracleService%s gestoppt waehrend Online-SicherungDatabase instance %s started up during offline backupDatenbankinstanz %s gestartet waehrend Offline-SicherungCollection of information on database files failedSammlung der Informationen ueber Datenbankdateien gescheitert'Alter tablespace %s begin backup' successful'Alter database begin backup' successful'Alter tablespace %s begin backup' erfolgreich'Alter database begin backup' erfolgreich'Alter tablespace %s begin backup' failed'Alter database begin backup' failed'Alter tablespace %s begin backup' gescheitert'Alter database begin backup' gescheitert'Alter tablespace %s end backup' successful'Alter database end backup' successful'Alter tablespace %s end backup' erfolgreich'Alter database end backup' erfolgreich'Alter tablespace %s end backup' failed'Alter database end backup' failed'Alter tablespace %s end backup' gescheitert'Alter database end backup' gescheitertControl file copy created: %s %1.0fStandby control file copy created: %s %1.0fSteuerdateikopie erstellt: %s %1.0fStandby-Steuerdateikopie erstellt: %s %1.0fCopying of control file to %s failedCopying of standby control file to %s failedKopieren der Steuerdatei auf %s gescheitertKopieren der Standby-Steuerdatei auf %s gescheitertSwitch to the next online redolog file for database instance %s successfulUmschalten zur naechsten Online-Redolog-Datei fuer Datenbankinstanz %s erfolgreichSwitch to the next online redolog file for database instance %s failedUmschalten zur naechsten Online-Redolog-Datei fuer Datenbankinstanz %s gescheitert'Archive log list' for database instance %s failed'Archive log list' fuer Datenbankinstanz %s gescheitertInsertion of database log header failedEinfuegen des Datenbankprotokollkopfs gescheitertWriting to database log failedSchreiben des Datenbankprotokolls gescheitertUpdate of database log header failedAktualisierung des Datenbankprotokollkopfs gescheitertDisconnect from database instance %s failedVerbindungsabbau zu Datenbankinstanz %s gescheitertDatabase file %s of tablespace %s is already in backup statusDatenbankdatei %s vom Tablespace %s ist bereits im Backup-StatusDatabase instance %s will be opened nowDatabase instance %s will be reopened nowDatenbankinstanz %s wird jetzt geoeffnetDatenbankinstanz %s wird jetzt wieder eroeffnetStarting and mounting%s database instance %s ...Starten und Montieren%s der Datenbankinstanz %s ...Start and mount%s of database instance %s successfulStarten und Montieren%s der Datenbankinstanz %s erfolgreichStart and mount of database instance %s failedStarten und Montieren der Datenbankinstanz %s gescheitertStatus of tablespace %s is %sStatus von Tablespace %s ist %sStatus of database file %s is %sStatus von Datenbankdatei %s ist %sStatus of online redolog file %s is %sStatus von Online-Redolog-Datei %s ist %sApplying offline redolog file %s ...Einspielen der Offline-Redolog-Datei %s ...Offline redolog file %s applied successfullyOffline-Redolog-Datei %s erfolgreich eingespieltApplying offline redolog file %s failedApplying offline redolog failed for %d file(s)Einspielen der Offline-Redolog-Datei %s gescheitertEinspielen von Offline-Redolog gescheitert fuer %d Datei(en)Number of parallel instances is different from number of Oracle redo threadsAnzahl der parallelen Instanzen ist verschieden von der Anzahl der Oracle-Redo-ThreadsSwitching to the next online redolog file for database instance %s ...Umschalten zur naechsten Online-Redolog-Datei fuer Datenbankinstanz %s ...Raw disk offset and database block size are not a multiple of each otherRaw-Platten-Offset und Datenbankblockgroesse sind kein Vielfaches voneinanderDatabase instance %s is openDatabase instance %s is open in 'RESTRICTED' modeDatenbankinstanz %s ist geoeffnetDatenbankinstanz %s ist geoeffnet in 'RESTRICTED'-ModusDetermination of raw disk offset failed for file %sErmittlung des Raw-Platten-Offsets gescheitert fuer Datei %sNo tablespace has been put in backup status by backup utilityKein Tablespace wurde vom Backup-Utility in den Backup-Status gesetztError in backup utility while switching the status of file %sError in backup utility while switching the status of database filesFehler in Backup-Utility beim Umschalten des Status der Datei %sFehler in Backup-Utility beim Umschalten des Status der DatenbankdateienStarting applying offline redolog file %s ...Starten des Einspielens der Offline-Redolog-Datei %s ...Waiting for the completion of applying offline redolog files...Warten auf die Beendigung vom Einspielens der Offline-Redolog-Dateien...Following file has been extended by database: %s %1.0fFolgende Datei wurde von Datenbank erweitert: %s %1.0f%s cannot be called because tape management was not done%s kann nicht aufgerufen werden, weil Bandverwaltung wurde nicht durchgefuehrtBackup utility will be inquired for backup confirmationBackup-Utility wird zu Bestaetigung der Sicherungen abgefragtRestoring %sRestoring %s ...Zurueckladen von %sZurueckladen von %s ...Decompressing %sDecompressing %s ...Dekomprimierung von %sDekomprimierung von %s ...Verifying backup of %sVerifying file %sVerifikation der Sicherung von %sVerifikation der Datei %sDecompressing and verifying the backup of %sDecompressing and verifying the backup of %s ...Dekomprimierung und Verifikation der Sicherung von %sDekomprimierung und Verifikation der Sicherung von %s ...from %s ...from %s:%s ...von %s ...von %s:%s ...Backup '%s' of file %s confirmed by backup utilitySicherung '%s' der Datei %s von Backup-Utility bestaetigtVerifying volume %s in device %s ...Verifikation von Datentraeger %s in Geraet %s ...Backup utility has reported an error while confirming the backup of file %sBackup-Utility hat beim Bestaetigen der Sicherung der Datei %s einen Fehler gemeldetRestore of %s from %s failed due to previous errorsZurueckladen von %s von %s aufgrund frueherer Fehler gescheitertNot enough disk space in %s for restore, missing at least %4.3f MBNot enough disk space in %s for verification, missing at least %4.3f MBNicht genug Plattenplatz in %s fuer Zurueckladen, es fehlen mindestens %4.3f MBNicht genug Plattenplatz in %s fuer Verifikation, es fehlen mindestens %4.3f MBRestore of %s waiting for disk space...Verification of %s waiting for disk space...Zurueckladen von %s wartet auf Plattenplatz...Verifikation von %s wartet auf Plattenplatz...Verification of backup of %s successfulVerifikation der Sicherung von %s erfolgreichVerification of backup of %s failed due to previous errorsVerification of file %s failed due to previous errorsVerifikation der Sicherung von %s aufgrund frueherer Fehler gescheitertVerifikation der Datei %s aufgrund frueherer Fehler gescheitertVerification of header files on volume in device %s failedVerifikation der Kopfdateien auf Datentraeger in Geraet %s gescheitertThe content of saved file %s is different from the content of %sThe content of file %s is different from the content of %sDer Inhalt der gesicherten Datei %s ist unterschiedlich von dem Inhalt von %sDer Inhalt der Datei %s ist unterschiedlich von dem Inhalt von %sThe size %1.0f of the saved file %s is different from the size %1.0f of %sThe size %1.0f of the saved file %s is different from the expected size %1.0fDie Groesse %1.0f der gesicherten Datei %s ist unterschiedlich von der Groesse %1.0f von %sDie Groesse %1.0f der gesicherten Datei %s ist unterschiedlich von der erwarteten Groesse %1.0fNo verification on cpio continuation volumeKeine Verifikation auf cpio-FortsetzungsdatentraegerBackup of directory %s will not be verifiedSicherung von Verzeichnis %s wird nicht verifiziert%s is not a directory%s ist kein VerzeichnisDirectory %s createdDirectory %s:%s createdVerzeichnis %s angelegtVerzeichnis %s:%s angelegtSymbolic link from %s to %s createdSymbolischer Link von %s zu %s angelegtFile %s has been already reported by backup utilityDatei %s wurde bereits vom Backup-Utility zurueckgemeldetPerhaps cpio_disk_flags '%s' should be usedVielleicht sollten cpio_disk_flags '%s' benutzt werden%d of %d file restored by backup utility%d of %d files restored by backup utility%d von %d Datei durch Backup-Utility zurueckgeladen%d von %d Dateien durch Backup-Utility zurueckgeladenBackup utility has reported an error while restoring file %sBackup-Utility hat beim Zurueckladen der Datei %s einen Fehler gemeldetUnknown file '%s' restored by backup utilityUnbekannte Datei '%s' durch Backup-Utility zurueckgeladenBRTOOLS call failedBRTOOLS-Aufruf gescheitertVolume name %s not unique - automatic restore not possibleDatentraegername %s nicht eindeutig - automatisches Zurueckladen nicht moeglichDistribution of files on volume %s:Verteilung der Dateien auf Datentraeger %s:Duration of backup for files saved to volume %s:Dauer der Sicherung von Dateien gesichert auf Datentraeger %s:Duration of restore for files saved to volume %s:Dauer des Zurueckladens von Dateien gesichert auf Datentraeger %s:File/directory name '%s' contains white spaces / caret characters - file cannot be processedFile/directory name '%s' contains white spaces / caret characters - file will be skippedDatei-/Verzeichnisname '%s' beinhaltet Leerstellen / Winkelzeichen - Datei kann nicht verarbeitet werdenDatei-/Verzeichnisname '%s' beinhaltet Leerstellen / Winkelzeichen - Datei wird uebersprungenRaw disk '%s' not foundRaw-Platte '%s' nicht gefunden'%s' is not a raw disk'%s' ist keine Raw-PlatteCompress of %s waiting for disk space...Komprimierung von %s wartet auf Plattenplatz...No backup of file '%s' found by backup utilityKeine Sicherung von Datei '%s' gefunden durch Backup-UtilityNo backup of unknown file '%s' found by backup utilitykeine Sicherung von unbekannter Datei '%s' gefunden durch Backup-UtilityMounting volume %s in device %s ...Mounting volumes %s in devices %s ...Montieren des Datentraegers %s in Geraet %s ...Montieren der Datentraeger %s in Geraeten %s ...Mounting volume %s in device %s successfulMounting volumes %s in devices %s successfulMontieren des Datentraegers %s in Geraet %s erfolgreichMontieren der Datentraeger %s in Geraeten %s erfolgreichMounting volume %s in device %s failedMounting volumes %s in devices %s failedMontieren des Datentraegers %s in Geraet %s gescheitertMontieren der Datentraeger %s in Geraeten %s gescheitertDismounting volume in device %s ...Dismounting volumes in devices %s ...Demontieren des Datentraegers in Geraet %s ...Demontieren der Datentraeger in Geraeten %s ...Dismounting volume in device %s successfulDismounting volumes in devices %s successfulDemontieren des Datentraegers in Geraet %s erfolgreichDemontieren der Datentraeger in Geraeten %s erfolgreichDismounting volume in device %s failedDismounting volumes in devices %s failedDemontieren des Datentraegers in Geraet %s gescheitertDemontieren der Datentraeger in Geraeten %s gescheitert%s is not a data file - its backup cannot be verified using DBVERIFY%s is not a data file - it cannot be verified using DBVERIFY%s ist keine Datendatei - ihre Sicherung kann mittels DBVERIFY nicht verifiziert werden%s ist keine Datendatei - sie kann mittels DBVERIFY nicht verifiziert werdenVerifying backup of %s using DBVERIFYVerifying %s using DBVERIFY...Verifikation der Sicherung von %s mittels DBVERIFYVerifikation von %s mittels DBVERIFY...Verification of backup of %s using DBVERIFY successfulVerification of %s using DBVERIFY successfulVerifikation der Sicherung von %s mittels DBVERIFY erfolgreichVerifikation von %s mittels DBVERIFY erfolgreichVerification of backup of %s using DBVERIFY failed due to previous errorsVerification of %s using DBVERIFY failed due to previous errorsVerifikation der Sicherung von %s mittels DBVERIFY aufgrund frueherer Fehler gescheitertVerifikation von %s mittels DBVERIFY aufgrund frueherer Fehler gescheitertDBVERIFY has detected corrupt blocks in %sRMAN has detected corrupt blocks in %sDBVERIFY hat beschaedigte Bloecke entdeckt in %sRMAN hat beschaedigte Bloecke entdeckt in %sBackup of unknown file '%s' confirmed by backup utilitySicherung einer unbekannten Datei '%s' bestaetigt von Backup-Utility%d of %d file backup confirmed by backup utility%d of %d file backups confirmed by backup utility%d von %d Dateisicherung von Backup-Utility bestaetigt%d von %d Dateisicherungen von Backup-Utility bestaetigtBRRESTORE %sBRRESTORE completed successfullyBRRESTORE erfolgreich beendetBRRESTORE completed successfully with warningsBRRESTORE completed successfully with warnings or non-fatal errorsBRRESTORE erfolgreich mit Warnungen beendetBRRESTORE erfolgreich mit Warnungen oder nicht-fatalen Fehlern beendetBRRESTORE terminated with errorsBRRESTORE mit Fehlern beendetStart of file restore: %s.%s %sStart des Zurueckladens von Dateien: %s.%s %sEnd of file restore: %s.%s %sEnde des Zurueckladens von Dateien: %s.%s %sRestore of database: %sZurueckladen der Datenbank: %sBRRESTORE action ID: %sBRRESTORE Aktions-ID: %sBRRESTORE function ID: %sBRRESTORE Funktions-ID: %sTablespace for restore: %sTablespaces for restore: %sTablespace fuer Zurueckladen: %sTablespaces fuer Zurueckladen: %sDatabase file for restore: %sDatabase files for restore: %sDatenbankdatei fuer Zurueckladen: %sDatenbankdateien fuer Zurueckladen: %sNon-database file for restore: %sNon-database files for restore: %sNichtdatenbankdatei fuer Zurueckladen: %sNichtdatenbankdateien fuer Zurueckladen: %sDirectory for restore: %sDirectories for restore: %sVerzeichnis fuer Zurueckladen: %sVerzeichnisse fuer Zurueckladen: %sOffline redolog file for restore of database instance %s: %sOffline redolog files for restore of database instance %s: %sOffline-Redolog-Datei fuer Zurueckladen von Datenbankinstanz %s: %sOffline-Redolog-Dateien fuer Zurueckladen von Datenbankinstanz %s: %sFile for restore using backup utility ID %s: %sFiles for restore using backup utility ID %s: %sDatei fuer Zurueckladen mittels Backup-Utility-ID %s: %sDateien fuer Zurueckladen mittels Backup-Utility-ID %s: %s%d file found to restore, size %4.3f MB%d files found to restore, total size %4.3f MB%d Datei zum Zurueckladen gefunden, Groesse %4.3f MB%d Dateien zum Zurueckladen gefunden, Gesamtgroesse %4.3f MBNo files found for restore/verificationNo files found for restore/verification in backup %s.%sKeine Dateien zu Zurueckladen/Verifikation gefundenKeine Dateien zu Zurueckladen/Verifikation in Sicherung %s.%s gefunden%d of %d file restored - %4.3f of %4.3f MB done%d of %d files restored - %4.3f of %4.3f MB done%d von %d Datei zurueckgeladen - %4.3f von %4.3f MB fertig%d von %d Dateien zurueckgeladen - %4.3f von %4.3f MB fertigFiles will be restored from backup: %sFiles will be restored from backups: %sDateien werden zurueckgeladen von Sicherung: %sDateien werden zurueckgeladen von Sicherungen: %sFiles will be restored from directory: %sFiles will be restored from directories: %sDateien werden zurueckgeladen von Verzeichnis: %sDateien werden zurueckgeladen von Verzeichnissen: %sRestore device type: %sGeraetetyp fuer Zurueckladen: %sFile for restore directly from tape volume: %sBackup file for restore directly from disk: %sDatei fuer Zurueckladen direkt von Banddatentraeger: %sSicherungsdatei fuer Zurueckladen direkt von Platte: %sFiles will be decompressedFiles will be decompressed by brtoolsDateien werden dekomprimiertDateien werden mit brtools dekomprimiertFiles will not be decompressedDateien werden nicht dekomprimiertFiles will be decompressed by hardwareDateien werden mit Hardware dekomprimiertDirectories do not need to be decompressedVerzeichnisse muessen nicht dekomprimiert werdenFiles from the old sapdata_home %s will be restored into the new sapdata_home %sDateien aus dem alten sapdata_home %s werden in das neue sapdata_home %s zurueckgeladenFile %s will be overwrittenFile %s might be overwrittenDatei %s wird ueberschriebenDatei %s koennte ueberschrieben werdenDirectory %s will be overwrittenRaw disk %s will be overwrittenVerzeichnis %s wird ueberschriebenRaw-Platte %s wird ueberschriebenStart %s either with option '%s' or '%s'Starten Sie %s entweder mit Option '%s' oder '%s'BRRESTORE with option '%s' currently running or was killedBRRESTORE mit Option '%s' laeuft gerade oder wurde abgebrochenPlease delete file %s if BRRESTORE was killedBitte Datei %s loeschen, wenn BRRESTORE abgebrochen wurdeSetting of BRRESTORE lock failedSetzen von BRRESTORE-Sperre gescheitertFile name missing in message from backup utilityDateiname fehlt in Nachricht von Backup-UtilityLast successful disk backup not found in %sLast successful backup not found in %s in recovery interval of %d daysLetzte erfolgreiche Plattensicherung nicht gefunden in %sLetzte erfolgreiche Sicherung nicht gefunden in %s in Recovery-Intervall von %d TagenBackup %s is not a whole database backup (ALL)Sicherung %s ist keine Gesamtsicherung der Datenbank (ALL)File %s to be restored/verified was not backed upFile %s to be restored/verified was not backed up or is not a database fileDie zurueckzuladende / zu verifizierende Datei %s wurde nicht gesichertDie zurueckzuladende / zu verifizierende Datei %s wurde nicht gesichert oder ist keine DatenbankdateiRedolog sequence number %d not found in %sRedolog-Sequenznummer %d nicht gefunden in %sNo offline redolog files found in %s for processing for device type %sNo offline redolog files found in %s for processing for device type %s in recovery interval of %d daysKeine Offline-Redolog-Dateien in %s fuer Geraetetyp %s zum Verarbeiten gefundenKeine Offline-Redolog-Dateien in %s fuer Geraetetyp %s zum Verarbeiten gefunden in Recovery-Intervall von %d TagenDatabase instance '%s' not foundDatabase instance '%s' not found in backup %sDatenbankinstanz '%s' nicht gefundenDatenbankinstanz '%s' nicht gefunden in Sicherung %sDatabase instance %s not unique in option '%s'Datenbankinstanz %s nicht eindeutig in Option '%s'Second copy of offline redolog files will be used for restoreZweite Kopie von Offline-Redolog-Dateien wird fuer Zurueckladen benutztFile '%s' to be restored not foundBackup file '%s' not found - it cannot be restoredZurueckzuladende Datei '%s' nicht gefundenSicherungsdatei '%s' nicht gefunden - sie kann nicht zurueckgeladen werdenEntry '%s' to be restored does not exist in the saved directory %sDer zurueckzuladende Eintrag '%s' ist im gesicherten Verzeichnis %s nicht vorhanden%d files were already restored in the following run: %s%d files were already restored in the following runs: %s%d Dateien wurden bereits im folgenden Lauf zurueckgeladen: %s%d Dateien wurden bereits in den folgenden Laeufen zurueckgeladen: %sAll files were already restored in the following run: %sAll files were already restored in the following runs: %sAlle Dateien wurden bereits im folgenden Lauf zurueckgeladen: %sAlle Dateien wurden bereits in den folgenden Laeufen zurueckgeladen: %sDisk backup of offline redolog file '%s' not found in %sDisk backup of archivelog file with sequence number %d of thread %d not found in %sPlattensicherung der Offline-Redolog-Datei '%s' nicht gefunden in %sPlattensicherung der Archivelog-Datei mit Sequenznummer %d von Thread %d nicht gefunden in %sCompress directory %s on the same disk as %s - disk space problems possibleKomprimierungsverzeichnis %s auf demselben Plattendatentraeger wie %s - Plattenplatzprobleme moeglichRestore mode: %sModus des Zurueckladens: %sRead only tablespace %s will not be considered for restoreRead-Only-Tablespace %s wird fuer Zurueckladen nicht beruecksichtigtMessage '%s' not found in %sMeldung '%s' nicht gefunden in %sContinuation of message '%s' not found in %sFortsetzung von Meldung '%s' nicht gefunden in %sError message found in %s:Fehlermeldung in %s gefunden:Values of %s are different: current '%s', backup %s '%s'Werte von %s sind verschieden: aktuell '%s', Sicherung %s '%s'Value '%s' of %s will be used for restoreWert '%s' von %s wird benutzt fuer ZurueckladenProbably the database must be recovered due to restore from online backupWahrscheinlich muss die Datenbank aufgrund Zurueckladens von Online-Sicherung wiederhergestellt werdenProbably the database must be recovered due to partial restoreWahrscheinlich muss die Datenbank aufgrund Teilzurueckladens wiederhergestellt werdenInformation about backup file '%s' not found in log headerInformationen ueber gesicherte Datei '%s' nicht im Protokollkopf gefundenBackup %s terminated with errorsSicherung %s mit Fehlern beendetTermination message not found in %s - log file incomplete (this is OK if the log file has been restored)Endemeldung nicht gefunden in %s - Protokoll unvollstaendig (das ist in Ordnung, wenn das Protokoll zurueckgeladen worden ist)Redolog sequence number in line %d of %s not ascendingRedolog-Sequenznummer in Zeile %d von %s nicht aufsteigendAll lines in %s till line %d will be ignoredAll lines in %s from line %d on will be ignoredAlle Zeilen in %s bis Zeile %d werden ignoriertAlle Zeilen in %s beginnend ab Zeile %d werden ignoriertOnly backup confirmation will be inquired due to disk space shortage in compress_dir (missing at least %4.3f MB)Nur Bestaetigung der Sicherungen wird abgefragt aufgrund der Knappheit von Plattenplatz in compress_dir (es fehlen mindestens %4.3f MB)Line %d in %s rejected for %s because of different backup device typesZeile %d in %s aufgrund verschiedener Sicherungsgeraetetypen fuer %s abgelehntWrong value of %s for the first offline redolog file foundFalscher Wert von %s fuer die erste gefundene Offline-Redolog-DateiStart %s separately for each backup device typeStarten Sie %s fuer jeden Sicherungsgeraetetyp separatLine %d in %s rejected for %s because of different compress typesZeile %d in %s aufgrund verschiedener Komprimierungstypen fuer %s abgelehntStart %s separately for each compress typeStarten Sie %s fuer jeden Komprimierungstyp separatLine %d in %s rejected for %s because of different tape copy command typesLine %d in %s rejected for %s because of different disk copy command typesZeile %d in %s aufgrund verschiedener Bandkopierkommandotypen fuer %s abgelehntZeile %d in %s aufgrund verschiedener Plattenkopierkommandotypen fuer %s abgelehntStart %s separately for each tape copy command typeStart %s separately for each disk copy command typeStarten Sie %s fuer jeden Bandkopierkommandotyp separatStarten Sie %s fuer jeden Plattenkopierkommandotyp separatRestore %s terminated with errorsRestore %s mit Fehlern beendetUncatalog option set - uncataloging save sets only, no restoreUncatalog-Option gesetzt - nur Dekatalogisierung der Savesets, kein Zurueckladen%d file found to uncatalog, size %4.3f MB%d files found to uncatalog, total size %4.3f MB%d Datei zum Dekatalogisieren gefunden, Groesse %4.3f MB%d Dateien zum Dekatalogisieren gefunden, Gesamtgroesse %4.3f MBFirst copy of offline redolog file will be uncatalogedFirst copies of offline redolog files will be uncatalogedErste Kopie der Offline-Redolog-Datei wird dekatalogisiertErste Kopien der Offline-Redolog-Dateien werden dekatalogisiertSecond copy of offline redolog file will be uncatalogedSecond copies of offline redolog files will be uncatalogedZweite Kopie der Offline-Redolog-Datei wird dekatalogisiertZweite Kopien der Offline-Redolog-Dateien werden dekatalogisiertData file '%s' not foundDatendatei '%s' nicht gefundenOracle pfile %s created from spfile %sOracle pfile %s created from memoryOracle-Pfile %s erstellt aus Spfile %sOracle-Pfile %s erstellt aus Memory%s is not a symbolic link%s ist kein symbolischer LinkSymbolic link from %s to %s deletedSymbolic link %s deletedSymbolischer Link von %s zu %s geloeschtSymbolischer Link %s geloeschtDirectory %s deletedDirectory %s:%s deletedVerzeichnis %s geloeschtVerzeichnis %s:%s geloeschtBackup %s done by BRBACKUP version %s cannot be processedIgnoring backup %s.%s %s %s done by BRBACKUP version %sSicherung %s von einer BRBACKUP-Version %s kann nicht verarbeitet werdenSicherung %s.%s %s %s von einer BRBACKUP-Version %s wird ignoriertThe passwords entered must be identicalDie eingegebenen Kennwoerter muessen identisch seinTerminating %s processing after %d days...%s-Verarbeitung wird nach %d Tagen beendet...%s log file: %s%s Protokolldatei: %sDifferent symbolic link already exists for %sUnterschiedlicher symbolischer Link bereits existiert fuer %sBackup mode '%s' supported only for backup of disk backupSicherungsmodus '%s' unterstuetzt nur fuer Sicherung einer PlattensicherungIndex/Empty file %s to be recovered was not backed up - it can be recreated after recoveryTemporary file %s to be recovered was not backed up - it will be recreated after recoveryWiederherzustellende Index-/leere Datei %s wurde nicht gesichert - sie kann nach der Wiederherstellung neu angelegt werdenWiederherzustellende temporaere Datei %s wurde nicht gesichert - sie wird nach der Wiederherstellung neu angelegtIndex/empty file %s will be dropped now - its indexes will be rebuiltIndex/empty file %s will be deleted now - its indexes will be rebuiltIndex-/leere Datei %s wird jetzt verworfen - ihre Indizes werden neu aufgebautIndex-/leere Datei %s wird jetzt geloescht - ihre Indizes werden neu aufgebautNew index/empty tablespace %s will be created for tablespace %s with file: %sNew index/empty tablespace %s will be created for tablespace %s with files: %sNeuer Index-/leerer Tablespace %s wird fuer Tablespace %s angelegt mit Datei: %sNeuer Index-/leerer Tablespace %s wird fuer Tablespace %s angelegt mit Dateien: %sDatabase file %s (and its subdirectory or link if applicable) will be deleted nowDatabase file %s will be deleted nowDatenbankdatei %s (und wenn anwendbar ihr Unterverzeichnis oder Link) wird jetzt geloeschtDatenbankdatei %s wird jetzt geloeschtSubdirectory or link for database file %s and will be recreated now if neededUnterverzeichnis oder Link fuer Datenbankdatei %s Link wird jetzt neu angelegt wenn notwendigExport tablespaces parameter file %s createdParameterdatei fuer Export von Tablespaces %s angelegtImport tablespaces parameter file %s createdParameterdatei fuer Import von Tablespaces %s angelegtOracle pfile cannot be created from spfile in remote OPS$ connect mode on UNIX platformsOracle-Pfile kann nicht aus Spfile erstellt werden in Remote-OPS$-Verbindungsmodus auf UNIX-PlattformenSymbolic link from %s to %s will be recreated nowSymbolischer Link von %s zu %s wird jetzt neu angelegtOffline redolog files created before database reset cannot be saved by RMANOffline redolog files created before database reset cannot be verified by RMANOffline-Redolog-Dateien, die vor Datenbank-Reset erstellt wurden, koennen mit RMAN nicht gesichert/verifiziert werdenOffline-Redolog-Dateien, die vor Datenbank-Reset erstellt wurden, koennen mit RMAN nicht verifiziert werdenChecking the contents of duplex offline redolog file %s successfulUeberpruefung vom Inhalt der Duplex-Offline-Redolog-Datei %s erfolgreichChecking the contents of duplex offline redolog file %s failed - file will not be deletedUeberpruefung vom Inhalt der Duplex-Offline-Redolog-Datei %s gescheitert - Datei wird nicht geloeschtTo avoid recreating of index tablespaces, please select other or more backups if possibleUm das Neuanlegen von Index-Tablespaces zu vermeiden, bitte waehlen Sie andere oder weitere Sicherungen, wenn moeglichBR_TRACE: %p DB_FILE - name: %sStarting normal database backup using RMAN...Starten der normalen Datenbanksicherung mittels RMAN...Normal database backup using RMAN successfulNormale Datenbanksicherung mittels RMAN erfolgreichNormal database backup using RMAN failedNormale Datenbanksicherung mittels RMAN gescheitertStarting full database backup (level 0) using RMAN...Starten der Vollsicherung der Datenbank (Level 0) mittels RMAN...Full database backup (level 0) using RMAN successfulVollsicherung der Datenbank (Level 0) mittels RMAN erfolgreichFull database backup (level 0) using RMAN failedVollsicherung der Datenbank (Level 0) mittels RMAN gescheitertStarting incremental database backup (level 1) using RMAN...Starten der inkrementellen Datenbanksicherung (Level 1) mittels RMAN...Incremental database backup (level 1) using RMAN successfulInkrementelle Datenbanksicherung (Level 1) mittels RMAN erfolgreichIncremental database backup (level 1) using RMAN failedInkrementelle Datenbanksicherung (Level 1) mittels RMAN gescheitertStarting full backup of new database files using RMAN...Starten der Vollsicherung von neuen Datenbankdateien mittels RMAN...Full backup of new database files using RMAN successfulVollsicherung von neuen Datenbankdateien mittels RMAN erfolgreichFull backup of new database files using RMAN failedVollsicherung von neuen Datenbankdateien mittels RMAN gescheitertLast full database backup (level 0): %sCorresponding full database backup (level 0): %sLetzte Vollsicherung der Datenbank (Level 0): %sEntsprechende Vollsicherung der Datenbank (Level 0): %sFollowing file created after the last full database backup (level 0) will be fully saved:Following files created after the last full database backup (level 0) will be fully saved:Folgende nach der letzten Vollsicherung der Datenbank (Level 0) angelegte Datei wird vollstaendig gesichert:Folgende nach der letzten Vollsicherung der Datenbank (Level 0) angelegte Dateien werden vollstaendig gesichert:Last full database backup (level 0) not foundCorresponding full database backup (level 0) %s not foundLetzte Vollsicherung der Datenbank (Level 0) nicht gefundenEntsprechende Vollsicherung der Datenbank (Level 0) %s nicht gefundenLast full database backup (level 0) %s was not successfulLast full database backup (level 0) %s was successfulLetzte Vollsicherung der Datenbank (Level 0) %s war nicht erfolgreichLetzte Vollsicherung der Datenbank (Level 0) %s war erfolgreichLast full database backup (level 0) %s was killed or restoredLetzte Vollsicherung der Datenbank (Level 0) %s wurde abgebrochen oder zurueckgeladenLast full database backup (level 0) %s older than the value %d of parameter '%s'Letzte Vollsicherung der Datenbank (Level 0) %s aelter als der Wert %d von Parameter '%s'Redolog sequence number %d of the last full backup (level 0) %s not found in table %sRedolog-Sequenznummer %d der letzten Vollsicherung der Datenbank (Level 0) %s nicht gefunden in Tabelle %sPlease start a full database backup (level 0) firstBitte starten Sie zuerst eine Vollsicherung der Datenbank (Level 0)Backup of database file save set piece - %sBackup of control file save set piece - %sSicherung von Datenbankdatei Saveset-Piece - %sSicherung von Steuerdatei Saveset-Piece - %s%d of %d file / save set processed by RMAN%d of %d files / save sets processed by RMAN%d von %d Datei/Saveset durch RMAN verarbeitet%d von %d Dateien/Savesets durch RMAN verarbeitetPreparation for using RMAN only - no backupNur Vorbereitung fuer die Benutzung von RMAN - keine SicherungPreparation of database backup using RMAN failedVorbereitung der Datenbanksicherung mittels RMAN gescheitertPreparing backup of %s using RMAN...Vorbereitung der Sicherung von %s mittels RMAN...Preparation of backup of %s using RMAN failed due to previous errorsVorbereitung der Sicherung von %s mittels RMAN aufgrund frueherer Fehler gescheitertSave sets with %s file:Save sets with %s files:Savesets mit %s Datei:Savesets mit %s Dateien:Save set information not available for %sSaveset-Informationen nicht verfuegbar fuer %sRun BRBACKUP with option '-m all' to update information about all save setsStarten Sie BRBACKUP mit Option '-m all', um Informationen ueber alle Savesets zu aktualisierenCataloging backups of all database files...Cataloging backups of all database files to database %s ...Katalogisierung der Sicherungen aller Datenbankdateien...Katalogisierung der Sicherungen aller Datenbankdateien in Datenbank %s ...Backups of all database files cataloged successfullySicherungen aller Datenbankdateien erfolgreich katalogisiertCataloging backups of all database files failedKatalogisierung der Sicherungen aller Datenbankdateien gescheitertUncataloging save sets created by RMAN...Dekatalogisierung der von RMAN erstellten Savesets...Save sets created by RMAN uncataloged successfullyDie von RMAN erstellten Savesets erfolgreich dekatalogisiertUncataloging save sets created by RMAN failedDekatalogisierung der von RMAN erstellten Savesets gescheitertRMAN call for database instance %s failedRMAN-Aufruf fuer Datenbankinstanz %s gescheitertBRSBTLIB call %s failedBRSBTLIB-Aufruf %s gescheitertCopying of data by BRSBTLIB failedKopieren von Daten durch BRSBTLIB gescheitertCompression function failed, return code: %dCompression function failed, return code: %d - %sKomprimierungsfunktion gescheitert, Return-Code: %dKomprimierungsfunktion gescheitert, Return-Code: %d - %sSave set piece %d savedSave set number %d savedSaveset-Teil %d gesichertSaveset-Nummer %d gesichertStarting offline redolog backup using RMAN...Starten der Offline-Redolog-Sichering mittels RMAN...Offline redolog backup using RMAN successfulOffline-Redolog-Sichering mittels RMAN erfolgreichOffline redolog backup using RMAN failedOffline-Redolog-Sichering mittels RMAN gescheitertSaving offline redolog file save set piece - %sOffline redolog file %s included in save set %sSicherung von Offline-Redolog-Datei Saveset-Piece - %sOffline-Redolog-Datei %s inkludiert in Saveset %sDatabase reset logs ID not foundDatenbank Reset-Logs-ID nicht gefunden'Shutting down instance' message not found in Oracle alert log %s for the last startup - cannot check if database instance %s was cleanly shut down'Shutting down instance' Meldung fuer das letzte Starten nicht gefunden in Oracle-Alert-Protokoll %s - es kann nicht ueberprueft werden, ob die Datenbankinstanz %s sauber runtergefahren wurdeError messages found in Oracle alert log %s for the last shutdown - database instance %s was not cleanly shut downFehlermeldungen fuer das letzte Stoppen gefunden in Oracle-Alert-Protokoll %s - Datenbankinstanz %s wurde nicht sauber runtergefahrenCheck Oracle alert log %s for further information about this errorUeberpruefen Sie Oracle-Alert-Protokoll %s fuer weitere Informationen ueber diesen FehlerChecking symbolic links using the last good BRBACKUP log file...Ueberpruefung der symbolischen Links mittels der letzten guten BRBACKUP-Protokolldatei...Proxy file handle - %sProxy-Datei-Handle - %sStarting restore from normal database backup using RMAN...Starten des Zurueckladens von einer normalen Datenbanksicherung mittels RMAN...Restore from normal database backup using RMAN successfulZurueckladen von einer normalen Datenbanksicherung mittels RMAN erfolgreichRestore from normal database backup using RMAN failedZurueckladen von einer normalen Datenbanksicherung mittels RMAN gescheitertStarting restore from full database backup using RMAN...Starten des Zurueckladens von einer Vollsicherung der Datenbank mittels RMAN...Restore from full database backup using RMAN successfulZurueckladen von einer Vollsicherung der Datenbank mittels RMAN erfolgreichRestore from full database backup using RMAN failedZurueckladen von einer Vollsicherung der Datenbank mittels RMAN gescheitertStarting restore of incremental database backup using RMAN...Starten des Zurueckladens einer inkrementellen Datenbanksicherung mittels RMAN...Restore of incremental database backup using RMAN successfulZurueckladen einer inkrementellen Datenbanksicherung mittels RMAN erfolgreichRestore of incremental database backup using RMAN failedZurueckladen einer inkrementellen Datenbanksicherung mittels RMANgescheitertRestoring save set piece - %sRestoring file %s from save set %sZurueckladen von Saveset-Piece - %sZurueckladen der Datei %s von Saveset %sBackup %s is not a full database backup (level 0)Sicherung %s ist keine Vollsicherung der Datenbank (Level 0)Backup %s is not a incremental database backup (level 1)Sicherung %s ist keine inkrementelle Datenbanksicherung (Level 1)Run BRRESTORE with option '-m incr|incr_only|incr_full' to restore an incremental database backupStarten Sie BRRESTORE mit Option '-m incr|incr_only|incr_full', um eine inkrementelle Datenbanksicherung zurueckzuladenFile %s cannot be restored with other data files using RMANDatei %s kann nicht mit anderen Datendateien mittels RMAN zurueckgeladen werdenDue to running database instance control file cannot be restored during a BRRESTORE run with RMANDue to running database instance control file cannot be restored with other data filesWegen laufender Datenbankinstanz kann die Steuerdatei nicht waehrend eines BRRESTORE-Laufs mit RMAN zurueckgeladen werdenWegen laufender Datenbankinstanz kann die Steuerdatei nicht mit anderen Datendateien zurueckgeladen werdenStop the database instance and restore the control file separatelyStoppen Sie die Datenbankinstanz und laden die Steuerdatei separat zurueckThis file can be restored in a separate BRRESTORE runThese files can be restored in a separate BRRESTORE runDiese Datei kann in einem separaten BRRESTORE-Lauf zurueckladen werdenDiese Dateien koennen in einem separaten BRRESTORE-Lauf zurueckladen werdenVerifying backup of %s using RMANVerifying %s using RMAN...Verifikation der Sicherung von %s mittels RMANVerifikation von %s mittels RMAN...Verification of backup of %s using RMAN successfulVerification of %s using RMAN successfulVerifikation der Sicherung von %s mittels RMAN erfolgreichVerifikation von %s mittels RMAN erfolgreichVerification of backup of %s using RMAN failed due to previous errorsVerification of %s using RMAN failed due to previous errorsVerifikation der Sicherung von %s mittels RMAN aufgrund frueherer Fehler gescheitertVerifikation von %s mittels RMAN aufgrund frueherer Fehler gescheitertStarting verification of normal database backup using RMAN...Starten der Verifikation einer normalen Datenbanksicherung mittels RMAN...Verification of normal database backup using RMAN successfulVerifikation einer normalen Datenbanksicherung mittels RMAN erfolgreichVerification of normal database backup using RMAN failedVerification of data file using RMAN failedVerifikation einer normalen Datenbanksicherung mittels RMAN gescheitertVerifikation von Datendatei mittels RMAN gescheitertStarting verification of full database backup using RMAN...Starten der Verifikation einer Vollsicherung der Datenbank mittels RMAN...Verification of full database backup using RMAN successfulVerifikation einer Vollsicherung der Datenbank mittels RMAN erfolgreichVerification of full database backup using RMAN failedVerifikation einer Vollsicherung der Datenbank mittels RMAN gescheitertStarting verification of incremental database backup using RMAN...Starten der Verifikation einer inkrementellen Datenbanksicherung mittels RMAN...Verification of incremental database backup using RMAN successfulVerifikation einer inkrementellen Datenbanksicherung mittels RMAN erfolgreichVerification of incremental database backup using RMAN failedVerifikation einer inkrementellen Datenbanksicherung mittels RMAN gescheitertVerification of save set piece - %sVerifikation von Saveset-Piece - %sSave set piece %d appliedSave set number %d appliedSaveset-Teil %d eingespieltSaveset-Nummer %d eingespieltStarting restore of offline redolog files using RMAN...Starten des Zurueckladens von Offline-Redolog-Dateien mittels RMAN...Restore of offline redolog files using RMAN successfulZurueckladen von Offline-Redolog-Dateien mittels RMAN erfolgreichRestore of offline redolog files using RMAN failedZurueckladen von Offline-Redolog-Dateien mittels RMAN gescheitertStarting verification of offline redolog backup using RMAN...Starten der Verifikation einer Offline-Redolog-Sicherung mittels RMAN...Verification of offline redolog backup using RMAN successfulVerifikation einer Offline-Redolog-Sicherung mittels RMAN erfolgreichVerification of offline redolog backup using RMAN failedVerification of archivelog file using RMAN failedVerifikation einer Offline-Redolog-Sicherung mittels RMAN gescheitertVerifikation von Archivelog-Datei mittels RMAN gescheitertOffline redolog file %s exists - RMAN will probably failOffline-Redolog-Datei %s vorhanden - RMAN wird wahrscheinlich scheiternPlease delete or rename the existing offline redolog filePlease delete or rename the existing offline redolog filesBitte die vorhandene Offline-Redolog-Datei loeschen oder umbennenenBitte die vorhandenen Offline-Redolog-Dateien loeschen oder umbennenenDevice type 'rman' cannot be used for restore of non-data filesGeraetetyp 'rman' kann fuer Zurueckladen von Nicht-Datendateien nicht benutzt werdenBackup %s is not a partial database backupSicherung %s ist keine partielle Sicherung der DatenbankRaw disk file or directory %s can be only confirmed by backup utilityRaw-Plattendatei oder Verzeichnis %s kann von Backup-Utility nur bestaetigt werdenCannot apply more than %d archivelog files in one stepMehr als %d Archivelog-Dateien koennen nicht in einem Schritt eingespielt werdenNon-standard raw disk offset detected for database file %s - please contact SAPNicht-standardmaessiger Raw-Platten-Offset fuer Datenbankdatei %s entdeckt - bitte wenden Sie sich an SAPSelecting indexes/partitions with NOLOGGING created during or after the selected backup %s ...Selektion der Indizes/Partitionen mit NOLOGGING angelegt waehrend oder nach der ausgewaehlten Sicherung %s ...No indexes found with NOLOGGING created during or after the selected backup %sKeine Indizes gefunden mit NOLOGGING angelegt waehrend oder nach der ausgewaehlten Sicherung %s%d index found with NOLOGGING created during or after the selected backup %s - it can be rebuilt now%d indexes found with NOLOGGING created during or after the selected backup %s - they can be rebuilt now%d Index mit NOLOGGING gefunden, der waehrend oder nach der ausgewaehlten Sicherung %s angelegt wurde - er kann jetzt neu aufgebaut werden%d Indizes mit NOLOGGING gefunden, die waehrend oder nach der ausgewaehlten Sicherung %s angelegt wurden - sie koennen jetzt neu aufgebaut werdenList of indexes for rebuild created in file %sList of index partitions for rebuild created in file %sListe der Indizes fuer Neuaufbau erstellt in Datei %sListe der Index-Partitionen fuer Neuaufbau erstellt in Datei %sFunction/action '%s' is not released yetFunktion/Aktion '%s' ist noch nicht freigegeben%s not supported for Oracle version lower than %s%s not supported for Oracle version higher than %s%s nicht unterstuetzt fuer Oracle-Version kleiner als %s%s nicht unterstuetzt fuer Oracle-Version groesser als %sDetermination of hardware ID failed, return code: %dErmittlung der Hardware-ID gescheitert, Return-Code: %dNo valid SAP license found - please contact SAPKeine gueltige SAP-Lizenz gefunden - bitte wenden Sie sich an SAPTemporary SAP license valid only till %sVorlaeufige SAP-Lizenz nur bis %s gueltigSAP license expires in %d daySAP license expires in %d daysSAP-Lizenz laeuft in %d Tag abSAP-Lizenz laeuft in %d Tagen abUsed functionality is not covered by the current SAP licenseBenutzter Funktionsumfang ist durch die aktuelle SAP-Lizenz nicht abgedecktDatabase size exceeds the SAP license limitsDatenbankgroesse ueberschreitet die Beschraenkungen der SAP-LizenzSAP license has already expired - please contact SAPTemporary SAP license has already expired - please install an official version of BR*ToolsSAP-Lizenz ist bereits abgelaufen - bitte wenden Sie sich an SAPTemporaere SAP-Lizenz ist bereits abgelaufen - bitte installieren Sie eine offizielle Version von BR*ToolsQuick I/O file %s createdQuick I/O file %s resizedQuick-I/O-Datei %s angelegtQuick-I/O-Datei %s vergroessert/verkleinertCreation of Quick I/O file %s failedResize of Quick I/O file %s failedAnlegen der Quick-I/O-Datei %s gescheitertVergroesserung/Verkleinerung der Quick-I/O-Datei %s gescheitertBackup utility requested switch of backup mode for unknown file '%s'Backup-Utility verlangte Umschalten des Backup-Modus fuer unbekannte Datei '%s'Database instance '%s' not found in ORATABDatabase instance '%s' not found in REGISTRYDatenbankinstanz '%s' nicht gefunden in ORATABDatenbankinstanz '%s' nicht gefunden in REGISTRYDatabase instance was not shut down / started up by backup utilityDatabase instances were not shut down / started up by backup utilityDatenbankinstanz wurde vom Backup-Utility nicht gestoppt/gestartetDatenbankinstanzen wurden vom Backup-Utility nicht gestoppt/gestartetDatabase instance %s is shut downDatenbankinstanz %s ist gestopptDatabase instance %s is mounted%sDatabase instance %s is started/mountedDatenbankinstanz %s ist montiert%sDatenbankinstanz %s ist gestartet/montiert'%s' for database instance %s failed'%s' fuer Datenbankinstanz %s gescheitertTablespaces in table TSORA for SAP owner %s: %sTablespaces in Tabelle TSORA fuer SAP-Besitzer %s: %sDatabase instance %s is startedDatenbankinstanz %s ist gestartetDatabase instance %s will be started nowDatabase instance %s will be restarted nowDatenbankinstanz %s wird jetzt gestartetDatenbankinstanz %s wird jetzt neu gestartetStarting database instance %s ...Starten der Datenbankinstanz %s ...Start of database instance %s successfulStarten der Datenbankinstanz %s erfolgreichStart of database instance %s failedStarten der Datenbankinstanz %s gescheitertDatabase %s is not openDatabase %s is not startedDatenbank %s ist nicht geoeffnetDatenbank %s ist nicht gestartetDatabase system suspended successfullyDatenbanksystem erfolgreich angehaltenDatabase system suspension failedAnhalten des Datenbanksystems gescheitertDatabase system resumed successfullyDatenbanksystem erfolgreich wieder aufgenommenDatabase system resumption failedWiederaufnahme des Datenbanksystems gescheitertWrong message sequence from SPLITINT command: %sFehlerhafte Meldungsequenz vom SPLITINT-Kommando: %sNo message '%s' sent by SPLITINT commandKeine Meldung '%s' vom SPLITINT-Kommando ausgegebenSPLITINT command sent success message: %sSPLITINT-Kommando hat Erfolgsmeldung ausgegeben: %sSPLITINT command sent error message: %sSPLITINT-Kommando hat Fehlermeldung ausgegeben: %sDatabase instance '%s' not defined in parameter '%s'Datenbankinstanz '%s' nicht definiert in Parameter '%s'Unknown database instance '%s' found in parameter '%s'Unbekannte Datenbankinstanz '%s' gufunden in Parameter '%s'Database instance %s is not activeThread %d of database instance %s is disabledDatenbankinstanz %s ist nicht aktivThread %d von Datenbankinstanz %s deaktiviertInactive database instance %s started during the backupInaktive Datenbankinstanz %s waehrend der Sicherung gestartetStatus of database instance %s is unknownStatus der Datenbankinstanz %s ist unbekanntRestricted session mode will be enabled for database instance %sEingeschraenkter Session-Modus wird fuer Datenbankinstanz %s eingeschaltetRestricted session mode will be disabled for database instance %sEingeschraenkter Session-Modus wird fuer Datenbankinstanz %s ausgeschaltetRestricted session mode enabled for database instance %sEingeschraenkter Session-Modus eingeschaltet fuer Datenbankinstanz %sRestricted session mode disabled for database instance %sEingeschraenkter Session-Modus ausgeschaltet fuer Datenbankinstanz %sSQL statement waiting for busy resource: '%s'Thread %d: SQL statement waiting for busy resource: '%s'SQL-Anweisung wartet auf belegte Ressource: '%s'Thread %d: SQL-Anweisung wartet auf belegte Ressource: '%s'Deletion of database file '%s' waiting for releasing it by Oracle...Rename of database file '%s' waiting for releasing it by Oracle...Loeschen der Datenbankdatei '%s' wartet auf ihre Freigabe von Oracle...Umbenennen der Datenbankdatei '%s' wartet auf ihre Freigabe von Oracle...SQL statement waiting due to inconsistent control file: '%s'SQL statement waiting for successful control file operation: '%s'SQL-Anweisung wartet wegen inkonsistenter Steuerdatei: '%s'SQL-Anweisung wartet auf erfolgreiche Steuerdateioperation: '%s'Following tablespace will be dropped now: %sFollowing tablespaces will be dropped now: %sFolgender Tablespace wird jetzt geloescht: %sFolgende Tablespaces werden jetzt geloescht: %sBR_TRACE: location %s-%d, SQL statement: '%s'BR_TRACE: thread %d: location %s-%d, SQL statement: '%s'BR_TRACE: Stelle %s-%d, SQL-Anweisung: '%s'BR_TRACE: Thread %d: Stelle %s-%d, SQL-Anweisung: '%s'BR_TRACE: location %s-%d, SQL output: %sBR_TRACE: thread %d: location %s-%d, SQL output: %sBR_TRACE: Stelle %s-%d, SQL-Ausgabe: %sBR_TRACE: Thread %d: Stelle %s-%d, SQL-Ausgabe: %s-------------------------------------------------------------------------------+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++===============================================================================###############################################################################Standard keys: c - cont, b - back, s - stop, r - refr, h - helpStandardtasten: c - forts., b - zurueck, s - stoppen, r - aktual., h - HilfeBRTOOLS %sBRTOOLS completed successfullyBRTOOLS erfolgreich beendetBRTOOLS completed successfully with warningsBRTOOLS completed successfully with warnings or non-fatal errorsBRTOOLS erfolgreich mit Warnungen beendetBRTOOLS erfolgreich mit Warnungen oder nicht-fatalen Fehlern beendetBRTOOLS terminated with errorsBRTOOLS mit Fehlern beendetControl menu %d - please decide how to proceedSteuermenue %d - bitte entscheiden, wie fortgesetzt wirdChoice menu %d - please make a selectionAuswahlmenue %d - bitte eine Auswahl treffenInput menu %d - please enter/check input valuesEingabemenue %d - bitte Eingabewerte eintragen/ueberpruefenList menu %d - please select one entryList menu %d - you can select one entryListenmenue %d - bitte einen Eintrag auswaehlenListenmenue %d - Sie koennen einen Eintrag auswaehlenList menu %d - please select one or more entriesList menu %d - you can select one or more entriesListenmenue %d - bitte einen oder mehrere Eintraege auswaehlenListenmenue %d - Sie koennen einen oder mehrere Eintraege auswaehlenList display %d - no selection possibleListenanzeige %d - keine Auswahl moeglichHelp for menu %d:Hilfe fuer Menue %d:Enter your choice:Enter your selection:Auswahl eingeben:Your choice: '%s'Your selection: '%s'Ihre Auswahl: '%s'Invalid choice: '%s'Invalid selection: '%s'Ungueltige Auswahl: '%s'Unselectable choice: '%s'Unselectable selection: '%s'Unwaehlbare Auswahl: '%s'Locked choice: '%s'Locked selection: '%s'Gesperrte Auswahl: '%s'No default choice - processing cannot be continuedKeine vorgegebene Auswahl - Verarbeitung kann nicht fortgesetzt werdenWarnings or errors occurred - you can continue to ignore them or go back to repeat the last actionWarnungen oder Fehler aufgetreten - Sie koennen fortsetzen, um sie zu ignorieren, oder zurueckgehen, um die letzte Aktion zu wiederholenCannot continue due to previous warnings or errors - you can go back and repeat the last actionCannot continue due to previous warnings or errorsFortsetzung aufgrund frueherer Warnungen oder Fehler nicht moeglich - Sie koennen zurueckgehen und die letzte Aktion wiederholenFortsetzung aufgrund frueherer Warnungen oder Fehler nicht moeglichEnter '%s' to continue, '%s' to go back, '%s' to abort:Eingabe '%s' um fortzusetzen, '%s' um zurueckzugehen, '%s' um abzubrechen:Enter '%s' to go back, '%s' to abort:Eingabe '%s' um zurueckzugehen, '%s' um abzubrechen:Press - scroll, c - cont, s - skip, b - back, h - headerPress - scroll, - select, c - cont, s - skip, b - back, h - headerDruecken - scrollen, c - fortsetzen, s - springen, b - zurueck, h - UeberschriftDruecken - scrollen, - auswaehlen, c - fortsetzen, s - springen, b - zurueck, h - UeberschriftGoing back to the previous menu...Zurueck zum vorigen Menue...Cannot go back - no previous menuCannot go back in this menuZurueckgehen nicht moeglich - kein voriges MenueZurueckgehen in dem Menue nicht moeglichThis is a recommended action - do you want to execute it now?This is a optional action - do you want to execute it now?Dies ist eine empfohlene Aktion - moechten Sie sie jetzt ausfuehren?Dies ist eine optionale Aktion - moechten Sie sie jetzt ausfuehren?Enter '%s' to execute the action, '%s' to skip it, '%s' to abort:Eingabe '%s' um die Aktion auszufueheren, '%s' um sie zu ueberspringen, '%s' um abzubrechen:The action will be executed...Die Aktion wird ausgefuehrt...The action will be skipped...Die Aktion wird uebersprungen...Do you really want to cancel %s? Enter y[es]/n[o]:Wollen Sie wirklich %s abbrechen? Eingabe y[es]/n[o]:Do you really want to exit %s? Enter y[es]/n[o]:Wollen Sie wirklich %s beenden? Eingabe y[es]/n[o]:Enter string value for "%s" [%s]:Enter string value for "%s" (%s) [%s]:Werteingabe als Zeichenkette fuer "%s" [%s]:Werteingabe als Zeichenkette fuer "%s" (%s) [%s]:Enter integer value for "%s" [%s]:Enter integer value for "%s" (%s-%s) [%s]:Werteingabe als ganze Zahl fuer "%s" [%s]:Werteingabe als ganze Zahl fuer "%s" (%s-%s) [%s]:New value for "%s": '%s'New value for "%s": '%d'Neuer Wert fuer "%s": '%s'Neuer Wert fuer "%s": '%d'Invalid value for "%s": '%s'Ungueltiger Wert fuer "%s": '%s'Value for "%s" longer than %d characters: '%s'Wert fuer "%s" laenger als %d Zeichen: '%s'The value of "%s" has not been changedDen Wert von "%s" ist nicht geaendert wordenThe value of "%s" has been resetDer Wert von "%s" wurde zurueckgesetztMandatory input value at position %d not enteredMuss-Eingabewert auf Position %d nicht eingegebenOne input value should be specified for '%s'At least one input value should be specified for '%s'Ein Eingabewert sollte fuer '%s' spezifiziert werdenMindestens ein Eingabewert sollte fuer '%s' spezifiziert werdenProgram status has been resetProgrammstatus wurde zurueckgesetztChecking input value for '%s' failedWarning by checking input value for '%s'Ueberpruefung von Eingabewert fuer '%s' gescheitertWarnungen bei der Ueberpruefung von Eingabewert fuer '%s'Display menu %d - no input possibleAnzeigemenue %d - keine Eingabe moeglichPassword missing in value for "%s": '%s'Kennwort fehlt in Wert fuer "%s": '%s'No disk backups found for backupNo disk backups found for deletionKeine Plattensicherungen zum Sichern gefundenKeine Plattensicherungen zum Loeschen gefundenFollowing file will be displayed: %sFolgende Datei wird angezeigt: %sAnother log file can be displayed nowEine andere Protokolldatei kann jetzt anzeigt werdenNo %s logs created since %s found in %sKeine %s-Protokolle erstellt ab %s in %s gefundenNo log files found for displayKeine Protokolldateien zu Anzeige gefundenReading log file %s ...Reading log file %s for device type '%s'...Lesen der Protokolldatei %s ...Lesen der Protokolldatei %s fuer Geraetetyp '%s'...Fatal errors occurred - terminating processing...Fatale Fehler aufgetreten - Verarbeitung wird beendet...BRRECOVER %sBRRECOVER completed successfullyBRRECOVER erfolgreich beendetBRRECOVER completed successfully with warningsBRRECOVER completed successfully with warnings or non-fatal errorsBRRECOVER erfolgreich mit Warnungen beendetBRRECOVER erfolgreich mit Warnungen oder nicht-fatalen Fehlern beendetBRRECOVER terminated with errorsBRRECOVER mit Fehlern beendetStart of database recovery: %s.%s %sStart der Datenbank-Wiederherstellung: %s.%s %sEnd of database recovery: %s.%s %sEnde der Datenbank-Wiederherstellung: %s.%s %sRecovery of database: %sWiederherstellung der Datenbank: %sBRRECOVER action ID: %sBRRECOVER Aktions-ID: %sBRRECOVER function ID: %sBRRECOVER Funktions-ID: %sRecovery type: %sWiederherstellungstyp: %sBRRECOVER currently running or was killedBRRECOVER laeuft gerade oder wurde abgebrochenPlease delete file %s if BRRECOVER was killedBitte Datei %s loeschen, wenn BRRECOVER abgebrochen wurdeSetting of BRRECOVER lock failedSetzen von BRRECOVER-Sperre gescheitertComplete database recovery completedVollstaendige Wiederherstellung der Datenbank beendetComplete database recovery recovery failedVollstaendige Wiederherstellung der Datenbank gescheitertDatabase point-in-time recovery completedPoint-in-Time-Wiederherstellung der Datenbank beendetDatabase point-in-time recovery failedPoint-in-Time-Wiederherstellung der Datenbank gescheitertTablespace point-in-time recovery completedPoint-in-Time-Wiederherstellung der Tablespaces beendetTablespace point-in-time recovery failedPoint-in-Time-Wiederherstellung der Tablespaces gescheitertWhole database reset completedZuruecksetzen der ganzen Datenbank beendetWhole database reset failedZuruecksetzen der ganzen Datenbank gescheitertRestore individual files completedZurueckladen einzelner Dateien beendetRestore individual files failedZurueckladen einzelner Dateien gescheitertApplying archivelog files completedEinspielen der Archivelog-Dateien beendetApplying archivelog files failedEinspielen der Archivelog-Dateien gescheitertDisaster recovery completedKatastrophen-Wiederherstellung beendetDisaster recovery failedKatastrophen-Wiederherstellung gescheitertFULL/INCR backup %s.%s cannot be specified for multiple selectionsFULL/INCR-Sicherung %s.%s kann bei mehrfacher Auswahl nicht spezifiziert werdenSelected backup %s.%s was finished after the specified point-in-timeAusgewaehlte Sicherung %s.%s war nach dem spezifizierten Zeitpunkt beendetNo appropriate backup created since %s found in %sNo appropriate backup found in %sKeine passende Sicherung erstellt ab %s in %s gefundenKeine passende Sicherung in %s gefundenNot all needed database files were saved in backup %sNot all needed database files were saved in backups %sNicht alle benoetigten Datenbankdateien wurden gesichert in Sicherung %sNicht alle benoetigten Datenbankdateien wurden gesichert in Sicherungen %sBackup '%s' not found in the list of backups or not suitable for this recoverySicherungs '%s' nicht gefunden in der Liste der Sicherungen oder nicht geeignet fuer diese WiederherstellungPlease go back and select other/additional backup for this recoveryYou can go back and select other/additional backup for this recoveryBitte zurueckgehen und andere/zusaetzliche Sicherung fuer diese Wiederherstellung auswaehlenSie koennen zurueckgehen und andere/zusaetzliche Sicherung fuer diese Wiederherstellung auswaehlenSelecting database tablespaces and segments...Selektion der Datenbank-Tablespaces und Segmente...No tablespaces found for database owner %s or owner does not existKeine Tablespaces fuer Datenbankbesitzer %s gefunden oder Besitzer existiert nichtTablespace %s does not exist or does not contain database segmentsTablespace %s existiert nicht oder beinhaltet keine DatenbanksegmenteSystem tablespace %s to be recovered contains %s segment of database owner %s - this segment will be also incompletely recoveredSystem tablespace %s to be recovered contains %s segments of database owner %s - these segments will be also incompletely recoveredDer wiederherzustellende System-Tablespace %s beinhaltet %s Segment von Datenbankbesitzer %s - dieses Segment wird auch unvollstaendig wiederhergestelltDer wiederherzustellende System-Tablespace %s beinhaltet %s Segmente von Datenbankbesitzer %s - diese Segmente werden auch unvollstaendig wiederhergestelltThe following tablespace was selected for point-in-time recovery: %sThe following tablespaces were selected for point-in-time recovery: %sFolgender Tablespace wurde fuer Point-in-Time-Wiederherstellung ausgewaehlt: %sFolgende Tablespaces wurden fuer Point-in-Time-Wiederherstellung ausgewaehlt: %sChecking if following tablespace is self-contained: %sChecking if following tablespaces are self-contained: %sUeberpruefung, ob folgender Tablespace in sich geschlossen ist: %sUeberpruefung, ob folgende Tablespaces in sich geschlossen sind: %sTablespace is not self-contained due to the following violations:Tablespaces are not self-contained due to the following violations:Tablespace ist nicht in sich geschlossen wegen der folgenden Verstoesse:Tablespaces sind nicht in sich geschlossen wegen der folgenden Verstoesse:Selected tablespaces comprise all user tablespaces - please use database point-in-time recoveryAusgewaehlte Tablespaces umfassen alle Benutzer-Tablespaces - bitte Point-in-Time-Wiederherstellung der Datenbank benutzenMetadata of the following tablespace will be exported: %sMetadata of the following tablespaces will be exported: %sMetadaten von folgendem Tablespace werden exportiert: %sMetadaten von folgenden Tablespaces werden exportiert: %sMetadata of the following tablespace will be imported: %sMetadata of the following tablespaces will be imported: %sMetadaten von folgendem Tablespace werden importiert: %sMetadaten von folgenden Tablespaces werden importiert: %sTablespace export completedTablespace import completedTablespace-Export beendetTablespace-Import beendetTablespace export failedTablespace import failedTablespace-Export gescheitertTablespace-Import gescheitertFile %s will be restored from %sDatei %s wird zurueckgeladen von %sOther profile %s found on %s tape - it can be restored in this stepAnderes Profil %s auf %s-Band gefunden - es kann in diesem Schritt zurueckgeladen werden%s log file %s found on %s tape - it can be restored in this step%s-Protokolldatei %s auf %s-Band gefunden - sie kann in diesem Schritt zurueckgeladen werden%d file has been successfully restored%d files have been successfully restored%d Datei wurde erfolgreich zurueckgeladen%d Dateien wurden erfolgreich zurueckgeladenDatabase instance %s will be mounted%s nowDatabase instance %s will be remounted now in mode '%s'Datenbankinstanz %s wird jetzt montiert%sDatenbankinstanz %s wird jetzt erneut in Modus '%s' montiertDatabase instance %s cannot be mounted due to missing control filesDatenbankinstanz %s kann wegen fehlender Steuerdateien nicht montiert werdenControl files are not '%s' - complete recovery not possibleControl files are not '%s' - database flashback not possibleSteuerdateien sind nicht '%s' - vollstaendige Wiederherstellung nicht moeglichSteuerdateien sind nicht '%s' - Datenbank-Flashback nicht moeglichControl file '%s' not foundSteuerdatei '%s' nicht gefundenOnline redolog file '%s' not foundOnline redolog file for %s not foundOnline-Redolog-Datei '%s' nicht gefundenOnline-Redolog-Datei fuer %s nicht gefundenChecking the status of database files for instance %s ...Ueberpruefung des Status von Datenbankdateien fuer Instanz %s ...Status of database files/tablespaces could not be completely checkedStatus der Datenbankdateien/Tablespaces konnte nicht vollstaendig ueberprueft werdenFile %s needs to be restored/recreated, reason: %sFile %s needs to be recovered, reason: %sFile %s muesste zurueckgeladen / neu angelegt werden, Ursache: %sFile %s muesste wiederhergestellt werden, Ursache: %sData file '%s' not found - it will be restored/recreated and recoveredTemporary file '%s' not found - it will be recreated after recoveryDatendatei '%s' nicht gefunden - sie wird zurueckgeladen / neu angelegt und wiederhergestelltTemporaere Datei '%s' nicht gefunden - sie wird nach der Wiederherstellung neu angelegtInvalid type of data file %s - it will be restored/recreated and recoveredUngueltiger Typ von Datendatei %s - sie wird zurueckgeladen / neu angelegt und wiederhergestelltData file %s not current - it will be recoveredDatendatei %s nicht aktuell - sie wird wiederhergestelltNo restore required - database will be only recoveredKein Zurueckladen notwendig - Datenbank wird nur wiederhergestelltNo restore and recovery required - database can be (re)openedKein Zurueckladen und keine Wiederherstellung notwendig - Datenbank kann (wieder) eroeffnet werdenFile %s was added to database after selected backups were started - it will be recreated during recoveryFile %s was added to database after selected backups were started - it can be recreated during recoveryDatei %s wurde zur Datenbank hinzugefuegt, nachdem die ausgewaehlten Sicherungen gestartet waren - sie wird waehrend der Wiederherstellung neu angelegt werdenDatei %s wurde zur Datenbank hinzugefuegt, nachdem die ausgewaehlten Sicherungen gestartet waren - sie kann waehrend der Wiederherstellung neu angelegt werdenFile %s will not be used after recovery - it will be deleted after recoveryDatei %s wird nach Wiederherstellung nicht benutzt - sie wird nach der Wiederherstellung geloeschtFollowing database file will be set %s for recovery: %sFollowing database files will be set %s for recovery: %sFolgende Datenbankdatei wird fuer Wiederherstellung auf %s gesetzt: %sFolgende Datenbankdateien werden fuer Wiederherstellung auf %s gesetzt: %sDatabase file %s set %sDatenbankdatei %s auf %s gesetztFollowing tablespace will be set %s: %sFollowing tablespaces will be set %s: %sFolgender Tablespace wird auf %s gesetzt: %sFolgende Tablespaces werden auf %s gesetzt: %sTablespace %s set %sTablespace %s auf %s gesetztFollowing tablespace will be (temporarily) dropped: %sFollowing tablespaces will be (temporarily) dropped: %sFolgender Tablespace wird (voruebergehend) geloescht: %sFolgende Tablespaces werden (voruebergehend) geloescht: %sTablespace %s droppedTablespace %s geloeschtCannot determine begin point-in-time for recoveryBeginn-Zeitpunkt fuer Wiederherstellung kann nicht bestimmt werdenChecking the availability of archivelog files for database instance %s ...Ueberpruefung der Verfuegbarkeit der Archivelog-Dateien fuer Datenbankinstanz %s ...Archivelog entry for '%s' not found in %s - BRRECOVER will try to use all available offline/online redolog filesArchivelog entry for '%s' not found in %s for THREAD# %d - BRRECOVER will try to use all available offline/online redolog filesArchivelog-Eintrag fuer '%s' nicht gefunden in %s - BRRECOVER wird versuchen, alle verfuegbare Offline/Online-Redolog-Dateien zu benutzenArchivelog-Eintrag fuer '%s' nicht gefunden in %s fuer THREAD# %d - BRRECOVER wird versuchen, alle verfuegbare Offline/Online-Redolog-Dateien zu benutzen%d archivelog file of database instance %s missing%d archivelog files of database instance %s missing%d Archivelog-Datei von Datenbankinstanz %s fehlt%d Archivelog-Dateien von Datenbankinstanz %s fehlenMore than %d archivelog files of database instance %s missing - terminating searching...Mehr als %d Archivelog-Dateien von Datenbankinstanz %s fehlen - Suche wird beendet...First redolog file sequence to apply for database instance %s: %dErste Redolog-Datei-Sequenz zum Einspielen fuer Datenbankinstanz %s: %dLast redolog file sequence to apply for database instance %s: %dLetzte Redolog-Datei-Sequenz zum Einspielen fuer Datenbankinstanz %s: %dYou can change the source the archivelog files will be restored/applied fromYou can do next change to the source the archivelog files will be restored/applied fromSie koennen die Quelle aendern, von der die Archivelog-Dateien zurueckgeladen/eingespielt werdenSie koennen naechste Aenderung der Quelle machen, von der die Archivelog-Dateien zurueckgeladen/eingespielt werdenThe source for applying archivelog sequence %d of instance %s has been changed from '%s' to '%s'Die Quelle fuer Einspielen der Archivelog-Sequenz %d von Instanz %s ist geaendert worden von '%s' auf '%s'The source '%s' for applying archivelog sequence %d of instance %s could not be changedDie Quelle '%s' fuer Einspielen der Archivelog-Sequenz %d von Instanz %s konnte nicht geaendert werdenAll archivelog files to be applied are on disk - no restore requiredAlle einzuspielenden Archivelog-Dateien sind auf Platte - kein Zurueckladen notwendigArchivelog file will be restored in groups of maximum %d fileArchivelog file will be restored in groups of maximum %d filesArchivelog-Dateien werden zurueckgeladen in Gruppen von maximal %d DateiArchivelog-Dateien werden zurueckgeladen in Gruppen von maximal %d DateienArchivelog file with sequence number %d of database instance %s will be applied nowArchivelog files with sequence number %d-%d of database instance %s will be applied nowArchivelog-Datei mit Sequenznummer %d von Datenbankinstanz %s wird jetzt eingespieltArchivelog-Dateien mit Sequenznummer %d-%d von Datenbankinstanz %s werden jetzt eingespieltMedia recovery completedMedien-Wiederherstellung beendetSpecified SCN/PIT was not reached - recovery not complete - but you can go back and repreat the restore/apply of archivelog filesSpezifizierte SCN/PIT wurde nicht erreicht - Wiederherstellung nicht vollstaendig - Sie koennen aber zurueckgehen und das Zurueckladen/Einspielen von Archivelog-Dateien wiederholenDatabase instance %s will be opened now in mode '%s'Database instance %s will be reopened now in mode '%s'Datenbankinstanz %s wird jetzt in Modus '%s' geoeffnetDatenbankinstanz %s wird jetzt in Modus '%s' wiedereroeffnetNo more archivelog files can be applied after the database has been openedKeine weiteren Archivelog-Dateien koennen eingespielt werden, nachdem die Datenbank geoeffnet wurdeDatabase file %s will be deleted and recreatedDatabase file %s will be recreatedDatenbankdatei %s wird geloescht und neu angelegtDatenbankdatei %s wird neu angelegtDatabase file %s recreatedTemporary database file %s recreatedDatenbankdatei %s wurde neu angelegtTemporaere Datenbankdatei %s wurde neu angelegtUnneeded database file %s will be dropped and deletedUnneeded database file %s will be droppedUnbenutzte Datenbankdatei %s wird verworfen und geloeschtUnbenutzte Datenbankdatei %s wird verworfenDatabase file %s not used anymoreDatabase file %s not used anymore - it can be deleted nowDatenbankdatei %s wird nicht mehr benutztDatenbankdatei %s wird nicht mehr benutzt - sie kann jetzt geloescht werdenDatabase file %s can be saved before deletionDatabase files can be saved before deletionDatenbankdatei %s kann vor Loeschen gesichert werdenDatenbankdateien koennen vor Loeschen gesichert werdenDatabase file %s dropped successfullyTemporary database file %s dropped successfullyDatenbankdatei %s erfolgreich verworfenTemporaere Datenbankdatei %s erfolgreich verworfenDatabase file %s deletedRedolog file %s deletedDatenbankdatei %s geloeschtRedolog-Datei %s geloeschtTablespace %s has no files defined in databaseTablespace %s hat keine in der Datenbank definierten DateienRestored control file %s can be copied to its original location: %sRestored control file %s can be copied to its original locations: %sZurueckgeladene Steuerdatei %s kann zu ihrer Ursprungslokation kopiert werden: %sZurueckgeladene Steuerdatei %s kann zu ihrer Ursprungslokationen kopiert werden: %sNumber of restored/recovered database files: %d/%dNumber of restored/recovered files: %d/%dAnzahl der zurueckgeladenen/wiederhergestellten Datenbankdateien: %d/%dAnzahl der zurueckgeladenen/wiederhergestellten Dateien: %d/%dNumber of restored/applied incremental files: %d/%dAnzahl der zurueckgeladenen/eingespielten inkrementellen Dateien: %d/%dNumber of restored/applied archivelog files: %d/%dAnzahl der zurueckgeladenen/eingespielten Archivelog-Dateien: %d/%dRestored archivelog file can be deleted now - not deleting them can lead to space shortage in archive directoryDie zurueckgeladenen Archivelog-Dateien koennen jetzt geloescht werden - Nichtloeschen kann zum Platzmangel in Archivierungsverzeichnis fuehrenBRCONNECT %sBRCONNECT completed successfullyBRCONNECT erfolgreich beendetBRCONNECT completed successfully with warningsBRCONNECT completed successfully with warnings or non-fatal errorsBRCONNECT erfolgreich mit Warnungen beendetBRCONNECT erfolgreich mit Warnungen oder nicht-fatalen Fehlern beendetBRCONNECT terminated with errorsBRCONNECT mit Fehlern beendetStart of BRCONNECT processing: %s.%s %sStart der BRCONNECT-Verarbeitung: %s.%s %sEnd of BRCONNECT processing: %s.%s %sEnde der BRCONNECT-Verarbeitung: %s.%s %sName of database instance: %sName der Datenbankinstanz: %sBRCONNECT action ID: %sBRCONNECT Aktions-ID: %sBRCONNECT function ID: %sBRCONNECT Funktions-ID: %sBRCONNECT function: %sBRCONNECT Funktion: %sOwner of database schema for processing: %sOwners of database schemas for processing: %sBesitzer der Datenbankschema zur Verarbeitung: %sBesitzer der Datenbankschemata zur Verarbeitung: %sDatabase objects for processing: %sDatenbankobjekte zur Verarbeitung: %sSchema owner found in database %s: %sSchema owners found in database %s: %sSchemabesitzer gefunden in Datenbank %s: %sNumber of tables in schema of owner %s: %dNumber of tables/partitions in schema of owner %s: %d/%dAnzahl der Tabellen im Schema des Besitzers %s: %dAnzahl der Tabellen/Partitionen im Schema des Besitzers %s: %d/%dNumber of indexes in schema of owner %s: %dNumber of indexes/partitions in schema of owner %s: %d/%dAnzahl der Indizes im Schema des Besitzers %s: %dAnzahl der Indizes/Partitionen im Schema des Besitzers %s: %d/%dNumber of segments in schema of owner %s: %dNumber of segments/LOBs in schema of owner %s: %d/%dAnzahl der Segmente im Schema des Besitzers %s: %dAnzahl der Segmente/LOBs im Schema des Besitzers %s: %d/%dNumber of monitored/modified tables in schema of owner %s: %d/%dAnzahl der ueberwachten/modifizierten Tabellen im Schema des Besitzers %s: %d/%dNumber of tables found in %s for owner %s: %dAnzahl der in %s gefundenen Tabellen fuer Besitzer %s: %dNumber of pool and cluster tables found in DDNTT for owner %s: %dAnzahl der in DDNTT gefundenen Poll- und Cluster-Tabellen fuer Besitzer %s: %dBRCONNECT currently running with function '%s' or was killedBRCONNECT laeuft gerade mit Funktion '%s' oder wurde abgebrochenPlease delete file %s if BRCONNECT was killedBitte Datei %s loeschen, wenn BRCONNECT abgebrochen wurdeSetting of BRCONNECT lock failedSetzen von BRCONNECT-Sperre gescheitertNo SAP owners found in databaseNo owners found in databaseKeine SAP-Besitzer in Datenbank gefundenKeine Besitzer in Datenbank gefundenOwner '%s' not found in database or not SAP ownerOwner '%s' not found in databaseBesitzer '%s' in Datenbank nicht gefunden oder kein SAP-BesitzerBesitzer '%s' in Datenbank nicht gefundenTable/index '%s' not found in databaseTabelle/Index '%s' in Datenbank nicht gefundenTable %s does not exist in schema of owner %sTabelle %s existiert nicht im Schema des Besitzers %sTime limit exceeded - no more objects will be processedZeitlimit ueberschritten - es werden keine weiteren Objekte verarbeitetChanging password for database user %s ...Aenderung von Kennwort fuer Datenbankbenutzer %s ...Password changed successfully in database for user %sKennwort erfolgreich geaendert in Datenbank fuer Benutzer %sPassword changed successfully in table %s.SAPUSER for user %sPassword inserted successfully into table %s.SAPUSER for user %sKennwort erfolgreich geaendert in Tabelle %s.SAPUSER fuer Benutzer %sKennwort erfolgreich eingefuegt in Tabelle %s.SAPUSER fuer Benutzer %sTable SAPUSER not found for user %sTabelle SAPUSER fuer Benutzer %s nicht gefundenChanging password for user %s failedSetting password for user %s failedAenderung von Kennwort fuer Benutzer %s gescheitertSetzen von Kennwort fuer Benutzer %s gescheitertCreating public synonyms for database log owner %s ...Anlegen der Public-Synonyme fuer Datenbankprotokoll-Besitzer %s ...Public synonyms for database log owner %s created successfullyPublic-Synonyme erfolgreich angelegt fuer Datenbankprotokoll-Besitzer %sCreating public synonyms for database log owner %s failedAnlegen der Public-Synonyme fuer Datenbankprotokoll-Besitzer %s gescheitertNumber of tables treated as info cubes for owner %s: %dAnzahl der als Info-Cubes behandelten Tabellen fuer Besitzer %s: %dTable %s not found for index %s.%s - ignoring indexTable %s not found for LOB index %s.%s - ignoring indexTabelle %s fuer Index %s.%s nicht gefunden - Index wird ignoriertTabelle %s fuer LOB-Index %s.%s nicht gefunden - Index wird ignoriertTable %s not found for segment %s.%s - ignoring segmentIndex %s not found for segment %s.%s - ignoring segmentTabelle %s fuer Segment %s.%s nicht gefunden - Segment wird ignoriertIndex %s fuer Segment %s.%s nicht gefunden - Segment wird ignoriertTable %s not found for partition %s.%s.%s - ignoring partitionTabelle %s fuer Partition %s.%s.%s nicht gefunden - Partition wird ignoriertIndex %s not found for partition %s.%s.%s - ignoring partitionIndex %s fuer Partition %s.%s.%s nicht gefunden - Partition wird ignoriertTable partition %s not found for segment %s.%s.%s - ignoring segmentIndex partition %s not found for segment %s.%s.%s - ignoring segmentTabellen-Partition %s fuer Segment %s.%s.%s nicht gefunden - Segment wird ignoriertIndex-Partition %s fuer Segment %s.%s.%s nicht gefunden - Segment wird ignoriertPartition %s.%s.%s not found for monitored table %sPartition %s.%s.%s fuer ueberwachte Tabelle %s nicht gefundenOnly printable ASCII characters are allowed in passwordNur druckbare ASCII-Zeichen sind in Kennwort erlaubt%d errors occurred - terminating processing...%d errors occurred in thread %d - terminating processing in the thread...%d Fehler aufgetreten - Verarbeitung wird beendet...%d Fehler in Thread %d aufgetreten - Verarbeitung in dem Thread wird beendet...Time limit exceeded - threads will be cancelled after grace time of %d secondsZeitlimit ueberschritten - Threads werden nach einer Aufschubzeit von %d Sekunden abgebrochenNumber of threads that will be started in parallel to the main thread: %dAnzahl der Threads, die parallel zum Haupt-Thread gestartet werden: %dThread %d started successfullyThread %d erfolgreich gestartetThread %d finished with return code %dThread %d endete mit Return-Code %dThread %d has been cancelled due to timeoutThread %d ist wegen Zeitueberschreitung abgebrochen worden%d of %d object processed - %4.3f of %4.3f units done%d of %d objects processed - %4.3f of %4.3f units done%d von %d Objekt verarbeitet - %4.3f von %4.3f Einheiten fertig%d von %d Objekte verarbeitet - %4.3f von %4.3f Einheiten fertigNumber of tables with missing statistics: %dNumber of tables/partitions with missing statistics: %d/%dAnzahl der Tabellen mit fehlenden Statistiken: %dAnzahl der Tabellen/Partitionen mit fehlenden Statistiken: %d/%dNumber of tables to delete statistics: %dAnzahl der Tabellen zum Loeschen der Statistiken: %dNumber of tables to check statistics: %dNumber of tables to check (and collect if needed) statistics: %dAnzahl der Tabellen zur Ueberpruefung der Statistiken: %dAnzahl der Tabellen zur Ueberpruefung (und Sammlung wenn erforderlich) der Statistiken: %dNumber of tables to collect statistics without checking: %dAnzahl der Tabellen zum Sammeln der Statistiken ohne Ueberpruefung: %dNumber of indexes with missing statistics: %dNumber of indexes/partitions with missing statistics: %d/%dAnzahl der Indizes mit fehlenden Statistiken: %dAnzahl der Indizes/Partitionen mit fehlenden Statistiken: %d/%dNumber of indexes to delete statistics: %dAnzahl der Indizes zum Loeschen der Statistiken: %dNumber of indexes to collect statistics: %dAnzahl der Indizes zum Sammeln der Statistiken: %dCheck (nocoll) option set - statistics will not be collectedPruef-(nocoll)-Option gesetzt - Statistiken werden nicht gesammeltHistory option set - statistics will be stored in tables DBSTATHORA and DBSTAIHORAHistorieoption gesetzt - Statistiken werden in Tabellen DBSTATHORA und DBSTAIHORA fortgeschriebenDelete option set - statistics will be deletedDelete option set - %s statistics will be deletedLoeschoption gesetzt - Statistiken werden geloeschtLoeschoption gesetzt - %s-Statistiken werden geloeschtValidate option set - structure of tables/indexes/clusters will be validatedValidate option set - structure of tables/indexes/clusters will be validated with 'cascade' optionValidierungsoption gesetzt - Struktur der Tabellen/Indizes/Clusters wird validiertValidierungsoption gesetzt - Struktur der Tabellen/Indizes/Clusters wird mit 'cascade'-Option validiertForce option with value '%s' setForce-Option mit Wert '%s' gesetztNo tables/indexes found to update/delete statisticsNo tables/indexes found to validate structureKeine Tabellen/Indizes zur Aktualisierung/Loeschung der Statistiken gefundenKeine Tabellen/Indizes zur Validierung der Struktur gefundenPerhaps option '%s' should be used to force this actionVielleicht sollte Option '%s' benutzt werden, um die Aktion zu erzwingenOwner of index %s.%s different from the owner of table %s.%s - ignoring indexBesitzer des Index %s.%s verschieden von dem Besitzer der Tabelle %s.%s - Index wird ignoriertTable found in %s does not exist in schema of owner %s: %sIn %s gefundene Tabelle existiert nicht im Schema des Besitzers %s: %sMethod '%s' cannot be used without option '%s'Methode 's' kann nicht ohne Option '%s' benutzt werdeIndex found in %s does not exist in schema of owner %s: %sIn %s gefundener Index existiert nicht im Schema des Besitzers %s: %sIllegal value '%s' found in %s.DBSTATC field '%s' for table '%s.%s' - ignoring the recordIllegal value '%s' found in %s.DBSTATC field '%s' for table '%s' with object type '%s' - ignoring the recordUnerlaubter Wert '%s' in %s.DBSTATC-Feld '%s' fuer Tabelle '%s.%s' gefunden - der Satz wird ignoriertUnerlaubter Wert '%s' in %s.DBSTATC-Feld '%s' fuer Tabelle '%s' mit Objekttyp '%s' gefunden - der Satz wird ignoriertPool or cluster table found in DDNTT does not exist in schema of owner %s: %sIn DDNTT gefundene Poll- oder Cluster-Tabelle existiert nicht im Schema des Besitzers %s: %sPool or cluster table selected to check/collect statistics: %s.%sPool or cluster index selected to check/collect statistics: %s.%sPoll- oder Cluster-Tabelle bestimmt zur Ueberpruefung/Sammlung der Statistiken: %s.%sPoll- oder Cluster-Index bestimmt zur Ueberpruefung/Sammlung der Statistiken: %s.%sDeleting table and index statistics...Loeschung der Tabellen- und Index-Statistiken...Statistics deleted for %d/%d tables/indexesStatistiken geloescht fuer %d/%d Tabellen/IndizesStatistics deleted for table %s.%sStatistics deleted for table partition %s.%s.%sStatistiken geloescht fuer Tabelle %s.%sStatistiken geloescht fuer Tabellen-Partition %s.%s.%sStatistics deleted for index %s.%sStatistiken geloescht fuer Index %s.%sDeleting statistics failed for table %s.%sLoeschung der Statistiken gescheitert fuer Tabelle %s.%sChecking and collecting table and index statistics...Ueberpruefung und Sammlung der Tabellen- und Index-Statistiken...Number of tables selected to collect statistics after check: %dAnzahl der Tabellen bestimmt zum Sammeln der Statistiken nach Ueberpruefung: %dStatistics checked for %d tableStatistics checked for %d tablesStatistiken ueberprueft fuer %d TabelleStatistiken ueberprueft fuer %d TabellenStatistics collected for %d/%d tables/indexesStatistiken gesammelt fuer %d/%d Tabellen/IndizesCollecting statistics for table %s.%s with method/sample %s ...Collecting statistics for table partition %s.%s.%s with method/sample %s ...Sammlung der Statistiken fuer Tabelle %s.%s mit Methode/Probe %s ...Sammlung der Statistiken fuer Tabellen-Partition %s.%s.%s mit Methode/Probe %s ...Collecting statistics for index %s.%s with method/sample %s ...Sammlung der Statistiken fuer Index %s.%s mit Methode/Probe %s ...Table selected to collect statistics after check: %s.%s %sTable partition selected to collect statistics after check: %s.%s.%s %sTabelle bestimmt zur Sammlung der Statistiken nach Ueberpruefung: %s.%s %sTabellen-Partition bestimmt zur Sammlung der Statistiken nach Ueberpruefung: %s.%s.%s %sStatistics collected for table: %s.%s, rows old/new: %1.0f/%1.0fStatistics collected for table: %s.%s, rows old/new: (%1.0f)/%1.0fStatistiken gesammelt fuer Tabelle: %s.%s, Saetze alt/neu: %1.0f/%1.0fStatistiken gesammelt fuer Tabelle: %s.%s, Saetze alt/neu: (%1.0f)/%1.0fStatistics collected for index: %s.%s, rows old/new: %1.0f/%1.0fStatistiken gesammelt fuer Index: %s.%s, Saetze alt/neu: %1.0f/%1.0fCollecting statistics failed for table %s.%sCollecting statistics failed for index %s.%sSammlung der Statistiken gescheitert fuer Tabelle %s.%sSammlung der Statistiken gescheitert fuer Index %s.%sNumber of tables/clusters to validate structure: %d/%dAnzahl der Tabellen/Clusters zur Validierung der Strukturen: %d/%dNumber of indexes to validate structure: %dAnzahl der Indizes zur Validierung der Struktur: %dStructure validated for %d/%d/%d tables/indexes/clustersStructure validated with 'cascade' option for %d/%d/%d tables/indexes/clustersStruktur validiert fuer %d/%d/%d Tabellen/Indizes/ClustersStruktur validiert mit 'cascade'-Option fuer %d/%d/%d Tabellen/Indizes/ClustersValidating structure of tables and indexes...Validating structure of tables and indexes with 'cascade' option...Validierung der Struktur von Tabellen und Indizes...Validierung der Struktur von Tabellen und Indizes mit 'cascade'-Option...Structure validated successfully for table %s.%s%sStructure validated successfully for cluster %s.%s%sStruktur erfolgreich validiert fuer Tabelle %s.%s%sStruktur erfolgreich validiert fuer Cluster %s.%s%sStructure validated successfully for index %s.%sStruktur erfolgreich validiert fuer Index %s.%sValidating structure failed for table/cluster %s.%sValidating structure failed for index %s.%sValidierung der Struktur gescheitert fuer Tabelle/Cluster %s.%sValidierung der Struktur gescheitert fuer Index %s.%sTables with the longest duration of collecting statistics for owner %sTables with the longest duration of validating structure for owner %sTabellen mit laengster Dauer der Sammlung von Statistiken fuer Besitzer %sTabellen mit laengster Dauer der Validierung von Strukturen fuer Besitzer %sIndexes with the longest duration of collecting statistics for owner %sIndexes with the longest duration of validating structure for owner %sIndizes mit laengster Dauer der Sammlung von Statistiken fuer Besitzer %sIndizes mit laengster Dauer der Validierung von Strukturen fuer Besitzer %s'retain' option with value '%d' set - checking/collecting statistics can be skipped'retain' option with value '%s' set - checking/collecting statistics can be skipped'retain'-Option mit Wert '%d' gesetzt - Ueberpruefung/Sammlung der Statistiken kann uebersprungen werden'retain'-Option mit Wert '%s' gesetzt - Ueberpruefung/Sammlung der Statistiken kann uebersprungen werdenNumber of tables that will be skipped due to the 'retain' option: %dNumber of tables that will be skipped due to locked statistics: %dAnzahl der Tabellen, die aufgrund der 'retain'-Option uebersprungen werden: %dAnzahl der Tabellen, die aufgrund gesperrter Statistiken uebersprungen werden: %dNumber of indexes that will be skipped due to the 'retain' option: %dNumber of indexes that will be skipped due to locked statistics: %dAnzahl der Indizes, die aufgrund der 'retain'-Option uebersprungen werden: %dAnzahl der Indizes, die aufgrund gesperrter Statistiken uebersprungen werden: %dOracle resource busy for table/index/cluster %s.%s - structure cannot be validatedOracle-Ressource besetzt fuer Tabelle/Index/Cluster %s.%s - Struktur kann nicht validiert werdenUsage of space allocated in tablespaces for analyzed tables and indexesAusnutzung des allokierten Platzes in Tablespaces fuer analysierte Tabellen und IndizesNumber of tables to check (and adapt if needed) next extent: %dNumber of tables/partitions to check (and adapt if needed) next extent: %d/%dAnzahl der Tabellen zur Ueberpruefung (und Anpassung wenn erforderlich) des 'Next-Extent': %dAnzahl der Tabellen/Partitionen zur Ueberpruefung (und Anpassung wenn erforderlich) des 'Next-Extent': %d/%dNumber of indexes to check (and adapt if needed) next extent: %dNumber of indexes/partitions to check (and adapt if needed) next extent: %d/%dAnzahl der Indizes zur Ueberpruefung (und Anpassung wenn erforderlich) des 'Next-Extent': %dAnzahl der Indizes/Partitionen zur Ueberpruefung (und Anpassung wenn erforderlich) des 'Next-Extent': %d/%dNumber of tables in locally managed tablespaces: %dNumber of tables/partitions in locally managed tablespaces: %d/%dAnzahl der Tabellen in lokal verwaltenen Tablespaces: %dAnzahl der Tabellen/Partitionen in lokal verwaltenen Tablespaces: %d/%dNumber of indexes in locally managed tablespaces: %dNumber of indexes/partitions in locally managed tablespaces: %d/%dAnzahl der Indizes in lokal verwaltenen Tablespaces: %dAnzahl der Indizes/Partitionen in lokal verwaltenen Tablespaces: %d/%dNo tables/indexes found to check and adapt next extentKeine Tabellen/Indizes zur Ueberpruefung und Anpassung des 'Next-Extent' gefundenAll selected tables/indexes are in locally managed tablespacesAlle gewaehlten Tabellen/Indizes sind in lokal verwaltenen TablespacesChecking and adapting next extent of tables and indexes...Ueberpruefung und Anpassung des 'Next-Extent' von Tabellen und Indizes...Next extent checked for %d/%d/%d tables/indexes/LOBsNext extent checked for %d/%d/%d/%d/%d tables/partitions/indexes/partitions/LOBs'Next-Extent' ueberprueft fuer %d/%d/%d Tabellen/Indizes/LOBs'Next-Extent' ueberprueft fuer %d/%d/%d/%d/%d Tabellen/Partitionen/Indizes/Partitionen/LOBsNumber of tables/indexes/LOBs selected to adapt next extent size: %d/%d/%dNumber of tables/partitions/indexes/partitions/LOBs selected to adapt next extent size: %d/%d/%d/%d/%dAnzahl der Tabellen/Indizes/LOBs bestimmt zur Anpassung der 'Next-Extent'-Groesse: %d/%d/%dAnzahl der Tabellen/Partitionen/Indizes/Partitionen/LOBs bestimmt zur Anpassung der 'Next-Extent'-Groesse: %d/%d/%d/%d/%dNumber of tables/indexes/LOBs selected to adapt next extent limit: %d/%d/%dNumber of tables/partitions/indexes/partitions/LOBs selected to adapt next extent limit: %d/%d/%d/%d/%dAnzahl der Tabellen/Indizes/LOBs bestimmt zur Anpassung des 'Next-Extent'-Limits: %d/%d/%dAnzahl der Tabellen/Partitionen/Indizes/Partitionen/LOBs bestimmt zur Anpassung des 'Next-Extent'-Limits: %d/%d/%d/%d/%dNext extent size adapted for %d/%d/%d tables/indexes/LOBsNext extent size adapted for %d/%d/%d/%d/%d tables/partitions/indexes/partitions/LOBs'Next-Extent'-Groesse angepasst fuer %d/%d/%d Tabellen/Indizes/LOBs'Next-Extent'-Groesse angepasst fuer %d/%d/%d/%d/%d Tabellen/Partitionen/Indizes/Partitionen/LOBsNext extent limit adapted for %d/%d/%d tables/indexes/LOBsNext extent limit adapted for %d/%d/%d/%d/%d tables/partitions/indexes/partitions/LOBs'Next-Extent'-Limit angepasst fuer %d/%d/%d Tabellen/Indizes/LOBs'Next-Extent'-Limit angepasst fuer %d/%d/%d/%d/%d Tabellen/Partitionen/Indizes/Partitionen/LOBsTable selected to adapt next extent size: %s.%s, value old/new: %1.0f KB / %1.0f KBTable partition/LOB selected to adapt next extent size: %s.%s.%s, value old/new: %1.0f KB / %1.0f KBTabelle bestimmt zur Anpassung der 'Next-Extent'-Groesse: %s.%s, Wert alt/neu: %1.0f KB / %1.0f KBTabellen-Partition/LOB bestimmt zur Anpassung der 'Next-Extent'-Groesse: %s.%s.%s, Wert alt/neu: %1.0f KB / %1.0f KBIndex selected to adapt next extent size: %s.%s, value old/new: %1.0f KB / %1.0f KBIndex partition selected to adapt next extent size: %s.%s.%s, value old/new: %1.0f KB / %1.0f KBIndex bestimmt zur Anpassung der 'Next-Extent'-Groesse: %s.%s, Wert alt/neu: %1.0f KB / %1.0f KBIndex-Partition bestimmt zur Anpassung der 'Next-Extent'-Groesse: %s.%s.%s, Wert alt/neu: %1.0f KB / %1.0f KBTable selected to adapt next extent limit: %s.%s, value old/new: %s / %sTable partition/LOB selected to adapt next extent limit: %s.%s.%s, value old/new: %s / %sTabelle bestimmt zur Anpassung des 'Next-Extent'-Limits: %s.%s, Wert alt/neu: %s / %sTabellen-Partition/LOB bestimmt zur Anpassung des 'Next-Extent'-Limits: %s.%s.%s, Wert alt/neu: %s / %sIndex selected to adapt next extent limit: %s.%s, value old/new: %s / %sIndex partition selected to adapt next extent limit: %s.%s.%s, value old/new: %s / %sIndex bestimmt zur Anpassung des 'Next-Extent'-Limits: %s.%s, Wert alt/neu: %s / %sIndex-Partition bestimmt zur Anpassung des 'Next-Extent'-Limits: %s.%s.%s, Wert alt/neu: %s / %sNext extent size adapted for table %s.%s, value old/new: %1.0f KB / %1.0f KBNext extent size adapted for table partition/LOB %s.%s.%s, value old/new: %1.0f KB / %1.0f KB'Next-Extent'-Groesse angepasst fuer Tabelle %s.%s, Wert alt/neu: %1.0f KB / %1.0f KB'Next-Extent'-Groesse angepasst fuer Tabellen-Partition/LOB %s.%s.%s, Wert alt/neu: %1.0f KB / %1.0f KBNext extent size adapted for index %s.%s, value old/new: %1.0f KB / %1.0f KBNext extent size adapted for index partition %s.%s.%s, value old/new: %1.0f KB / %1.0f KB'Next-Extent'-Groesse angepasst fuer Index %s.%s, Wert alt/neu: %1.0f KB / %1.0f KB'Next-Extent'-Groesse angepasst fuer Index-Partition %s.%s.%s, Wert alt/neu: %1.0f KB / %1.0f KBNext extent limit adapted for table %s.%s, value old/new: %s / %sNext extent limit adapted for table partition/LOB %s.%s.%s, value old/new: %s / %s'Next-Extent'-Limit angepasst fuer Tabelle %s.%s, Wert alt/neu: %s / %s'Next-Extent'-Limit angepasst fuer Tabellen-Partition/LOB %s.%s.%s, Wert alt/neu: %s / %sNext extent limit adapted for index %s.%s, value old/new: %s / %sNext extent limit adapted for index partition %s.%s.%s, value old/new: %s / %s'Next-Extent'-Limit angepasst fuer Index %s.%s, Wert alt/neu: %s / %s'Next-Extent'-Limit angepasst fuer Index-Partition %s.%s.%s, Wert alt/neu: %s / %sAdapting next extent failed for table/index %s.%sAdapting next extent failed for table/index partition/LOB %s.%s.%sAnpassung des 'Next-Extent' gescheitert fuer Tabelle/Index %s.%sAnpassung des 'Next-Extent' gescheitert fuer Tabelle/Index-Partition/LOB %s.%s.%sTable/index %s.%s locked - next extent cannot be adaptedTable/index partition/LOB %s.%s.%s locked - next extent cannot be adaptedTabelle/Index %s.%s gesperrt - 'Next-Extent' kann nicht angepasst werdenTabelle/Index-Partition/LOB %s.%s.%s gesperrt - 'Next-Extent' kann nicht angepasst werdenCurrent number of allocated extents %d for table/index %s.%s larger than next extent limitCurrent number of allocated extents %d for table/index partition/LOB %s.%s.%s larger than next extent limitAktuelle Anzahl der aktuell allokierten Extents %d fuer Tabelle/Index %s.%s groesser als 'Next-Extent'-LimitAktuelle Anzahl der aktuell allokierten Extents %d fuer Tabelle/Index-Partition/LOB %s.%s.%s groesser als 'Next-Extent'-LimitObsolete parameter %s set in Oracle profileVeralteter Parameter %s gesetzt in Oracle-ProfilPublic synonym %s created successfully for table %s.%sPublic-Synonym %s erfolgreich angelegt fuer Tabelle %s.%s%s log files will be deleted from directory: %s%s log files will be deleted from directories: %s%s-Protokolldateien werden geloescht aus Verzeichnis: %s%s-Protokolldateien werden geloescht aus Verzeichnissen: %sOracle trace files will be deleted from directory: %sOracle trace files will be deleted from directories: %sOracle-Trace-Dateien werden geloescht aus Verzeichnis: %sOracle-Trace-Dateien werden geloescht aus Verzeichnissen: %sDatabase log records will be deleted from table of owner %s: %sDatabase log records will be deleted from tables of owner %s: %sDatenbankprotokoll-Saetze werden geloescht aus Tabelle des Besitzer %s: %sDatenbankprotokoll-Saetze werden geloescht aus Tabellen des Besitzer %s: %sLimit option set - cleanup will be limited to specified optionsLimit-Option gesetzt - Aufraeumen wird auf die spezifizierten Optionen beschraenkt%s log file %s (%s) selected for deletion%s-Protokolldatei %s (%s) zum Loeschen bestimmt%d %s log file selected for deletion from directory %s%d %s log files selected for deletion from directory %s%d %s-Protokolldatei aus Verzeichnis %s zum Loeschen bestimmt%d %s-Protokolldateien aus Verzeichnis %s zum Loeschen bestimmt%d copy of offline redolog file selected for deletion from directory %s%d copies of offline redolog files selected for deletion from directory %s%d Kopie der Offline-Rodo-Log-Datei aus Verzeichnis %s zum Loeschen bestimmt%d Kopien der Offline-Rodo-Log-Dateien aus Verzeichnis %s zum Loeschen bestimmtBackup/copy directory %s (%s) containing %d file selected for deletionBackup/copy directory %s (%s) containing %d files selected for deletionSicherungs-/Kopieverzeichnis %s (%s) mit %d Datei zum Loeschen bestimmtSicherungs-/Kopieverzeichnis %s (%s) mit %d Dateien zum Loeschen bestimmt%d backup/copy directory selected for deletion from %s%d backup/copy directories selected for deletion from %s%d Sicherungs-/Kopieverzeichnis aus %s zum Loeschen bestimmt%d Sicherungs-/Kopieverzeichnisse aus %s zum Loeschen bestimmtExport directory %s (%s) containing %d file selected for deletionExport directory %s (%s) containing %d files selected for deletionExport Verzeichnis %s (%s) mit %d Datei zum Loeschen bestimmtExport Verzeichnis %s (%s) mit %d Dateien zum Loeschen bestimmt%d export directory selected for deletion from %s%d export directories selected for deletion from %s%d Export-Verzeichnis aus %s zum Loeschen bestimmt%d Export-Verzeichnisse aus %s zum Loeschen bestimmt%d Oracle trace file selected for deletion from directory %s%d Oracle trace files selected for deletion from directory %s%d Oracle-Trace-Datei aus Verzeichnis %s zum Loeschen bestimmt%d Oracle-Trace-Dateien aus Verzeichnis %s zum Loeschen bestimmt%d row selected for deletion from table %s.%s%d rows selected for deletion from table %s.%s%d Satz aus Tabelle %s.%s zum Loeschen bestimmt%d Saetze aus Tabelle %s.%s zum Loeschen bestimmtFile/directory %s (%s) selected for deletionDatei/Verzeichnis %s (%s) zum Loeschen bestimmt%s log file %s (%s) deleted%s-Protokolldatei %s (%s) geloescht%d %s log file deleted from directory %s%d %s log files deleted from directory %s%d %s-Protokolldatei aus Verzeichnis %s geloescht%d %s-Protokolldateien aus Verzeichnis %s geloescht%d copy of offline redolog file deleted from directory %s%d copies of offline redolog files deleted from directory %s%d Kopie der Offline-Rodo-Log-Datei aus Verzeichnis %s geloescht%d Kopien der Offline-Rodo-Log-Dateien aus Verzeichnis %s geloeschtBackup/copy directory %s (%s) containing %d file deletedBackup/copy directory %s (%s) containing %d files deletedSicherungs-/Kopieverzeichnis %s (%s) mit %d Datei geloeschtSicherungs-/Kopieverzeichnis %s (%s) mit %d Dateien geloescht%d backup/copy directory deleted from %s%d backup/copy directories deleted from %s%d Sicherungs-/Kopieverzeichnis aus %s geloescht%d Sicherungs-/Kopieverzeichnisse aus %s geloeschtExport directory %s (%s) containing %d file deletedExport directory %s (%s) containing %d files deletedExport Verzeichnis %s (%s) mit %d Datei geloeschtExport Verzeichnis %s (%s) mit %d Dateien geloescht%d export directory deleted from %s%d export directories deleted from %s%d Export-Verzeichnis aus %s geloescht%d Export-Verzeichnisse aus %s geloescht%d Oracle trace file deleted from directory %s%d Oracle trace files deleted from directory %s%d Oracle-Trace-Datei aus Verzeichnis %s geloescht%d Oracle-Trace-Dateien aus Verzeichnis %s geloescht%d row deleted from table %s.%s%d rows deleted from table %s.%s%d Satz aus Tabelle %s.%s geloescht%d Saetze aus Tabelle %s.%s geloeschtFile/directory %s (%s) deletedDatei/Verzeichnis %s (%s) geloeschtNumber of Oracle clusters found for owner %s: %dAnzahl der gefundenen Oracle-Clusters fuer Besitzer %s: %dNumber of active/inactive check conditions for database administration: %d/%dAnzahl der aktiven/inaktiven Pruefbedingungen fuer Datenbankadministration: %d/%dNumber of active/inactive check conditions for database operations: %d/%dAnzahl der aktiven/inaktiven Pruefbedingungen fuer Datenbankoperationen: %d/%dNumber of active/inactive check conditions for database messages: %d/%dAnzahl der aktiven/inaktiven Pruefbedingungen fuer Datenbankmeldungen: %d/%dNumber of active/inactive check conditions for database profile: %d/%dAnzahl der aktiven/inaktiven Pruefbedingungen fuer Datenbankprofil: %d/%dNumber of signaled error/warning/exception alerts for database administration: %d/%d/%dAnzahl der signalisierten Fehler-/Warnungs-/Ausnahme-Alerts fuer Datenbankadministration: %d/%d/%dNumber of signaled error/warning/exception alerts for database operations: %d/%d/%dAnzahl der signalisierten Fehler-/Warnungs-/Ausnahme-Alerts fuer Datenbankoperationen: %d/%d/%dNumber of signaled error/warning/exception alerts for database messages: %d/%d/%dAnzahl der signalisierten Fehler-/Warnungs-/Ausnahme-Alerts fuer Datenbankmeldungen: %d/%d/%dNumber of signaled error/warning/exception alerts for database profile: %d/%d/%dAnzahl der signalisierten Fehler-/Warnungs-/Ausnahme-Alerts fuer Datenbankprofil: %d/%d/%dDefault option set - using default settings for checksDefault-Option gesetzt - Standardeinstellungen werden fuer Pruefungen benutztLast successful BRCONNECT check run: %sLetzter erfolgreicher BRCONNECT-Pruefungslauf: %sNumber of conditions found in DBCHECKORA: %dAnzahl der in DBCHECKORA gefundenen Bedingungen: %dCheck conditions for database administration:Pruefbedingugen fuer Datenbankadministration:Check conditions for database operations:Pruefbedingugen fuer Datenbankoperationen:Check conditions for database messages:Pruefbedingugen fuer Datenbankmeldungen:Check conditions for database profile:Pruefbedingugen fuer Datenbankprofil:Table DBCHECKORA not found or empty - using default settings for checksTable DBCHECKORA not found or empty - using settings from '%s' parameter for checksTabelle DBCHECKORA nicht gefunden oder leer - Standardeinstellungen werden fuer Pruefungen benutztTabelle DBCHECKORA nicht gefunden oder leer - Einstellungen aus '%s'-Parameter werden fuer Pruefungen benutztIllegal value '%s' found in DBCHECKORA field '%s' for key '%s' - ignoring the recordUnerlaubter Wert '%s' in DBCHECKORA-Feld '%s' fuer Schluessel '%s' gefunden - der Satz wird ignoriertTable DBMSGORA not found - alerts will be reported only in log fileTabelle DBMSGORA nicht gefunden - Alerts werden nur in Protokoll-Datei gemeldetChecking database administration...Ueberpruefung der Datenbankadministration...Database administration alert - level: %s, type: %s, object: %sDatabase administration alert - level: %s, type: %s, object: %s, value: %sDatenbankadministrations-Alert - Stufe: %s, Typ: %s, Objekt: %sDatenbankadministrations-Alert - Stufe: %s, Typ: %s, Objekt: %s, Wert: %sThe default temporary tablespace of database %s is set to %sDer default temporaere Tablespace von Datenbank %s ist gesetzt auf %sChecking database operations...Ueberpruefung der Datenbankoperationen...Database operation alert - level: %s, operation: %s, time: %s, condition: %sDatabase operation alert - level: %s, operation: %s, condition: %sDatenbankoperations-Alert - Stufe: %s, Operation: %s, Zeit: %s, Bedingung: %sDatenbankoperations-Alert - Stufe: %s, Operation: %s, Bedingung: %sChecking database messages in %s ...Checking database messages in %s:%s ...Ueberpruefung der Datenbankmeldungen in %s ...Ueberpruefung der Datenbankmeldungen in %s:%s ...Oracle alert log '%s' not found - checking database messages will be skippedOracle alert log '%s' not found - cannot check if database instance %s was cleanly shut downOracle-Alert-Protokoll '%s' nicht gefunden - Ueberpruefung der Datenbankmeldungen wird uebersprungenOracle-Alert-Protokoll '%s' nicht gefunden - es kann nicht ueberprueft werden, ob die Datenbankinstanz %s sauber runtergefahren wurdeDatabase message alert - level: %s, line: %d, time: %s, message: %sDatabase message alert - level: %s, instance: %s, line: %d, time: %s, message: %sDatenbankmeldung-Alert - Stufe: %s, Zeile: %d, Zeit: %s, Meldung: %sDatenbankmeldung-Alert - Stufe: %s, Instanz: %s, Zeile: %d, Zeit: %s, Meldung: %sChecking database profile...Ueberpruefung des Datenbankprofils...Database profile alert - level: %s, parameter: %s, value: %sDatenbankprofil-Alert - Stufe: %s, Parameter: %s, Wert: %sChanges in database profile parameters:Aenderungen der Parameter des Datenbankprofils:Number of changed database profile parameters: %dAnzahl der gaenderten Parameter des Datenbankprofils: %dNot enough disk space for the total maximum size %4.3f MB of %d files of tablespace %s on disk device %d, missing at least %4.3f MBNicht genug Plattenplatz fuer die gesamte maximale Groesse %4.3f MB von %d Dateien des Tablespace %s auf Plattengeraet %d, es fehlen mindestens %4.3f MBDatabase disk volumesDatenbank-PlattendatentraegerTablespace fragmentationFragmentierung der TablespacesUnknown DBA condition '%s' ignoredUnbekannte DBA-Bedingung '%s' wurde ignoriertUnknown Oracle parameter '%s' in PROF condition foundUnbekannter Oracle-Parameter '%s' in PROF-Bedingung gefundenIndex %s.%s is unbalanced - please rebuild the indexPartitioned index %s.%s is unbalanced - please rebuild the index partitionsIndex %s.%s ist unausgeglichen - bitte den Index neu aufbauenPartitionierter Index %s.%s ist unausgeglichen - bitte die Index-Partitionen neu aufbauenGlobal statistics for table %s.%s have not been updated by Oracle - recollecting statistics...Globale Statistiken fuer Tabelle %s.%s wurden von Oracle nicht aktualisiert - Statistiken werden neu gesammelt...Bitmap index %s selected for checking statistics - please activate the monitoring attribute for table %s.%sBitmap index %s selected for checking statistics - please set Oracle parameter statistics_level to 'typical'Bitmap-Index %s ausgewaehlt fuer Ueberpruefung der Statistiken - bitte aktivieren Sie das Minitoring-Attribut fuer Tabelle %s.%sBitmap-Index %s ausgewaehlt fuer Ueberpruefung der Statistiken - bitte Oracle-Parameter statistics_level auf 'typical' setzenUnknown tablespace '%s' defined in table %s.%s for table data class (tabart) '%s'Unknown tablespace '%s' defined in table %s.%sUnbekannter Tablespace '%s' definiert in Tabelle %s.%s fuer Tabellen-Datenart (Tabart) '%s'Unbekannter Tablespace '%s' definiert in Tabelle %s.%sSAP tablespace %s not defined in table(s) %sSAP tablespace %s defined in table %s.%s not found in %s.%sSAP-Tablespace %s nicht definiert in Tabelle(n) %sSAP-Tablespace %s definiert in Tabelle %s.%s nicht gefunden in %s.%sSame tablespace %s defined in tables %s.%s and %s.%sDerselbe Tablespace %s definiert in Tabellen %s.%s und %s.%sStarting collection of system statistics with option/interval %s ...Deleting system statistics...Starten der Sammlung von Systemstatistiken mit Option/Intervall %s ...Loeschen von Systemstatistiken...Collection of system statistics completedDeletion of system statistics completedSammlung von Systemstatistiken beendetLoeschung von Systemstatistiken beendetCollection of system statistics failedDeletion of system statistics failedSammlung von Systemstatistiken gescheitertLoeschung von Systemstatistiken gescheitertMonitoring attribute activated for table %s.%sMinitoring-Attribut aktiviert fuer Tabelle %s.%sTable/index %s.%s does not exist anymoreTable/index partition %s.%s.%s does not exist anymoreTabelle/Index %s.%s existiert nicht mehrTabellen/Index-Partition %s.%s.%s existiert nicht mehrSystem statistics will be collected with '%s' optionInterval for the collection of system statistics: %d minutesSystemstatistiken werden mit '%s'-Option gesammeltZeitdauer der Sammlung von Systemstatistiken: %d MinutenRemaining time for the collection of system statistics: %d minuteRemaining time for the collection of system statistics: %d minutesVerbleibende Zeit fuer die Sammlung von Systemstatistiken: %d MinuteVerbleibende Zeit fuer die Sammlung von Systemstatistiken: %d MinutenLoading of SQL client library %s failed - please check Oracle configurationLaden der SQL-Client-Library %s gescheitert - bitte Oracle-Konfiguration ueberpruefen%s not supported for SAP Basis version lower than %s%s nicht unterstuetzt fuer SAP Basis Version kleiner als %sBRSPACE %sStart of BRSPACE processing: %s.%s %sStart der BRSPACE-Verarbeitung: %s.%s %sBRSPACE function '%s' completedBRSPACE-Funktion '%s' beendetBRSPACE function '%s' failedBRSPACE-Funktion '%s' gescheitertBRSPACE completed successfullyBRSPACE erfolgreich beendetBRSPACE completed successfully with warningsBRSPACE completed successfully with warnings or non-fatal errorsBRSPACE erfolgreich mit Warnungen beendetBRSPACE erfolgreich mit Warnungen oder nicht-fatalen Fehlern beendetBRSPACE terminated with errorsBRSPACE mit Fehlern beendetEnd of BRSPACE processing: %s.%s %sEnde der BRSPACE-Verarbeitung: %s.%s %sBRSPACE action ID: %sBRSPACE Aktions-ID: %sBRSPACE function ID: %sBRSPACE Funktions-ID: %sBRSPACE function: %sBRSPACE Funktion: %sBRSPACE currently running with function '%s' or was killedBRSPACE laeuft gerade mit funktion '%s' oder wurde abgebrochenPlease delete file %s if BRSPACE was killedBitte Datei %s loeschen, wenn BRSPACE abgebrochen wurdeSetting of BRSPACE lock failedSetzen von BRSPACE-Sperre gescheitertSQL statement '%s' executed successfullySQL statement '%s' executed successfully in thread %dSQL-Anweisung '%s' erfolgrech ausgefuehrtSQL-Anweisung '%s' erfolgrech ausgefuehrt in Thread %dExecution of SQL statement '%s' failedAusfuehrung der SQL-Anweisung '%s' gescheitertNumber of instances processed: %dAnzahl der verarbeiteten Instanzen: %dNumber of parameters processed: %dAnzahl der verarbeiteten Parameter: %dNumber of tablespaces processed: %dAnzahl der verarbeiteten Tablespaces: %dNumber of files processed: %dAnzahl der verarbeiteten Dateien: %dNumber of tables processed: %dAnzahl der verarbeiteten Tabellen: %dNumber of indexes processed: %dAnzahl der verarbeiteten Indizes: %dPlease shut down database instance %s first or use the '%s' optionBitte stoppen Sie zuerst Datenbankinstanz %s oder benutzen Sie die '%s'-OptionPlease shut down SAP system first or use the '%s' optionBitte stoppen Sie zuerst SAP-System oder benutzen Sie die '%s'-OptionOnline redolog file switched successfully to sequence number %d for database instance %sOnline-Redolog-Datei erfolgreich umgeschaltet zu Sequenznummer %d fuer Datenbankinstanz %sDatabase checkpoint can be executed globally for all database instancesDatenbank-Checkpoint kann global fuer alle Datenbankinstanzen ausgefuehrt werdenDatabase checkpoint executed successfully for database instance %sDatenbank-Checkpoint erfolgreich ausgefuehrt fuer Datenbankinstanz %sDatabase %s already in '%s' modeDatenbank %s bereits in '%s'-ModusArchivelog mode toggled successfully to '%s' for database %sArchivelog-Modus erfolgreich umgeschaltet auf '%s' fuer Datenbank %sDatabase parameter %s altered successfully from '%s' to '%s'Database parameter %s set successfully to '%s'Datenbankparameter %s erfolgreich geaendert von '%s' auf '%s'Datenbankparameter %s erfolgreich gesetzt auf '%s'Database parameter %s reset successfullyDatenbankparameter %s erfolgreich zurueckgesetztDatabase parameter %s cannot be changedDatenbankparameter %s kann nicht geaendert werdenOracle pfile %s will be created from spfile %sOracle pfile %s will be created from memoryOracle-Pfile %s wird aus Spfile %s erstelltOracle-Pfile %s wird aus Memory erstelltNo spfile active - Oracle pfile cannot be createdNo Oracle spfile activeKein Spfile aktiv - Oracle-Pfile kann nicht erstellt werdenKein Oracle-Spfile aktivClass of information to be shown: %sArt der anzuzeigenden Informationen: %sDatabase parameter '%s' not foundDatenbankparameter '%s' nicht gefundenUnknown database instance '%s' found in %s for parameter '%s'Unknown database instance %d found in %s for parameter '%s'Unbekannte Datenbankinstanz '%s' gefunden in %s fuer Parameter '%s'Unbekannte Datenbankinstanz %d gefunden in %s fuer Parameter '%s'Selecting information about tables and indexes...Auslesen der Informationen ueber Tabellen und Indizes...Selecting information about segments...Auslesen der Informationen ueber Segmente...Selecting information about extents...Auslesen der Informationen ueber Extents...Number of extents for segments of owner %s: %dNumber of segment extents in database %s: %dAnzahl der Extents fuer Segments von Besitzer %s: %dAnzahl der Segment-Extents in Datenbank %s: %dNumber of free extents in database %s: %dAnzahl der freien Extents in Datenbank %s: %dInformation about database space has been resetInformationen ueber Datenbankplatz wurden zurueckgesetztInformation about database segments has been resetInformationen ueber Datenbanksegmente wurden zurueckgesetztNo objects found for showingKeine Objekte fuer Anzeige gefundenPlease start up database instance %s first or use the '%s' optionBitte starten Sie zuerst Datenbankinstanz %s oder benutzen Sie die '%s'-OptionEnter new password for user '%s' (max. %d ASCII chars):Reenter new password for user '%s' (max. %d ASCII chars):Eingabe von neuem Kennwort fuer Benutzer '%s' (max. %d ASCII-Zeichen):Wiedereingabe von neuem Kennwort fuer Benutzer '%s' (max. %d ASCII-Zeichen):Not enough free space in %s for total maximum size of all database files of tablespace %s located on this disk volume, missing at least %4.3f MBNot enough free space in %s for total maximum size of all database files of tablespace %s located on this disk volume and to be moved there, missing at least %4.3f MBNicht genug freier Platz in %s fuer gesamte maximale Groesse aller Datenbankdateien von Tablespace %s lokalisiert auf diesem Plattendatentraeger, es fehlen mindestens %4.3f MBNicht genug freier Platz in %s fuer gesamte maximale Groesse aller Datenbankdateien von Tablespace %s lokalisiert auf diesem Plattendatentraeger und der dorthin zu verschiebenden, es fehlen mindestens %4.3f MBDatabase file '%s' can be renamed now to '%s'Datenbankdatei '%s' kann jetzt umbenannt werden auf '%s'Tablespace %s extended successfully with file: %sTablespace %s extended successfully with files: %sTablespace %s erfolgreich erweitert mit Datei: %sTablespace %s erfolgreich erweitert mit Dateien: %sFile %s is already used by the database - this can cause problems in backupsFile %s is already used through link %s by the databaseDatei %s wird bereits von der Datenbank benutzt - dies kann Probleme bei Sicherungen verursachenDatei %s wird bereits ueber Link %s von der Datenbank benutztRaw disk / link target %s is already used by the databaseRaw disk / link target %s is already used through link %s by the databaseRaw-Platte / Linkziel %s wird bereits von der Datenbank benutztRaw-Platte / Linkziel %s wird bereits ueber Link %s von der Datenbank benutztFile %s already exists in file systemFile %s is still available on diskDatei %s existiert bereits im DateisystemDatei %s ist noch vorhanden auf PlatteDatabase file %s must be located in a subdirectory of '%s' directoryDatabase file %s should be located in a subdirectory of '%s' directoryDatenbankdatei %s muss sich in einem Unterverzeichnis von '%s'-Verzeichnis befindenDatenbankdatei %s sollte sich in einem Unterverzeichnis von '%s'-Verzeichnis befindenLink to raw disk %s must be located in '%s' directoryLink to raw disk %s should be located in '%s' directoryLink zu Raw-Platte %s muss sich in '%s'-Verzeichnis befindenLink zu Raw-Platte %s sollte sich in '%s'-Verzeichnis befindenNot enough free space in %s for file %s, missing at least %4.3f MBNot enough free space in %s for files to be moved, missing at least %4.3f MBNicht genug freier Platz in %s fuer Datei %s, es fehlen mindestens %4.3f MBNicht genug freier Platz in %s fuer die zu verschiebenden Dateien, es fehlen mindestens %4.3f MBNot enough free space in %s for next extension of file %s, missing at least %4.3f MBNot enough free space in %s for next extension of files to be moved, missing at least %4.3f MBNicht genug freier Platz in %s fuer naechste Erweiterung der Datei %s, es fehlen mindestens %4.3f MBNicht genug freier Platz in %s fuer naechste Erweiterung der zu verschiebenden Dateien, es fehlen mindestens %4.3f MBNot enough free space in %s for maximum size of file %s, missing at least %4.3f MBNot enough free space in %s for total maximum size of all files to be moved there, missing at least %4.3f MBNicht genug freier Platz in %s fuer maximale Groesse der Datei %s, es fehlen mindestens %4.3f MBNicht genug freier Platz in %s fuer gesamte maximale Groesse aller dorthin zu verschiebenden Dateien, es fehlen mindestens %4.3f MBTablespace %s created successfully with file: %sTablespace %s created successfully with files: %sTablespace %s erfolgreich angelegt mit Datei: %sTablespace %s erfolgreich angelegt mit Dateien: %sTablespace name '%s' should have at least %d characters and begin with '%s'Tablespace-Name '%s' sollte mindestens %d Zeichen haben und mit '%s' beginnenTable-tablespace name '%s' should end with '%s' characterIndex-tablespace name '%s' should end with '%s' characterTabellen-Tablespace-Name '%s' sollte enden mit '%s' ZeichenIndex-Tablespace-Name '%s' sollte enden mit '%s' ZeichenTablespace %s already exists in databaseTablespace %s existiert bereits in DatenbankNew table data class (tabart) '%s' created for tablespace %s of owner %sTable data class (tabart) '%s' updated for index tablespace %s of owner %sNeue Tabellen-Datenart (Tabart) '%s' angelegt fuer Tablespace %s von Besitzer %sTabellen-Datenart (Tabart) '%s' aktualisiert fuer Index-Tablespace %s von Besitzer %sCreating new table data class (tabart) '%s' failed for tablespace %s of owner %sUpdating table data class (tabart) '%s' failed for index tablespace %s of owner %sAnlegen einer neuen Tabellen-Datenart (Tabart) '%s' gescheitert fuer Tablespace %s von Besitzer %sAktualisierung einer Tabellen-Datenart (Tabart) '%s' gescheitert fuerIndex-Tablespace %s von Besitzer %sTable data class (tabart) '%s' for tablespace %s of owner %s deletedTable data class (tabart) '%s' removed for index tablespace %s of owner %sTabellen-Datenart (Tabart) '%s' fuer Tablespace %s von Besitzer %s geloeschtTabellen-Datenart (Tabart) '%s' entfernt fuer Index-Tablespace %s von Besitzer %sDeleting of table data class (tabart) '%s' failed for tablespace %s of owner %sLoschen einer Tabellen-Datenart (Tabart) '%s' gescheitert fuer Tablespace %s von Besitzer %sAll table data classes (tabarts) are in useAlle Tabellen-Datenarten (Tabarten) werden benutztTablespace %s dropped successfullyTablespace %s erfolgreich geloeschtSearching for segments in tablespace %s ...Suchen nach Segmenten in Tablespace %s ...Tablespace %s is emptyTablespace %s is empty - skipping index rebuildTablespace %s ist leerTablespace %s ist leer - Neuaufbau der Indizes wird uebersprungenTablespace %s contains %d object(s) - option '%s' can be used to drop itTablespace %s contains %d object(s) - do you really want to drop it?Tablespace %s beinhaltet %d Objekt(e) - Option '%s' kann benutzt werden, um ihn zu loeschenTablespace %s beinhaltet %d Objekt(e) - wollen Sie ihn wirklich loeschen?Tablespace %s altered successfully into status '%s'Tablespace %s erfolgreich geaendert in den Status '%s'Free extents of tablespace %s coalesced successfullyFreie Extents von Tablespace %s erfolgreich zusammenfuegtTablespace %s cannot be selected for function '%s'Tablespace %s cannot be selected for action '%s'Tablespace %s kann fuer Funktion '%s' nicht ausgewaehlt werdenTablespace %s kann fuer Aktion '%s' nicht ausgewaehlt werdenNo appropriate tablespace found for function '%s'No appropriate tablespace found for action '%s'Kein passender Tablespace fuer Funktion '%s' gefundenKein passender Tablespace fuer Aktion '%s' gefundenDatabase should be closed for taking data files offlineDatenbank sollte fuer Offline-Setzen der Datendateien geschlossen werdenData file %s altered successfullyData file %s altered successfully into status '%s'Datendatei %s erfolgreich geaendertDatendatei %s erfolgreich geaendert in den Status '%s'The size of data file %s altered successfully from %1.0f MB to %s MBDie Groesse der Datendatei %s erfolgreich geaendert von %1.0f MB auf %s MBData file %s cannot be selected for function '%s'Data file %s cannot be selected for action '%s'Datendatei %s kann fuer Funktion '%s' nicht ausgewaehlt werdenDatendatei %s kann fuer Aktion '%s' nicht ausgewaehlt werdenNo appropriate data file found for function '%s'No appropriate data file found for action '%s'Keine passende Datendatei fuer Funktion '%s' gefundenKeine passende Datendatei fuer Aktion '%s' gefundenData file %s moved successfully to %sData files %s moved successfully to %sDatendatei %s erfolgreich verschoben zu %sDatendateien %s erfolgreich verschoben zu %sMove destination '%s' must be a 'sapdata' or 'sapraw' directory path nameVerschiebungsziel '%s' muss ein 'sapdata' oder 'sapraw' Verzeichnis-Pfadname seinMove destination '%s' not found or not a directoryVerschiebungsziel '%s' nicht gefunden oder kein VerzeichnisOnly one file may be selected to be moved to individual raw diskNur eine Datei darf ausgewaehlt werden, um auf einzelne Raw-Platte verschoben zu werdenData file %s cannot be moves to the same locationDatendatei %s kann zu demselben Ort verschoben werdenShould the data file %s be created as Quick I/O file?Soll die Datendatei %s als Quick-I/O-Datei angelegt werden?Extending tablespace %s ...Erweitern von Tablespace %s ...Creating tablespace %s ...Anlegen von Tablespace %s ...Dropping tablespace %s ...Loeschen von Tablespace %s ...Next data file can be specified nowNaechste Datendatei kann jetzt spezifiziert werdenIndex tablespace %s can be created nowIndex Tablespace %s kann jetzt angelegt werdenUser table data class (tabart) '%s' must begin with characters %sBenutzer Tabellen-Datenart (Tabart) '%s' muss mit Zeichen %s beginnenThe default temporary tablespace of database %s can be set to %s nowDer default temporaere Tablespace von Datenbank %s kann jetzt auf %s gesetzt werdenTablespace %s renamed successfully to %sTablespace %s erfolgreich umbenannt auf %sDatabase file '%s' renamed successfully to '%s'Datenbankdatei '%s' erfolgreich umbenannt auf '%s'Dropped tablespace %s is still used by owner %s as default tablespace - please alter the user or recreate the tablespaceDropped tablespace %s is still used by owner %s as temporary tablespace - please alter the user or recreate the tablespaceGeloeschter Tablespace %s wird weiter als Default-Tablespace vom Benutzer %s benutzt - bitte aendern Sie den Benutzer oder legen Sie den Tablespace neu anGeloeschter Tablespace %s wird weiter als temporaerer Tablespace vom Benutzer %s benutzt - bitte aendern Sie den Benutzer oder legen Sie den Tablespace neu anTablespace %s should be auto-extensible for reorganizationTablespace %s should be auto-extensible for rebuildTablespace %s sollte fuer Reorganisation automatisch erweiterbar seinTablespace %s sollte fuer Neuerstellung automatisch erweiterbar seinTablespace %s is not a locally managed tablespaceTablespace %s ist nicht ein lokal verwalteter TablespaceTablespace %s cannot be specified for function '%s'Tablespace %s cannot be specified as '%s' for function '%s'Tablespace %s kann nicht fuer Funktion '%s' spezifiziert werdenTablespace %s kann nicht als '$s' fuer Funktion '%s' spezifiziert werdenStarting '%s' table reorganization...Starting '%s' table partition reorganization...Starten der '%s'-Tabellen-Reorganisation...Starten der '%s'-Tabellen-Partitionen-Reorganisation...Number of tables reorganized successfully: %dNumber of tables/partitions reorganized successfully: %d/%dAnzahl der erfolgreich reorganisierten Tabellen: %dAnzahl der erfolgreich reorganisierten Tabellen/Partitionen: %d/%dReorganization failed for %d table(s)Reorganization failed for %d/%d tables/partitionsReorganisation gescheitert fuer %d Tabelle(n)Reorganisation gescheitert fuer %d/%d Tabellen/PartitionenReorganization failed for all tablesReorganization failed for all table partitionsReorganisation gescheitert fuer alle TabellenReorganisation gescheitert fuer alle Tabellen-PartitionenTable %s.%s reorganized successfullyTable partition %s.%s.%s reorganized successfullyTabelle %s.%s erfolgreich reorganisiertTabellen-Partition %s.%s.%s erfolgreich reorganisiertReorganization of table %s.%s failedReorganization of table partition %s.%s.%s failedReorganisation der Tabelle %s.%s gescheitertReorganisation der Tabellen-Partition %s.%s.%s gescheitertTable(s) '%s' not foundTabelle(n) '%s' nicht gefundenChecking tables for reorganization...Ueberpruefung der Tabellen fuer Reorganisation...Name of table %s.%s longer than %d charactersName of index %s.%s longer than %d charactersName der Tabelle %s.%s ist laenger als %d ZeichenName des Index %s.%s ist laenger als %d ZeichenTable %s.%s has a LONG (RAW) columnTable %s.%s of Index %s has a LONG (RAW) columnTabelle %s.%s hat eine LONG-(RAW)-SpalteTabelle %s.%s von Index %s hat eine LONG-(RAW)-SpalteReorganization of table %s.%s will be skippedReorganization of table partition %s.%s.%s will be skippedReorganisation der Tabelle %s.%s wird uebersprungenReorganisation der Tabellen-Partition %s.%s.%s wird uebersprungenNumber of tables selected/skipped for reorganization: %d/%dNumber of table partitions selected/skipped for reorganization: %d/%dAnzahl der Tabellen ausgewaehlt/uebersprungen fuer Reorganisation: %d/%dAnzahl der Tabellen-Partitionen ausgewaehlt/uebersprungen fuer Reorganisation: %d/%dAll tables have been skipped for reorganizationAll table partitions have been skipped for reorganizationAlle Tabellen wurden fuer Reorganisation uebersprungenAlle Tabellen-Partitionen wurden fuer Reorganisation uebersprungenStarting creation of DDL statements for reorganization...Starting creation of DDL statements...Starten der Erstellung von DDL-Anweisungen fuer Reorganisation...Starten der Erstellung von DDL-Anweisungen...Number of tables DDL for which statements were successfully created: %dAnzahl der Tabellen fuer die DDL-Anweisungen erfolgreich erstellt wurden: %dCreation of DDL statements failed for %d tableCreation of DDL statements failed for %d tablesErstellung der DDL-Anweisungen gescheitert fuer %d TabelleErstellung der DDL-Anweisungen gescheitert fuer %d TabellenTable %s.%s locked for DDL statementsTabelle %s.%s fuer DDL-Anweisungen gesperrtDDL statements created for table %s.%sDDL-Anweisungen erstellt fuer Tabelle %s.%sCreation of DDL statements for table %s.%s failedErstellung der DDL-Anweisungen fuer Tabelle %s.%s gescheitertSQL statement '%s' longer than %d KBSQL-Anweisung '%s' laenger als %d KBDDL buffer overflow - SQL statements longer than %d KBUeberlauf des DDL-Puffers - SQL-Anweisungen laenger als %d KB%d of %d table processed - %d of %d table DDL done%d of %d tables processed - %d of %d table DDLs done%d von %d Tabelle verarbeitet - %d von %d Tabellen-DDL fertig%d von %d Tabellen verarbeitet - %d von %d Tabellen-DDLs fertigTables with the longest duration of creating DDLs for owner %sTabellen mit laengster Dauer der Erstellung der DDLs fuer Besitzer %sStarting '%s' reorganization of table %s.%s ...Starting '%s' reorganization of table partition %s.%s.%s ...'%s'-Reorganisation der Tabelle %s.%s wird gestartet...'%s'-Reorganisation der Tabellen-Partition %s.%s.%s wird gestartet...Interim table created for table %s.%sInterim table created for table partition %s.%s.%sVorlaeufige Tabelle erstellt fuer Tabelle %s.%sVorlaeufige Tabelle erstellt fuer Tabellen-Partition %s.%s.%sPrimary key created for table %s.%sPrimaerschluessel erstellt fuer Tabelle %s.%sStarting online redefinition of table %s.%s ...Starting online redefinition of table partition %s.%s.%s ...Online-Redefinition der Tabelle %s.%s wird gestartet...Online-Redefinition der Tabellen-Partition %s.%s.%s wird gestartet...Interim table synchronized with table %s.%sInterim table synchronized with table partition %s.%s.%sVorlaeufige Tabelle synchronisiert mit Tabelle %s.%sVorlaeufige Tabelle synchronisiert mit Tabellen-Partition %s.%s.%sInterim index created for index %s of table %s.%sInterim index created for index %s of table partition %s.%s.%sVorlaeufige Index erstellt fuer Index %s von Tabelle %s.%sVorlaeufige Index erstellt fuer Index %s von Tabellen-Partition %s.%s.%sInterim constraints created for table %s.%sInterim constraints created for table partition %s.%s.%sVorlaeufige Constraints erstellt fuer Tabelle %s.%sVorlaeufige Constraints erstellt fuer Tabellen-Partition %s.%s.%sInterim referential constraints created for table %s.%sInterim referential constraints created for table partition %s.%s.%sVorlaeufige referentielle Constraints erstellt fuer Tabelle %s.%sVorlaeufige referentielle Constraints erstellt fuer Tabellen-Partition %s.%s.%sInterim grants created for table %s.%sInterim grants created for table partition %s.%s.%sVorlaeufige Grants erstellt fuer Tabelle %s.%sVorlaeufige Grants erstellt fuer Tabellen-Partition %s.%s.%sInterim triggers created for table %s.%sInterim triggers created for table partition %s.%s.%sVorlaeufige Triggers erstellt fuer Tabelle %s.%sVorlaeufige Triggers erstellt fuer Tabellen-Partition %s.%s.%sInterim comments created for table %s.%sInterim comments created for table partition %s.%s.%sVorlaeufige Kommentare erstellt fuer Tabelle %s.%sVorlaeufige Kommentare erstellt fuer Tabellen-Partition %s.%s.%sCreating indexes and dependent objects for table %s.%s ...Creating indexes for table partition %s.%s.%s ...Erstellen der Indizes und abhaengigen Objekte fuer Tabelle %s.%s ...Erstellen der Indizes fuer Tabellen-Partition %s.%s.%s ...Finishing online redefinition of table %s.%s ...Finishing online redefinition of table partition %s.%s.%s ...Online-Redefinition der Tabelle %s.%s wird abgeschlossen...Online-Redefinition der Tabellen-Partition %s.%s.%s wird abgeschlossen...Online redefinition of table %s.%s finishedOnline redefinition of table partition %s.%s.%s finishedOnline-Redefinition der Tabelle %s.%s beendetOnline-Redefinition der Tabelle %s.%s-Partition %s.beendetInterim table dropped for table %s.%sInterim table dropped for table partition %s.%s.%sVorlaeufige Tabelle geloescht fuer Tabelle %s.%sVorlaeufige Tabelle geloescht fuer Tabellen-Partition %s.%s.%sName of constraint %s.%s longer than %d charactersName des Constraints %s.%s ist laenger als %d ZeichenName of trigger %s.%s longer than %d charactersName des Triggers %s.%s ist laenger als %d Zeichen%d of %d table processed - %1.0f of %1.0f rows done%d of %d tables processed - %1.0f of %1.0f rows done%d von %d Tabelle verarbeitet - %1.0f von %1.0f Reihen fertig%d von %d Tabellen verarbeitet - %1.0f von %1.0f Reihen fertigTables with the longest duration of reorganization for owner %sTabellen mit laengster Dauer der Reorganisation fuer Besitzer %sTable %s.%s has disabled referential constraints - it cannot be reorganized onlineTable %s.%s has disabled referential constraints - its parent table %s.%s cannot be reorganized onlineTabelle %s.%s hat deaktivierte referentielle Constraints - sie kann nicht online reorganisiert werdenTabelle %s.%s hat deaktivierte referentielle Constraints - ihre Parent-Tabelle %s.%s kann nicht online reorganisiert werdenStatistics exported for table %s.%sStatistics exported for table %s.%s and its indexesStatistiken exportiert fuer Tabelle %s.%sStatistiken exportiert fuer Tabelle %s.%s und ihre IndizesStatistics imported for table %s.%sStatistics imported for table %s.%s and its indexesStatistiken importiert fuer Tabelle %s.%sStatistiken importiert fuer Tabelle %s.%s und ihre IndizesTable %s.%s has no LONG columnTabelle %s.%s hat keine LONG-SpalteCreating DDL statements for table %s.%s ...Erstellen der DDL-Anweisungen fuer Tabelle %s.%s ...You can check/change the DDL statements in file %s nowSie koennen jetzt die DDL-Anweisungen in Datei %s ueberpruefen/aendernTable %s.%s will be sorted by the fields of index %s during reorganizationTabelle %s.%s wird waehrend der Reorganisation nach den Feldern von Index %s sortiertSort index '%s' not found for table %s.%s - it will not be sorted during reorganizationSortindex '%s' nicht gefunden fuer Tabelle %s.%s - sie wird waehrend der Reorganisation nicht sortiertStarting '%s' index rebuilding...Starting '%s' index partition rebuilding...Starten der '%s'-Index-Neuerstellung...Starten der '%s'-Index-Partition-Neuerstellung...Number of indexes rebuilt successfully: %dNumber of indexes/partitions rebuilt successfully: %d/%dAnzahl der erfolgreich neu erstellten Indizes: %dAnzahl der erfolgreich neu erstellten Indizes/Partitionen: %d/%dRebuild failed for %d index(es)Rebuild failed for %d/%d indexes/partitionsNeuerstellung gescheitert fuer %d Index/IndizesNeuerstellung gescheitert fuer %d/%d Indizes/PartitionenRebuild failed for all indexesRebuild failed for all index partitionsNeuerstellung gescheitert fuer alle IndizesNeuerstellung gescheitert fuer alle Index-PartitionenStarting '%s' rebuilding of index %s.%s ...Starting '%s' rebuilding of index partition %s.%s.%s ...'%s'-Neuerstellung des Index %s.%s wird gestartet...'%s'-Neuerstellung der Index-Partition %s.%s.%s wird gestartet...Index %s.%s rebuilt successfullyIndex partition %s.%s.%s rebuilt successfullyIndex %s.%s erfolgreich neu erstelltIndex-Partition %s.%s.%s erfolgreich neu erstelltRebuild of index %s.%s failedRebuild of index partition %s.%s.%s failedNeuerstellung des Index %s.%s gescheitertNeuerstellung der Index-Partition %s.%s.%s gescheitert%d of %d index processed - %1.0f of %1.0f rows done%d of %d indexes processed - %1.0f of %1.0f rows done%d von %d Index verarbeitet - %1.0f von %1.0f Reihen fertig%d von %d Indizes verarbeitet - %1.0f von %1.0f Reihen fertigIndexes with the longest duration of rebuilding for owner %sIndizes mit laengster Dauer der Neuerstellung fuer Besitzer %s%d table exported by %s utility%d tables exported by %s utility%d Tabelle exportiert von %s-Utility%d Tabellen exportiert von %s-UtilityTable export failedTabellen-Export gescheitertTotal used spaces in tables to be exported greater than free space in dump directory %s, missing at least %4.3f MB - export may failGesamter benutzter Platz in den zu exportierenden Tabellen groesser als freier Platz in Dump-Verzeichnis %s, es fehlen mindestens %4.3f MB - Export kann scheiternDump file %s will be overwrittenDump-Datei %s wird ueberschriebenExport of tables will be started with command line: %sExport of tablespaces will be started with command line: %sExport von Tabellen wird gestartet mit Kommandozeile: %sExport von Tablespaces wird gestartet mit Kommandozeile: %sWarnings or errors have been reported by %s utilityWarnungen oder Fehler wurden von %s-Utility gemeldet%d table imported by %s utility%d tables imported by %s utility%d Tabelle importiert von %s-Utility%d Tabellen importiert von %s-UtilityTable import failedTabellen-Import gescheitertNo BRSPACE export tables runs found for importKeine BRSPACE-Tabellenexport-Laeufe fuer Import gefundenExport '%s' not found in the list of exportsExport '%s' nicht gefunden in der Liste der ExporteDump file '%s' not foundDump-Datei '%s' nicht gefundenDump file %s is not a regular fileDump-Datei %s ist keine normale DateiImport of tables will be started with command line: %sImport of tablespaces will be started with command line: %sImport von Tabellen wird gestartet mit Kommandozeile: %sImport von Tablespaces wird gestartet mit Kommandozeile: %sTable %s.%s altered successfully into status '%s'Tabelle %s.%s erfolgreich geaendert in den Status '%s'Parallel degree of table %s.%s altered successfully from %d to %sParallelitaetsgrad der Tabelle %s.%s erfolgreich geaendert von %d auf %sTable %s.%s cannot be selected for function '%s'Table %s.%s cannot be selected for action '%s'Tabelle %s.%s kann fuer Funktion '%s' nicht ausgewaehlt werdenTabelle %s.%s kann fuer Aktion '%s' nicht ausgewaehlt werdenNo appropriate tables found for function '%s'No appropriate tables found for action '%s'Keine passenden Tabellen fuer Funktion '%s' gefundenKeine passenden Tabellen fuer Aktion '%s' gefundenContents of index %s.%s coalesced successfullyInhalt von Index %s.%s erfolgreich zusammenfuegtParallel degree of index %s.%s altered successfully from %d to %sParallelitaetsgrad der Index %s.%s erfolgreich geaendert von %d auf %sIndex(es) '%s' not foundIndex/Indizes '%s' nicht gefundenNo appropriate indexes found for function '%s'No appropriate indexes found for action '%s'Keine passenden Indizes fuer Funktion '%s' gefundenKeine passenden Indizes fuer Aktion '%s' gefundenA dummy export will be done to null deviceEin Dummy-Export wird auf Null-Geraet ausgefuehrtTable %s.%s shrunk successfullyTabelle %s.%s erfolgreich geschrumpftIndex %s.%s shrunk successfullyIndex %s.%s erfolgreich geschrumpftChecking tables for action '%s'...Checking indexes for action '%s'...Ueberpruefung der Tabellen fuer Aktion '%s'...Ueberpruefung der Indizes fuer Aktion '%s'...Table %s.%s located in a non-ASSM tablespace %sIndex %s.%s located in a non-ASSM tablespace %sTabelle %s.%s befindet sich in einem nicht-ASSM Tablespace %sIndex %s.%s befindet sich in einem nicht-ASSM Tablespace %sTable %s.%s will be skipped for action '%s'Index %s.%s will be skipped for action '%s'Tabelle %s.%s wird uebersprungen fuer Aktion '%s'Index %s.%s wird uebersprungen fuer Aktion '%s'Number of tables selected/skipped for action '%s': %d/%dNumber of indexes selected/skipped for action '%s': %d/%dAnzahl der Tabellen ausgewaehlt/uebersprungen fuer Aktion '%s': %d/%dAnzahl der Indizes ausgewaehlt/uebersprungen fuer Aktion '%s': %d/%dAll tables have been skipped for action '%s'All indexes have been skipped for action '%s'Alle Tabellen wurden fuer Aktion '%s' uebersprungenAlle Indizes wurden fuer Aktion '%s' uebersprungenIOT-TOP index %s.%s cannot be rebuiltIOT-TOP index partition %s.%s.%s cannot be rebuiltIOT-TOP-Index-Partition %s.%s.%s kann nicht neu erstellt werdenIOT-TOP-Index %s.%s kann nicht neu erstellt werdenNumber of indexes selected/skipped for rebuilding: %d/%dNumber of index partitions selected/skipped for rebuilding: %d/%dAnzahl der Indizes ausgewaehlt/uebersprungen fuer Neuerstellung: %d/%dAnzahl der Index-Partitionen ausgewaehlt/uebersprungen fuer Neuerstellung: %d/%dAll indexes have been skipped for rebuildingAll index partition have been skipped for rebuildingAlle Indizes wurden fuer Neuerstellung uebersprungenAlle Index-Partitionen wurden fuer Neuerstellung uebersprungenTable %s.%s is a non-partitioned index-organized tableTabelle %s.%s ist eine nicht-partitionierte index-organisierte TabelleIndex %s.%s is an IOT-TOP indexIndex %s.%s ist ein IOT-TOP-IndexNumber of tables altered successfully: %dAnzahl der erfolgreich geaenderten Tabellen: %dAlter table failed for %d tableAlter table failed for %d tablesAenderung gescheitert fuer %d TabelleAenderung gescheitert fuer %d TabellenAlter failed for all tablesAenderung gescheitert fuer alle TabellenNumber of indexes altered successfully: %dAnzahl der erfolgreich geaenderten Indizes: %dAlter failed for %d indexAlter failed for %d indexesAenderung gescheitert fuer %d IndexAenderung gescheitert fuer %d IndizesAlter failed for all indexesAenderung gescheitert fuer alle IndizesDrop of interim table %s.%s#$ waiting due to active cursors...Thread %d: drop of interim table %s.%s#$ waiting due to active cursors...Loeschung der vorlaeufigen Tabelle %s.%s#$ wartet aufgrund aktiven Cursors...Thread %d: Loeschung der vorlaeufigen Tabelle %s.%s#$ wartet aufgrund aktiven Cursors...Cleaning up tables after reorganization...Aufraeumen der Tabellen nach Reorganisation...Table %s.%s cleaned up successfully after reorganizationTabelle %s.%s erfolgreich aufgeraeumt nach ReorganisationNumber of tables that have been cleaned up: %dAnzahl der Tabellen, die aufgeraeumt wurden: %dPrimary key may have been created for table %s.%s during reorganization - it can be dropped nowPrimaerschluessel wurde moeglicherweise erstellt waehrend der Reorganisation fuer Tabelle %s.%s - er kann nun geloescht werdenPrimary key dropped for table %s.%sPrimaerschluessel geloescht fuer Tabelle %s.%sParallel degree may have been changed for table %s.%s and its indexes during reorganization - they can be reset nowParallelitaetsgrad wurde moeglicherweise geaendert waehrend der Reorganisation fuer Tabelle %s.%s und ihre Indizes - sie koennen nun zurueckgesetzt werdenParallel degree reset for table %s.%s and/or its indexesParallelitaetsgrad zurueckgesetzt fuer Tabelle %s.%s und/oder ihre Indizes%s currently not running%s started with function '%s' currently not running%s laeuft gerade nicht%s gestartet mit Funktion '%s' laeuft gerade nicht%s started with function '%s' will be stopped now%s gestartet mit Funktion '%s' wird jetzt gestoppt%s thread %d stopped%s-Thread %d gestoppt%s started with function '%s' has been stopped%s gestartet mit Funktion '%s' wurde gestopptStopping of %s started with function '%s' failedStoppen von %s gestartet mit Funktion '%s' gescheitert%s started with function '%s' will be suspended now%s gestartet mit Funktion '%s' wird jetzt angehalten%s thread %d suspended%s-Thread %d angehalten%s started with function '%s' has been suspended%s gestartet mit Funktion '%s' wurde angehaltenSuspension of %s started with function '%s' failedAnhalten von %s gestartet mit Funktion '%s' gescheitert%s suspended with function '%s' will be resumed now%s gestartet mit Funktion '%s' wird jetzt wieder aufgenommen%s thread %d resumed%s-Thread %d wieder aufgenommen%s suspended with function '%s' has been resumed%s gestartet mit Funktion '%s' wurde wieder aufgenommenResumption of %s suspended with function '%s' failedWiederaufnahme von %s gestartet mit Funktion '%s' gescheitert%s started with function '%s' is already suspended%s gestartet mit Funktion '%s' ist bereits angehalten%s started with function '%s' is not suspended%s gestartet mit Funktion '%s' ist nicht angehaltenRenamed tablespace %s is still used by owner %s as default tablespace - please alter the user or recreate the tablespaceRenamed tablespace %s is still used by owner %s as temporary tablespace - please alter the user or recreate the tablespaceUmbenannter Tablespace %s wird weiter als Default-Tablespace vom Benutzer %s benutzt - bitte aendern Sie den Benutzer oder legen Sie den Tablespace neu anUmbenannter Tablespace %s wird weiter als temporaerer Tablespace vom Benutzer %s benutzt - bitte aendern Sie den Benutzer oder legen Sie den Tablespace neu anThe default tablespace of owner %s can be set to %s nowThe temporary tablespace of owner %s can be set to %s nowDer Default-Tablespace von Benutzer %s kann jetzt auf %s gesetzt werdenDer temporaere Tablespace von Benutzer %s kann jetzt auf %s gesetzt werdenShould the size Quick I/O file %s be increased?Should the size Quick I/O file %s be reduced?Soll die Groesse der Quick-I/O-Datei %s erhoeht werden?Soll die Groesse der Quick-I/O-Datei %s reduziert werden?Size of file %s exceeds the maximum Oracle file size - it will be reduced to %d MBGroesse der Datei %s ueberschreitet die maximale Oracle Dateigroesse - sie wird auf %d MB reduziertMaximum size of file %s exceeds the maximum Oracle file size - it will be reduced to %d MBMaximale Groesse der Datei %s ueberschreitet die maximale Oracle Dateigroesse - sie wird auf %d MB reduziertIncrement size of file %s exceeds the maximum Oracle file size - it will be reduced to %d MBGroesse des Zuwachses der Datei %s ueberschreitet die maximale Oracle Dateigroesse - sie wird auf %d MB reduziertThe name of file '%s' has not been changedDer der Datei '%s' is nicht geaendert wordenThe new name '%s' of file '%s' must use the same sapdata (sapraw) directoryDer neue Name '%s' der Datei '%s' muss dasselbe sapdata-(sapraw)-Verzeichnis benutzenExport of individual tables from multiple schemas not supported by %sExport der einzelnen Tabellen von mehreren Schemata nicht unterstuetzt von %sImport of individual tables from multiple schemas not supported by %sImport der einzelnen Tabellen von mehreren Schemata nicht unterstuetzt von %sOwner name not allowed in parameter/option '%s'Besitzername nicht erlaubt in Parameter/Option '%s'The name '%s' is reserved for a %s tablespaceThe name '%s' is reserved for an %s tablespaceDer Name '%s' ist reserviert fuer einen %s-TablespaceThe default permanent tablespace of database %s can be set to %s nowDer default permanente Tablespace von Datenbank %s kann jetzt auf %s gesetzt werdenDummy export to null device not supported by Oracle Data PumpDummy-Export auf Null-Geraet nicht unterstuetzt von Oracle Data PumpEnter password for data pump encryption (max. %d ASCII chars):Reenter password for data pump encryption (max. %d ASCII chars):Eingabe Kennwort fuer Data-Pump-Verschluesselung (max. %d ASCII-Zeichen):Wiedereingabe Kennwort fuer Data-Pump-Verschluesselung (max. %d ASCII-Zeichen):Database file %s already exists in databaseDatenbankdatei %s existiert bereits in DatenbankInterim indexes created for table partition %s.%s.%sInterim indexes created for table %s.%sVorlaeufige Indizes erstellt fuer Tabelle %s.%sVorlaeufige Indizes erstellt fuer Tabellen-Partition %s.%s.%s%s will be aborted now in mode '%s'%s wird jetzt abgebrochen in Modus '%s'Aborting of %s in mode '%s'...Abbrechen von %s in Modus '%s'...%s copy process %d stopped%s-Kopierprozess %d gestoppt%s has been aborted in mode '%s'%s wurde abgebrochen in Modus '%s'Abortion of %s in mode '%s' failedAbbruch von %s in Modus '%s' gescheitertBR_TRACE: memory allocation - location %s-%d, type: '%s', size %d, address: %pBR_TRACE: Speicherzuteilung - Stelle %s-%d, Typ: '%s', Groesse %d, Adresse: %pBR_TRACE: memory free - type: '%s', address: %pBR_TRACE: Speicherfreigabe - Typ: '%s', Adresse: %pNo password entry found for user ID %dKein Kennworteintrag fuer Benutzer-ID %d gefundenTablespace %s contains materialized view %s.%s - it cannot be droppedTablespace %s beinhaltet Materialized-View %s.%s - er kann nicht geloescht werdenWhen the materialized view was created during an online reorganization, then it can be removed using cleanup reorg actionWhen the materialized views were created during an online reorganization, then they can be removed using cleanup reorg actionWenn der Materialized-View waehrend einer Online-Reorganisation angelegt wurde, dann kann er mittles der Cleanup-Reorg-Aktion geloescht werdenWenn die Materialized-Views waehrend einer Online-Reorganisation angelegt wurden, dann koennen sie mittles der Cleanup-Reorg-Aktion geloescht werdenNational character set '%s' not supported for this functionNationaler Zeichensatz '%s' nicht unterstuetzt fuer diese FunktionDatabase %s has no default temporary tablespaceDatenbank %s hat keinen default temporaeren TablespaceDatabase %s is not in automatic undo management mode or Oracle parameter '%s' is not setDatenbank %s ist nicht in automatischem Undo-Verwaltungsmodus oder Oracle-Parameter '%s' ist nicht gesetztUndo tablespace name %s cannot be different from the value '%s' of Oracle parameter '%s' if spfile is not usedUndo-Tablespace-Name %s kann nicht unterschiedlich sein vom Wert '%s' des Oracle-Parameters '%s', wenn Spfile nicht benutzt wirdOracle parameter '%s' must be set to '%s' if spfile is not usedOracle parameter '%s' must be set to '%s' or higher for %sOracle-Parameter '%s' muss auf '%s' gesetzt sein, wenn Spfile nicht benutzt wirdOracle-Parameter '%s' muss auf '%s' oder hoeher gesetzt sein fuer %sDatabase %s has no user tablespacesDatenbank %s hat keine Benutzer-TablespacesNext redolog group can be specified nowNaechste Redolog-Gruppe kann jetzt spezifiziert werdenCreate database statement SQL file %s createdSQL-Datei fuer Anlegen der Datenbank %s angelegtBuild data dictionary views SQL file %s createdSQL-Datei fuer Anlegen der Dictionary-Views %s angelegtDummy temporary tablespace %s createdDummy temporaerer Tablespace %s angelegtDummy temporary tablespace %s deletedDummy temporaerer Tablespace %s geloeschtThe default temporary tablespace of database %s changed from %s to %sDer default temporaere Tablespace von Datenbank %s wurde geaendert von %s auf %sDummy undo tablespace %s createdDummy Undo-Tablespace %s angelegtDummy undo tablespace %s deletedDummy Undo-Tablespace %s geloeschtDefault tablespace %s of owner %s not foundDefault-Tablespace %s von Benutzer %s nicht gefundenTemporary tablespace %s of owner %s not foundTemporaerer Tablespace %s von Benutzer %s nicht gefundenDefault tablespace of owner %s changed to %sDefault tablespace of owner %s changed from %s to %sDefault-Tablespace von Benutzer %s geaendert auf %sDefault-Tablespace von Benutzer %s geaendert von %s auf %sTemporary tablespace of owner %s changed to %sTemporary tablespace of owner %s changed from %s to %sTemporaerer Tablespace von Benutzer %s geaendert auf %sTemporaerer Tablespace von Benutzer %s geaendert von %s auf %sOracle special database owner %s will not be exported by %s utilityOracle special database owner %s will not be exported by %s utility - this can generate warning/error messages during importOracle Sonder-Datenbankbesitzer %s wird von %s-Utility nicht exportiertOracle Sonder-Datenbankbesitzer %s wird von %s-Utility nicht exportiert - das kann Warnungs-/Fehlermeldungen waehrend des Imports generierenExport global objects parameter file %s createdParameterdatei fuer Export der globalen Objekte %s angelegtExport of global objects will be started with command line: %sExport von globalen Objekten wird gestartet mit Kommandozeile: %sExport of global objects completedExport von globalen Objekten beendetExport of global objects failedExport von globalen Objekten gescheitertSQLPLUS will be started for execution of SQL script %sSQLPLUS wird gestartet fuer Ausfuehrung von SQL-Skript %sExecution of SQL script %s completedAusfuehrung von SQL-Skript %s beendetSQLPLUS executed successfully SQL script %sSQLPLUS hat SQL-Skript %s erfolgreich ausgefuehrtExecution of SQL script %s by SQLPLUS failedAusfuehrung von SQL-Skript %s durch SQLPLUS gescheitertSQLPLUS reported warnings or errors during the execution of SQL script %sSQLPLUS hat Warnungen oder Fehler bei der Ausfuehrung von SQL-Skript %s gemeldetImport global objects parameter file %s createdParameterdatei fuer Import der globalen Objekte %s angelegtImport of global objects will be started with command line: %sImport von globalen Objekten wird gestartet mit Kommandozeile: %sImport of global objects completedImport von globalen Objekten beendetImport of global objects failedImport von globalen Objekten gescheitertArchivelog mode will be toggled now to '%s' for database %sArchivelog-Modus wird jetzt umgeschaltet auf '%s' fuer Datenbank %sDatabase %s recreated successfullyDatenbank %s erfolgreich neu angelegtThe default permanent tablespace of database %s has been changed from %s to %sDer default permanente Tablespace von Datenbank %s wurde geaendert von %s auf %sSystem tablespace %s to be recreated contains %s segment of database owner %s - this segment and/or its content may be lostSystem tablespace %s to be recreated contains %s segments of database owner %s - these segments and/or their contents may be lostDer neu anzulegende System-Tablespace %s beinhaltet %s Segment von Datenbankbesitzer %s - dieses Segment und/oder sein Inhalt kann verloren gehenDer neu anzulegende System-Tablespace %s beinhaltet %s Segmente von Datenbankbesitzer %s - diese Segmente und/oder ihre Inhalte koennen verloren gehenStatistics table %s.%s created in tablespace %sStatistics table %s.%s created in default tablespace of owner %sStatistik-Tabelle %s.%s angelegt in Tablespace %sStatistik-Tabelle %s.%s angelegt in Default-Tablespace von Besitzer %sStatistics table %s.%s droppedStatistik-Tabelle %s.%s geloeschtExporting database statistics into table %s.%s ...Exporting %s schema statistics into table %s.%s ...Datenbank-Statistiken werden exportiert in die Tabelle %s.%s ...%s Schema-Statistiken werden exportiert in die Tabelle %s.%s ...Database statistics exported successfully into table %s.%s%s schema statistics exported successfully into table %s.%sDatenbank-Statistiken erfolgreich exportiert in die Tabelle %s.%s%s Schema-Statistiken erfolgreich exportiert in die Tabelle %s.%sExport of database statistics into table %s.%s failedExport of %s schema statistics into table %s.%s failedExport von Datenbank-Statistiken in die Tabelle %s.%s gescheitertExport von %s Schema-Statistiken in die Tabelle %s.%s gescheitertImporting database statistics from table %s.%s ...Importing %s schema statistics from table %s.%s ...Datenbank-Statistiken werden importiert aus der Tabelle %s.%s ...%s Schema-Statistiken werden importiert aus der Tabelle %s.%s ...Database statistics imported successfully from table %s.%s%s schema statistics imported successfully from table %s.%sDatenbank-Statistiken erfolgreich importiert aus der Tabelle %s.%s%s Schema-Statistiken erfolgreich importiert aus der Tabelle %s.%sImport of database statistics from table %s.%s failedImport of %s schema statistics from table %s.%s failedImport von Datenbank-Statistiken aus der Tabelle %s.%s gescheitertImport von %s Schema-Statistiken aus der Tabelle %s.%s gescheitertSystem database file can be saved now: %sSystem database files can be saved before dropping user tablespacesSystem-Datenbankdateien kann jetzt gesichert werden: %sSystem-Datenbankdateien koennen vor Loeschen von Benutzer-Tablespaces gesichert werdenPost database create SQL script %s created successfullyPost-Datenbankerstellung SQL-Skript %s erfolgreich angelegtSystem database files will be restored nowSystem-Datenbankdateien werden jetzt zurueckgeladenDatabase owner %s has segments in tablespaces SYSTEM/SYSAUX and in a user tablespace - segments in system tablespaces will be lostDatenbankbesitzer %s hat Segmente in Tablespaces SYSTEM/SYSAUX und in einem Benutzer-Tablespaces - Segmente in System-Tablespaces werden verloren gehenAll user tablespaces are emptyAlle Benutzer-Tablespaces sind leerTable %s.%s in tablespace SYSTEM/SYSAUX has the same name as a table in a user tablespace - table in system tablespace will be lostTabelle %s.%s in System-Tablespace SYSTEM/SYSAUX hat denselben Namen wie eine Tabelle in einem Benutzer-Tablespaces - Tabelle in System-Tablespace werden verloren gehenTrace message from %s: %sTrace-Meldung von %s: %sError message from %s: %sFehlermeldung von %s: %sInitialization of license key library %s failed, return code %dInitialisierung der Lizenzschluessel-Bibliothek %s gescheitert, Return-Code %dChecking of license key using library %s failed at location %s-%d, return code %dUeberpruefung des Lizenzschluessels mittels Bibliothek %s gescheitert an der Stelle %s-%d, Return-Code %dChecking SAP license failed at location %s-%dUeberpruefung der SAP-Lizenz gescheitert an der Stelle %s-%dKilling Oracle sessions...Oracle-Sessions werden abgebrochen...Oracle automatic statistics collection job %s deactivatedOracle automatic jobs deactivated successfullyAutomatischer Oracle Statistiksammlung-Job %s deaktiviertAutomatischer Oracle Jobs erfolgreich deaktiviertDeletion of statistics failed for %d/%d tables/indexesLoeschung von Statistiken gescheitert fuer %d/%d Tabellen/IndizesCollection of statistics failed for %d/%d tables/indexesSammlung von Statistiken gescheitert fuer %d/%d Tabellen/IndizesValidation of structure failed for %d/%d/%d tables/indexes/clustersValidierung von Strukturen gescheitert fuer %d/%d/%d Tabellen/Indizes/ClustersOracle automatic statistics collection job %s is active - it can conflict with BRCONNECT statistics runsAutomatischer Oracle Statistiksammlung-Job %s ist aktiv - er kann mit BRCONNECT-Statistiklaeufen in Konflikt geratenStarting collection of Oracle dictionary statistics...Deleting Oracle dictionary statistics...Starten der Sammlung von Oracle-Dictionary-Statistiken...Loeschen von Oracle-Dictionary-Statistiken...Collection of Oracle dictionary statistics completedDeletion of Oracle dictionary statistics completedSammlung von Oracle-Dictionary-Statistiken beendetLoeschung von Oracle-Dictionary-Statistiken beendetCollection of Oracle dictionary statistics failedDeletion of Oracle dictionary statistics failedSammlung von Oracle-Dictionary-Statistiken gescheitertLoeschung von Oracle-Dictionary-Statistiken gescheitertOracle dictionary statistics will be collected with default optionsOracle-Dictionary-Statistiken werden mit Standardoptionen gesammeltStatistics have been locked for table %s.%sStatistiken wurden gesperrt fuer Tabelle %s.%sStatistics have been unlocked for table %s.%sStatistiken wurden entsperrt fuer Tabelle %s.%sLocking of statistics failed for table %s.%sUnlocking of statistics failed for table %s.%sSperren von Statistiken gescheitert fuer Tabelle %s.%sEntsperren von Statistiken gescheitert fuer Tabelle %s.%sTable data class (tabart) '%s' from %s.%s not found in %s.%sTabellen-Datenart (Tabart) '%s' aus %s.%s nicht gefunden in %s.%sTable data class (tabart) '%s' of table %s.%s not found in %s.%sTabellen-Datenart (Tabart) '%s' von Tabelle %s.%s nicht gefunden in %s.%sTable %s.%s is a queue tableTabelle %s.%s ist eine Queue-TabelleTable %s.%s is a nested tableTable %s.%s has a nested sub-tableTabelle %s.%s ist eine Nested-TabelleTabelle %s.%s hat eine Nested-UntertabelleCompressed table %s.%s has no unique indexKomprimierte Tabelle %s.%s hat keinen Unique-IndexTable %s.%s has a domain index %s.%sTabelle %s.%s hat einen Domain-Index %s.%sSAP table data class (tabart) '%s' of owner %s is referencing the dropped tablespace %sSAP-Tabellen-Datenart (Tabart) '%s' von Besitzer %s referenziert den geloeschten Tablespace %sParameter '%s' not set for local split mirrorParameter '%s' nicht gesetzt fuer lokalen Split-MirrorParameter '%s' must be set to a value different from sapdata home for local split mirrorParameter '%s' muss fuer lokalen Split-Mirror auf ein Wert unterschiedlich von Sapdata-Home gesetzt werdenPartitioned table %s.%s has no partitions - ignoring partitioning for this tablePartitionierte Tabelle %s.%s hat keine Partitionen - Partitionierung wird fuer diese Tabelle ignoriertPartitioned index %s.%s has no partitions - ignoring partitioning for this indexPartitionierter Index %s.%s hat keine Partitionen - Partitionierung wird fuer diesen Index ignoriertFiles larger or equal %d MB (e.g. %s) cannot be saved by %s - use %s instead (see SAP note 20577)Dateien groesser oder gleich %d MB (z.B. %s) koennen nicht mit %s gesichert werden - benutzen Sie %s stattdessen (siehe SAP-Hinweis 20577)Table %s.%s has '%s' statusTabelle %s.%s hat '%s' StatusDatabase will be opened now to switch to the next online redolog filesDatenbank wird jetzt geoeffnet, um zu naechsten Online-Redolog-Dateien umzuschaltenOriginal (current) control files will be copied back nowOriginal control files can be copied back now to recover information about archivelog filesOriginal-(current)-Steuerdateien werden jetzt zurueckkopiertOriginal-Steuerdateien koennen jetzt zurueckkopiert werden, um Informationen ueber Archivelog-Dateien zu rettenNo archivelog files found for applying for database instance %sKeine Archivelog-Dateien zum Einspielen fuer Datenbank-Instanz %s gefundenOwner %s already exists in databaseBesitzer %s existiert bereits in DatenbankDatabase owner %s created successfullyDatenbankbesitzer %s erfolgreich angelegtCreating database owner %s failedAnlegen von Datenbankbesitzer %s gescheitertDatabase owner %s dropped successfullyDatenbankbesitzer %s erfolgreich geloeschtDropping database owner %s failedLoeschen von Datenbankbesitzer %s gescheitertPassword deleted successfully from table %s.SAPUSER for user %sKennwort erfolgreich geloescht aus Tabelle %s.SAPUSER fuer Benutzer %sDeletion of password from table SAPUSER failed for user %sLoeschen von Kennwort aus Tabelle SAPUSER gescheitert fuer Benutzer %sOnline backup of standby database supported only with RMANOnline-Sicherung von Standby-Datenbank unterstuetzt nur mit RMANArchivelog files were applied to standby database during an offline backup with RMANArchivelog-Dateien wurden waehrend einer Offline-Sicherung mit RMAN in Standby-Datenbank eingespieltProbably archivelog files saved by RMAN need to be restored and applied - control files to be restored must contain information about their backupsArchivelog files saved by RMAN need to be restored and applied now - control files must contain information about their backupsWahrscheinlich werden durch RMAN gesicherte Archivelog-Dateien fuer Zurueckladen und Einspielen gebraucht - zurueckzuladende Steuerdateien muessen Informationen ueber ihre Sicherungen beinhaltenDurch RMAN gesicherte Archivelog-Dateien werden jetzt zurueckladen und eingespielt - Steuerdateien muessen Informationen ueber ihre Sicherungen beinhaltenControl file saved in the selected backup probably does not contain this information - you can restore it from the last BRARCHIVE backupStandby control file restored from the selected backup probably does not contain this information - you can restore it from the last BRARCHIVE standby backupDie Steuerdatei in der ausgewaehlten Sicherung beinhaltet diese Informationen wahrscheinlich nicht - Sie koennen sie von der letzten BRARCHIVE-Sicherung zurueckladenDie aus der ausgewaehlten Sicherung zurueckgeladene Standby-Steuerdatei beinhaltet diese Informationen wahrscheinlich nicht - Sie koennen sie von der letzten BRARCHIVE-Standby-Sicherung zurueckladenRestore of control files from the last BRARCHIVE backup can be done now using disaster recovery function of BRRECOVERRestore of control files from the BRBACKUP backup %s.%s can be done nowZurueckladen von Steuerdateien von der letzten BRARCHIVE-Sicherung kann jetzt mittels der Disaster-Recovery Funktion von BRRECOVER durchgefuehrt werdenZurueckladen von Steuerdateien von der BRBACKUP-Sicherung %s.%s kann jetzt durchgefuehrt werdenControl files will be restored from the selected BRBACKUP backup %s.%s if you are not going to restore them from the last BRARCHIVE backupControl files will be restored from the selected BRBACKUP backup %s.%s if you are not going to restore them from the subsequent BRBACKUP backupSteuerdateien werden von der ausgewaehlten BRBACKUP-Sicherung %s.%s zurueckgeladen, wenn Sie sie nicht von der letzten BRARCHIVE-Sicherung zurueckladen wollenSteuerdateien werden von der ausgewaehlten BRBACKUP-Sicherung %s.%s zurueckgeladen, wenn Sie sie nicht von der nachfolgenden BRBACKUP-Sicherung zurueckladen wollenDatabase file '%s' has not been created yet in standby databaseDatenbankdatei '%s' ist noch nicht angelegt worden in Standby-DatenbankYou can use option '-b2' to restore profiles and log files from a BACKINT backupSie koennen Option '-b2' benutzen, um Profile und Protokolle von einer BACKINT-Sicherung zurueckzuladenProbably the password for the user '%s' must be also changed in SAP secure storageWahrscheinlich muss das Kennwort fuer den Benutzer '%s' auch in SAP Secure-Storage geaendert werdenSRVCTL call for database %s failedSRVCTL-Aufruf fuer Datenbank %s gescheitertConfiguration of database services:Konfiguration von Datenbank-Services:Status of database services:Staus von Datenbank-Services:Database service(s) %s will be started now on instance %sDatabase service(s) %s can be also started now on instance %sDatenbank-Service(s) %s wird/werden jetzt gestartet auf Instanz %sDatenbank-Service(s) %s kann/koennen jetzt auch gestartet werden auf Instanz %sStarting of database service %s on instance %s ...Starting of database services %s on instance %s ...Starten von Datenbank-Service %s auf Instanz %s ...Starten von Datenbank-Services %s auf Instanz %s ...Database service %s started successfully on instance %sDatabase services %s started successfully on instance %sDatenbank-Service %s erfolgreich gestartet auf Instanz %sDatenbank-Services %s erfolgreich gestartet auf Instanz %sStarting of database service %s on instance %s failedStarting of database services %s on instance %s failedStarten von Datenbank-Service %s auf Instanz %s gescheitertStarten von Datenbank-Services %s auf Instanz %s gescheitertDatabase service %s will be stopped now on instance %sDatabase services %s will be stopped now on instance %sDatenbank-Service %s wird jetzt gestoppt auf Instanz %sDatenbank-Services %s auf wird jetzt gestoppt Instanz %sStopping of database service %s on instance %s ...Stopping of database services %s on instance %s ...Stoppen von Datenbank-Service %s auf Instanz %s ...Stoppen von Datenbank-Services %s auf Instanz %s ...Database service %s stopped successfully on instance %sDatabase services %s stopped successfully on instance %sDatenbank-Service %s erfolgreich gestoppt auf Instanz %sDatenbank-Services %s erfolgreich gestoppt auf Instanz %sStopping of database service %s on instance %s failedStopping of database services %s on instance %s failedStoppen von Datenbank-Service %s auf Instanz %s gescheitertStoppen von Datenbank-Services %s auf Instanz %s gescheitertProcedure/function '%s.%s' created successfullyProcedure/function '%s.%s' updated successfullyProzedur/Funktion '%s.%s' erfolgreich angelegtProzedur/Funktion '%s.%s' erfolgreich aktualisiertCreating procedure/function '%s.%s' failedAnlegen von Prozedur/Funktion '%s.%s' gescheitertChecking version of procedure/function '%s.%s' failedUeberpruefung der Version von Prozedur/Funktion '%s.%s' gescheitertNo appropriate owner found for function '%s'No appropriate owner found for action '%s'Kein passender Besitzer fuer Funktion '%s' gefundenKein passender Besitzer fuer Aktion '%s' gefundenNext offline redolog file %s is already available in archive directoryNaechste Offline-Redolog-Datei %s ist bereits vorhanden im ArchivierungsverzeichnisThis backup is a copy of disk backup: %sDiese Sicherung ist eine Kopie von Plattensicherung: %sArchivelog file with sequence number %d not found in %sArchivelog file with sequence number %d of thread %d not found in %sArchivelog-Datei mit Sequenznummer %d nicht gefunden in %sArchivelog-Datei mit Sequenznummer %d von Thread %d nicht gefunden in %sControl file saved in the selected backup probably does not contain this information - you can restore it from the subsequent BRBACKUP backup %s.%sStandby control file restored from the selected backup probably does not contain this information - you can restore it from the subsequent BRBACKUP standby backup %s.%sDie Steuerdatei in der ausgewaehlten Sicherung beinhaltet diese Informationen wahrscheinlich nicht - Sie koennen sie von der nachfolgenden BRBACKUP-Sicherung %s.%s zurueckladenDie aus der ausgewaehlten Sicherung zurueckgeladene Standby-Steuerdatei beinhaltet diese Informationen wahrscheinlich nicht - Sie koennen sie von der nachfolgenden BRBACKUP-Standby-Sicherung %s.%s zurueckladenOnly 'offline' or 'online_cons' backups can be used for database resetNur 'offline' oder 'online_cons' Sicherungen koennen fuer Zuruecksetzen der Datenbank benutzt werdenCaution: Point-in-time recovery may cause inconsistencies in SAP data and between SAP systems (see SAP note 434645)Caution: Database reset may cause inconsistencies in SAP data and between SAP systems (see SAP note 434645)Achtung: Point-in-Time-Recovery kann Inkonsistenzen in SAP-Daten und zwischen SAP-Systemen verursachen (siehe SAP-Hinweis 434645)Achtung: Zuruecksetzen der Datenbank kann Inkonsistenzen in SAP-Daten und zwischen SAP-Systemen verursachen (siehe SAP-Hinweis 434645)Executing pre-split command '%s'...Ausfuehrung von Pre-Split-Kommando '%s'...Pre-split command '%s' executed successfullyPre-Split-Kommando '%s' erfolgreich ausgefuehrtExecution of pre-split command '%s' failedAusfuehrung von Pre-Split-Kommando '%s' gescheitertExecuting post-split command '%s'...Ausfuehrung von Post-Split-Kommando '%s'...Post-split command '%s' executed successfullyPost-Split-Kommando '%s' erfolgreich ausgefuehrtExecution of post-split command '%s' failedAusfuehrung von Post-Split-Kommando '%s' gescheitertLog file '%s' not foundProtokolldatei '%s' nicht gefundenRMAN archivelog backup cross-check will be executed nowRMAN archivelog backup check-delete will be executed nowRMAN Archivelog-Backup-Cross-Check wird jetzt ausgefuehrtRMAN Archivelog-Backup-Check-Delete wird jetzt ausgefuehrtRemapping of disk group '%s' during restore not supported for backup of disk backupRemapping of disk group '%s' during restore not supported for backup of disk backup %s.%sAbbildung von Disk-Gruppe '%s' bei Restore nicht unterstuetzt fuer Sicherung einer PlattensicherungAbbildung von Disk-Gruppe '%s' bei Restore nicht unterstuetzt fuer Sicherung einer Plattensicherung %s.%sUnexpected message '%s' sent by backup utilityUnerwartete Meldung '%s' gesendet von Backup-UtilityRemapping of disk drive '%s' during restore not supported for backup of disk backupRemapping of disk drive '%s' during restore not supported for backup of disk backup %s.%sAbbildung von Plattenlaufwerk '%s' bei Restore nicht unterstuetzt fuer Sicherung einer PlattensicherungAbbildung von Plattenlaufwerk '%s' bei Restore nicht unterstuetzt fuer Sicherung einer Plattensicherung %s.%sNo read only tablespaces found for backupKeine Read-Only-Tablespaces zum Sichern gefundenDatabase file '%s' was moved/renamed to '%s' during or after the selected backupDatabase file '%s' was moved/renamed to '%s' during or after the selected backupsDatenbankdatei '%s' wurde verschoben/umbenannt auf '%s' waehrend oder nach der ausgewaehlten SicherungDatenbankdatei '%s' wurde verschoben/umbenannt auf '%s' waehrend oder nach den ausgewaehlten SicherungenCorresponding file will be moved/renamed after the restoreCorresponding files will be moved/renamed after the restoreEntsprechende Datei wird nach dem Restore verschoben/umbenanntEntsprechende Dateien werden nach dem Restore verschoben/umbenanntDatabase file '%s' will be moved/renamed to '%s' nowDatenbankdatei '%s' wird jetzt verschoben/umbenannt auf '%s'Block change tracking disabled for database %sBlock-Change-Tracking ausgeschaltet fuer Datenbank %sBlock change tracking enabled for database %s using file %sBlock-Change-Tracking eingeschaltet fuer Datenbank %s unter Verwendung von Datei %sVerification option '%s' ignored for '%s' - RMAN save sets will be always verified by RMANVerifikationsoption '%s' ignoriert fuer '%s' - RMAN-Savesets werden immer durch RMAN verifiziertVerification option '%s' ignored for '%s' - archivelog files will automatically validated during the backup by RMANVerifikationsoption '%s' ignoriert fuer '%s' - Archivelog-Dateien werden waehrend der Sicherung durch RMAN automatisch validiertRMAN prepared for backupRMAN prepared for verificationRMAN fuer Sicherung vorbereitetRMAN fuer Verifikation vorbereitetRMAN will be used for verificationRMAN will be used for verification before backupRMAN wird fuer die Verifikation benutztRMAN wird fuer die Verifikation vor Sicherung benutztOnly database verification using RMAN - no backupOnly redolog verification using RMAN - no backup/deletionNur Datenbankverifikation mittels RMAN - keine SicherungNur Redolog-Verifikation mittels RMAN - keine Sicherung/Loeschung%s is not a data or redo file - its backup cannot be verificated using RMAN%s is not a data or redo file - it cannot be verificated using RMAN%s ist keine Daten- oder Redo-Datei - ihre Sicherung kann mittels RMAN nicht verifiziert werden%s ist keine Daten- oder Redo-Datei - sie kann mittels RMAN nicht verifiziert werdenStarting RMAN archivelog backup cross-check for device type '%s'...Starting RMAN archivelog backup check-delete for device type '%s'...Starten von RMAN Archivelog-Backup-Cross-Check fuer Geraetetyp '%s'...Starten von RMAN Archivelog-Backup-Check-Delete fuer Geraetetyp '%s'...%d archivelog file marked as deleted by RMAN%d archivelog files marked as deleted by RMAN%d Archivelog-Datei markiert als geloescht von RMAN%d Archivelog-Dateien markiert als geloescht von RMANRMAN archivelog backup cross-check executed successfullyRMAN archivelog backup check-delete executed successfullyRMAN Archivelog-Backup-Cross-Check erfogreich ausgefuehrtRMAN Archivelog-Backup-Check-Delete erfogreich ausgefuehrtFiles will be compressed by RMANDateien werden von RMAN komprimiertFiles will be decompressed by RMANDateien werden von RMAN dekomprimiertRMAN compression not supported for '%s'RMAN compression not supported for '%s', you can use '%s' insteadRMAN-Komprimierung nicht unterstuetzt fuer '%s'RMAN-Komprimierung nicht unterstuetzt fuer '%s', Sie koennen stattdessen '%s' benutzenDisk backup directory %s not found - ignoring backup %sPlattensicherungsverzeichnis %s nicht gefunden - Sicherung %s wird ignoriertCreating of control files with new database name in unattended mode is supported only if spfile is usedAnlegen von Steuerdateien mit neuem Datenbanknamen ist nur unterstuetzt, wenn Spfile benutzt wirdDummy online redolog file '%s' createdDummy-Online-Redolog-Datei '%s' angelegtDummy online redolog file '%s' droppedDummy-Online-Redolog-Datei '%s' verworfenNew control files can be created nowNew control files will be created now using SQL script %sNeue Steuerdateien koennen jetzt erstellt werdenNeue Steuerdateien werden jetzt erstellt mittels SQL-Skript %sNew control files created successfullyNeue Steuerdateien erfolgreich erstelltCreation of new control files failedErstellung von neue Steuerdateien gescheitertPlease set Oracle parameter db_name to '%s' in %s nowBitte setzen Sie jetzt Oracle-Parameter db_name auf '%s' in %sStarting RMAN database backup cross-check for device type '%s'...Starting RMAN database backup check-delete for device type '%s'...Starten von RMAN Datenbank-Backup-Cross-Check fuer Geraetetyp '%s'...Starten von RMAN Datenbank-Backup-Check-Delete fuer Geraetetyp '%s'...%d database backup file/piece or file copy marked as deleted by RMAN%d database backup files/pieces or file copies marked as deleted by RMAN%d Datenbank-Backup-Datei/-Teil oder Dateikopie markiert als geloescht von RMAN%d Datenbank-Backup-Dateien/-Teile oder Dateikopien markiert als geloescht von RMANRMAN database backup cross-check executed successfullyRMAN database backup check-delete executed successfullyRMAN Datenbank-Backup-Cross-Check erfogreich ausgefuehrtRMAN Datenbank-Backup-Check-Delete erfogreich ausgefuehrt%d file found for conversion, size %4.3f MB%d files found for conversion, total size %4.3f MB%d Datei zur Konvertierung gefunden, Groesse %4.3f MB%d Dateien zur Konvertierung gefunden, Gesamtgroesse %4.3f MBNo files found for conversionKeine Dateien zur Konvertierung gefundenConverting of database file %s to %s using RMAN...Konvertieren der Datenbankdatei %s auf %s mittels RMAN...Conversion of database file %s to %s using RMAN successfulKonvertierung der Datenbankdatei %s auf %s mittels RMAN erfolgreichConversion of database file %s using RMAN failedKonvertierung der Datenbankdatei %s mittels RMAN gescheitertDatabase file %s converted successfullyDatenbankdatei %s erfolgreich konvertiertConversion of database file %s failedKonvertierung der Datenbankdatei %s gescheitertEnter password for RMAN encryption (max. %d ASCII chars):Reenter password for RMAN encryption (max. %d ASCII chars):Eingabe Kennwort fuer RMAN-Verschluesselung (max. %d ASCII-Zeichen):Wiedereingabe Kennwort fuer RMAN-Verschluesselung (max. %d ASCII-Zeichen):Empty password has been enteredLeeres Kennwort ist eingegeben wordenBlock change tracking file %s deletedBlock-Change-Tracking-Datei %s geloeschtExecuting pre-shut command '%s'...Ausfuehrung von Pre-Shut-Kommando '%s'...Pre-shut command '%s' executed successfullyPre-Shut-Kommando '%s' erfolgreich ausgefuehrtExecution of pre-shut command '%s' failedAusfuehrung von Pre-Shut-Kommando '%s' gescheitertExecuting post-shut command '%s'...Ausfuehrung von Post-Shut-Kommando '%s'...Post-shut command '%s' executed successfullyPost-Shut-Kommando '%s' erfolgreich ausgefuehrtExecution of post-shut command '%s' failedAusfuehrung von Post-Shut-Kommando '%s' gescheitert%d archivelog backup file/piece or file copy marked as deleted by RMAN%d archivelog backup files/pieces or file copies marked as deleted by RMAN%d Archivelog-Backup-Datei/-Teil oder Dateikopie markiert als geloescht von RMAN%d Archivelog-Backup-Dateien/-Teile oder Dateikopien markiert als geloescht von RMANRMAN cannot be used for backup due to stopped database instance %sRMAN cannot be used for verification due to stopped database instance %sRMAN kann fuer Sicherung wegen gestoppter Datenbankinstanz %s nicht benutzt werdenRMAN kann fuer Verifikation wegen gestoppter Datenbankinstanz %s nicht benutzt werdenComparing file %sVergleichen der Datei %swith %s ...mit %s ...Starting '%s' table moving...Starting '%s' table partition moving...Starten der '%s'-Tabellen-Verschiebung...Starten der '%s'-Tabellen-Partition-Verschiebung...Number of tables moved successfully: %dNumber of tables/partitions moved successfully: %d/%dAnzahl der erfolgreich verschobenen Tabellen: %dAnzahl der erfolgreich verschobenen Tabellen/Partitionen: %d/%dMove failed for %d table(n)Move failed for %d/%d tables/partitionsVerschiebung gescheitert fuer %d Tabelle(n)Verschiebung gescheitert fuer %d/%d Tabellen/PartitionenMove failed for all tablesMove failed for all table partitionsVerschiebung gescheitert fuer alle TabellenVerschiebung gescheitert fuer alle Tabellen-PartitionenStarting '%s' moving of table %s.%s ...Starting '%s' moving of table partition %s.%s.%s ...'%s'-Verschiebung der Tabelle %s.%s wird gestartet...'%s'-Verschiebung der Tabellen-Partition %s.%s.%s wird gestartet...Table %s.%s moved successfullyTable partition %s.%s.%s moved successfullyTabelle %s.%s erfolgreich verschobenTabellen-Partition %s.%s.%s erfolgreich verschobenMove of table %s.%s failedMove of table partition %s.%s.%s failedVerschiebung der Tabelle %s.%s gescheitertVerschiebung der Tabellen-Partition %s.%s.%s gescheitertTables with the longest duration of moving for owner %sTabellen mit laengster Dauer der Verschiebung fuer Besitzer %sEmpty user name has been enteredLeerer Benutzername ist eingegeben wordenTable %s.%s is already partitionedTabelle %s.%s ist bereits partitioniertExport parameter file %s createdExport-Parameterdatei %s angelegtImport parameter file %s createdImport-Parameterdatei %s angelegt%d table missing in export created by %s utility%d tables missing in export created by %s utility%d Tabelle fehlt im Export erstellt von %s-Utility%d Tabellen fehlen im Export erstellt von %s-UtilityTable %s.%s will be skipped for export with %s utilityTabelle %s.%s wird uebersprungen fuer Export mit %s-UtilityNumber of tables selected/skipped for export with %s utility: %d/%dAnzahl der Tabellen ausgewaehlt/uebersprungen fuer Export mit %s-Utility: %d/%dAll tables have been skipped for export with %s utilityAlle Tabellen wurden fuer Export mit %s-Utility uebersprungenOPS$ and SYS user not supported for a consistent exportOPS$- und SYS-Benutzer nicht unterstuetzt fuer einen konsistenten ExportNumber of tables / statistics exports processed: %d/%dAnzahl der verarbeiteten Tabellen/Statistik-Exports: %d/%dValidation not allowed for path table %s.%sValidierung nicht erlaubt fuer Path-Tabelle %s.%sValidation not supported for external table %s.%sValidierung nicht unterstuetzt fuer externe Tabelle %s.%sNumber of tables for which statistics were successfully managed: %dAnzahl der Tabellen deren Statistiken erfolgreich verwaltet wurden: %dManage statistics failed for %d tableManage statistics failed for %d tablesStatistikverwaltung gescheitert fuer %d TabelleStatistikverwaltung gescheitert fuer %d TabellenManage statistics failed for all tablesStatistikverwaltung gescheitert fuer alle TabellenManage statistics was skipped for all tablesStatistikverwaltung wurde uebersprungen fuer alle TabellenNo statistics export found for action '%s'No appropriate statistics export found for action '%s'Kein Statistik-Export fuer Aktion '%s' gefundenKein passender Statistik-Export fuer Aktion '%s' gefundenStatistics of table %s.%s exported successfully with Id '%s'Statistiken von Tabelle %s.%s erfolgreich exportiert mit Id '%s'Statistics export failed for table %s.%sStatistik-Export gescheitert fuer Tabelle %s.%sTable %s.%s has no statistics - it will be skipped for export of statisticsTabelle %s.%s hat keine Statistiken - sie wird uebersprungen fuer Export von StatistikenAll tables have been skipped for export of statisticsAlle Tabellen wurden fuer Export von Statistiken uebersprungenNumber of tables selected/skipped for export of statistics: %d/%dAnzahl der Tabellen ausgewaehlt/uebersprungen fuer Export von Statistiken: %d/%dAll tables selected for export of statistics must belong to a single database ownerAlle zum Export von Statistiken ausgewaehlten Tabellen muessen einem einzelnen Datenbankbesitzer gehoerenStatistics of table %s.%s exported in run %s.%s with Id '%s' imported successfullyStatistiken von Tabelle %s.%s exportiert im Lauf %s.%s mit Id '%s' erfolgreich importiertStatistics import failed for table %s.%sStatistik-Import gescheitert fuer Tabelle %s.%sStatistics of table %s.%s are locked - but they can be imported despite of thisStatistiken von Tabelle %s.%s sind gesperrt - sie koennen aber trotzdem importiert werdenStatistics of table %s.%s restored successfully to the state of %sStatistiken von Tabelle %s.%s erfolgreich zurueckgesetzt auf den Stand von %sStatistics restore failed for table %s.%sStatistikzuruecksetzung gescheitert fuer Tabelle %s.%sStatistics of table %s.%s are locked - but they can be deleted despite of thisStatistiken von Tabelle %s.%s sind gesperrt - sie koennen aber trotzdem geloescht werdenStatistics of table %s.%s are locked - but they can be restored despite of thisStatistiken von Tabelle %s.%s sind gesperrt - sie koennen aber trotzdem zurueckgesetzt werdenStatistics export of table %s.%s of run %s.%s with Id '%s' deleted successfullyStatistik-Export von Tabelle %s.%s von Lauf %s.%s mit Id '%s' erfolgreich geloeschtDeletion of statistics export for table %s.%s failedLoeschung von Statistik-Export fuer Tabelle %s.%s gescheitertStatistics export of table %s.%s of run %s.%s with Id '%s' not foundStatistik-Export von Tabelle %s.%s von Lauf %s.%s mit Id '%s' nicht gefundenStatistics export of table %s.%s of run %s.%s with Id '%s' is already deletedStatistics export of run %s.%s with Id '%s' is already completely deletedStatistik-Export von Tabelle %s.%s von Lauf %s.%s mit Id '%s' ist bereits geloeschtStatistik-Export von Lauf %s.%s mit Id '%s' ist bereits komplett geloeschtAll statistics exports have been skipped for delete actionAlle Statistik-Exports wurden fuer Loeschaktion uebersprungenIgnore flag can be set now for %s.%s in DBSTATCIgnore flag can be reset now for %s.%s in DBSTATCIgnore-Flagge kann jetzt gesetzt werden fuer %s.%s in DBSTATCIgnore-Flagge kann jetzt zurueckgesetzt werden fuer %s.%s in DBSTATCIgnore flag has been set for %s.%s in DBSTATCIgnore flag has been reset for %s.%s in DBSTATCIgnore-Flagge ist gesetzt worden fuer %s.%s in DBSTATCIgnore-Flagge ist zurueckgesetzt worden fuer %s.%s in DBSTATCNumber of chained rows found in table %s.%s: %1.0f/%1.0fNumber of chained rows found in table partition %s.%s.%s: %1.0f/%1.0fAnzahl von verketteten Reihen gefunden in Tabelle %s.%s: %1.0f/%1.0fAnzahl von verketteten Reihen gefunden in Tabellen-Partition %s.%s.%s: %1.0f/%1.0fNumber of tables with chained rows: %dNumber of tables/partitions with chained rows: %d/%dAnzahl von Tabellen mit verketteten Reihen: %dAnzahl von Tabellen/Partitionen mit verketteten Reihen: %d/%dNumber of tables selected/skipped for creation of DDL statements: %d/%dNumber of table partitions selected/skipped for creation of DDL statements: %d/%dAnzahl der Tabellen ausgewaehlt/uebersprungen fuer Erstellung der DDL-Anweisungen: %d/%dAnzahl der Tabellen-Partitionen ausgewaehlt/uebersprungen fuer Erstellung der DDL-Anweisungen: %d/%dCreation of DDL statements failed for all tablesCreation of DDL statements failed for all table partitionsErstellung der DDL-Anweisungen gescheitert fuer alle TabellenErstellung der DDL-Anweisungen gescheitert fuer alle Tabellen-PartitionenTable selected to collect statistics after a DDL action (e.g. reorganization): %s.%s%sTabelle bestimmt zur Sammlung der Statistiken nach einer DDL-Aktion (z.B. Reorganisation): %s.%s%sTable %s found in %s.%s was not selected for reorganizationTabelle %s gefunden in %s.%s wurde fuer Reorganisation nicht ausgewaehltNo objects found in %s.%s for DDL generation ID '%s'Keine Objekte gefunden in %s.%s fuer DDL-Generations-ID '%s'Online redefinition of table %s.%s has been suspended before the finish actionOnline-Redefinition der Tabelle %s.%s wurde vor der Finish-Aktion angehaltenOnline redefinition of table %s.%s resumedOnline-Redefinition der Tabelle %s.%s wieder aufgenommenTable %s.%s is already index-organizedTabelle %s.%s ist bereits index-organisiertTable %s.%s is already a heap tableTabelle %s.%s ist bereits eine Heap-TabelleIOT for table %s.%s will be created during reorganization based on index %sIOT fuer Tabelle %s.%s wird waehrend der Reorganisation basierend auf Index %s erstelltIOT index '%s' not found for table %s.%sIOT-Index '%s' nicht gefunden fuer Tabelle %s.%sSelected IOT index %s.%s is not a unique indexAusgewaehlter IOT-Index %s.%s ist kein Unique-IndexStatistics collected for %d individual partition of %d partitioned tableStatistics collected for %d individual partitions of %d partitioned tablesStatistiken gesammelt fuer %d einzelne Partition von %d partitionierten TabelleStatistiken gesammelt fuer %d einzelne Partitionen von %d partitionierten TabellenCollection of statistics failed for %d partitioned table with %d effected partition(s)Collection of statistics failed for %d partitioned tables with %d effected partition(s)Sammlung von Statistiken gescheitert fuer %d partitionierte Tabelle mit %d betroffenen Partition(en)Sammlung von Statistiken gescheitert fuer %d partitionierte Tabellen mit %d betroffenen Partition(en)Statistics exported for index %s.%sStatistiken exportiert fuer Index %s.%sStatistics imported for index %s.%sStatistiken importiert fuer Index %s.%sAll tables/indexes have been skipped for update statisticsAll tables/indexes have been skipped for validation of structureAlle Tabellen/Indizes wurden fuer Aktualisierung der Statistiken uebersprungenAlle Tabellen/Indizes wurden fuer Validierung von Strukturen uebersprungen'complete' option with value '%d' set - validation of structure can be skipped'complete' option with value '%s' set - validation of structure can be skipped'complete'-Option mit Wert '%d' gesetzt - Validierung von Strukturen kann uebersprungen werden'complete'-Option mit Wert '%s' gesetzt - Validierung von Strukturen kann uebersprungen werdenNumber of tables that will be skipped for validation due to the 'complete' option: %dAnzahl der Tabellen, die aufgrund der 'complete'-Option fuer Validierung uebersprungen werden: %dNumber of indexes that will be skipped for validation due to the 'complete' option: %dAnzahl der Indizes, die aufgrund der 'complete'-Option fuer Validierung uebersprungen werden: %dStructure validated successfully for index %s.%s, number of columns to compress: %dStructure validated successfully for index %s.%s, number of columns to compress: %d (savings %d%%)Struktur erfolgreich validiert fuer Index %s.%s, Anzahl der zu komprimierenden Spalten: %dStruktur erfolgreich validiert fuer Index %s.%s, Anzahl der zu komprimierenden Spalten: %d (Ersparnis %d%%)Option '%s' is not set for '%s'Option '%s' ist nicht gesetzt fuer '%s'Input value not in (%s)Eingabewert nicht in (%s)Files will be saved by backup utility at volume levelDateien werden gesichert von Backup-Utility auf Volume-EbeneAt least one database file must be selected for processing by backup utility at volume levelAt least one database file should be selected for processing by backup utility at volume levelWenigstens eine Datenbankdatei muss fuer Verarbeitung ausgewaehlt werden bei Backup-Utility auf Volume-EbeneWenigstens eine Datenbankdatei sollte fuer Verarbeitung ausgewaehlt werden bei Backup-Utility auf Volume-EbeneDatabase file '%s' must be located in a sapdata directory if parameter %s is set to '%s'Database file '%s' must be located in a sapraw directory if parameter %s is set to '%s'Datenbankdatei '%s' muss sich in einem sapdata-Verzeichnis befinden, wenn Parameter %s auf '%s' gesetzt istDatenbankdatei '%s' muss sich in einem sapraw-Verzeichnis befinden, wenn Parameter %s auf '%s' gesetzt istRestore of file %s with backup utility at volume level to different location not possible if parameter %s is set to '%s'Zurueckladen der Datei %s mit Backup-Utility auf Volume-Ebene in andere Lokation is nicht moeglich, wenn Parameter %s auf '%s' gesetzt istVerification with backup utility at volume level not possible if parameter %s is set to '%s'Verifikation mit Backup-Utility auf Volume-Ebene is nicht moeglich, wenn Parameter %s auf '%s' gesetzt istBackup '%s' of file %s mounted by backup utility in %sBackup '%s' of file %s mounted by backup utility in %s from volume %sSicherung '%s' der Datei %s montiert von Backup-Utility in %sSicherung '%s' der Datei %s montiert von Backup-Utility in %s vom Volume %s%d of %d file mounted by backup utility%d of %d files mounted by backup utility%d von %d Datei von Backup-Utility montiert%d von %d Dateien von Backup-Utility montiertBackup utility has reported an error while mounting the backup of file %sBackup-Utility hat beim Montieren der Sicherung der Datei %s einen Fehler gemeldetUnknown file '%s' reported as mounted by backup utilityUnbekannte Datei '%s' gemeldet als montiert von Backup-UtilityBackup '%s' of file %s dismounted by backup utility from %sSicherung '%s' der Datei %s demontiert von Backup-Utility von %s%d of %d file dismounted by backup utility%d of %d files dismounted by backup utility%d von %d Datei von Backup-Utility demontiert%d von %d Dateien von Backup-Utility demontiertBackup utility has reported an error while dismounting the backup of file %sBackup-Utility hat beim Demontieren der Sicherung der Datei %s einen Fehler gemeldetUnknown file '%s' reported as dismounted by backup utilityUnbekannte Datei '%s' gemeldet als demontiert von Backup-UtilityNo subdirectory name or name longer than %d charactersKein Unterverzeichnisname oder Name laenger als %d ZeichenBackup %s.%s with BACKINT utility at volume level can be selected only as first backupSicherung %s.%s mit BACKINT-Utility auf Volume-Ebene kann nur als erste Sicherung ausgewaehlt werdenNon-database file '%s' found by backup utility on database disk volumeNichtdatenbankdatei '%s' von Backup-Utility auf Datenbank-Plattendatentraeger gefundenAdditional file '%s' on selected disk volume was restored by backup utilityZusaetzliche Datei '%s' auf ausgewaehlten Plattendatentraeger wurde durch Backup-Utility zurueckgeladenAdditional file '%s' on selected disk volume was mounted by backup utility in %sZusaetzliche Datei '%s' auf ausgewaehlten Plattendatentraeger wurde von Backup-Utility montiert in %sAdditional file '%s' on selected disk volume was dismounted by backup utility from %sZusaetzliche Datei '%s' auf ausgewaehlten Plattendatentraeger wurde von Backup-Utility demontiert von %s%d backup confirmed by backup utility%d file backups confirmed by backup utility%d Dateisicherung von Backup-Utility bestaetigt%d Dateisicherungen von Backup-Utility bestaetigtBackup utility called successfully with warningsBackup-Utility erfolgreich mit Warnungen aufgerufenSPLITINT command called successfully with warningsSPLITINT-Kommando erfolgreich mit Warnungen aufgerufen%s profile '%s' must be located in '%s' for strict secure storage connection modus%s-Profil '%s' muss sich befinden in '%s' fuer strengen Secure-Storage-VerbindungsmodusIllegal %s log directory '%s' for strict secure storage connection modus - it must be '%s'Unerlaubtes %s-Protokollverzeichnis '%s' fuer strengen Secure-Storage-Verbindungsmodus - es muss '%s' seinSetting password for database user %s in secure storage %s ...Setting password for user %s in secure storage %s ...Setzen von Kennwort fuer Datenbank-Benutzer %s in Secure-Storage %s ...Setzen von Kennwort fuer Benutzer %s in Secure-Storage %s ...Password set successfully for database user %s in secure storage %sPassword set successfully for user %s in secure storage %sKennwort erfolgreich gesetzt fuer Datenbank-Benutzer %s in Secure-Storage %sKennwort erfolgreich gesetzt fuer Benutzer %s in Secure-Storage %sSetting password for user %s in secure storage failedSetting password for user %s in secure storage %s failedSetzen von Kennwort fuer Benutzer %s in Secure-Storage gescheitertSetzen von Kennwort fuer Benutzer %s in Secure-Storage %s gescheitertCalling a function of library %s failed at location %s-%d, return code %dCalling a function of library %s failed at location %s-%d, return value '%s'Aufruf einer Funktion von Bibliothek %s gescheitert an der Stelle %s-%d, Return-Code %dAufruf einer Funktion von Bibliothek %s gescheitert an der Stelle %s-%d, Return-Wert '%s'Getting BR*Tools user name/password from secure storage failedGetting BR*Tools user name/password from secure storage %s failedAuslesen von Namen/Kennwort von BR*Tools-Benutzer aus Secure-Storage %s gescheitertAuslesen von Namen/Kennwort von BR*Tools-Benutzer aus Secure-Storage gescheitertFunction '%s' not supported with secure storage database connectionFunction '%s' not supported with strict secure storage connection modeFunktion '%s' nicht unterstuetzt mit Secure-Storage-DatenbankverbindungFunktion '%s' nicht unterstuetzt mit strengem Secure-Storage-VerbindungsmodusCleaning up BR*Tools files on local host...Cleaning up BR*Tools files on host %s ...Aufraeumen der BR*Tools-Dateien auf lokalem Rechner...Aufraeumen der BR*Tools-Dateien auf Rechner %s ...Cleaning up Oracle traces on local host...Cleaning up Oracle traces on host %s ...Aufraeumen der Oracle-Traces auf lokalem Rechner...Aufraeumen der Oracle-Traces auf Rechner %s ...The password of database user %s expires in %d day(s)The password of database user %s expires at %sDas Kennword von Datenbankbenutzer %s laeuft in %d Tag(en) abDas Kennword von Datenbankbenutzer %s laeuft um %s abStrict secure storage connection mode activatedStrenger Secure-Storage-Verbindungsmodus aktiviertUnix group '%s' not foundLocal Windows group '%s' not foundUnix-Gruppe '%s' nicht gefundenLokale Windows-Gruppe '%s' nicht gefundenUnix user '%s' not found in group '%s'Windows user '%s' not found in local group '%s'Unix-Benutzer '%s' nicht gefunden in der Gruppe '%s'Windows-Benutzer '%s' nicht gefunden in der lokalen Gruppe '%s'%s is a symbolic link%s ist ein symbolischer LinkThis is a preliminary version of %s - it is valid only till %sDas ist eine Vorabversion von %s - sie ist nur bis %s gueltigThis preliminary version of %s is not valid anymoreDiese Vorabversion von %s ist nicht mehr gueltig%s started with function '%s' will be terminated now%s gestartet mit Funktion '%s' wird jetzt beendet%s started with function '%s' has been terminated%s gestartet mit Funktion '%s' wurde beendetTermination of %s started with function '%s' failedBeendung von %s gestartet mit Funktion '%s' gescheitert%s started with function '%s' will be killed now%s gestartet mit Funktion '%s' wird jetzt abgebrochen%s started with function '%s' has been killed%s gestartet mit Funktion '%s' wurde abgebrochenKilling of %s started with function '%s' failedAbbruch von %s gestartet mit Funktion '%s' gescheitertFlashback database is off - it will be switched on nowDatenbank-Flashback ist aus - er wird jetzt eingeschaltetFlashback database is on - it will be switched off nowDatenbank-Flashback ist ein - er wird jetzt ausgeschaltetFlashback database switched on successfullyDatenbank-Flashback wurde erfolgreich eingeschaltetFlashback database switched off successfullyDatenbank-Flashback wurde erfolgreich ausgeschaltetFlashback database is already onDatenbank-Flashback ist bereits eingeschaltetFlashback database is already offDatenbank-Flashback ist bereits ausgeschaltetSwitching on of flashback database failedEinschalten von Datenbank-Flashback gescheitertSwitching off of flashback database failedAusschalten von Datenbank-Flashback gescheitertFlashback database is off - you cannot flash back the whole database, only individual tables can be flashed back using available rollback dataDatenbank-Flashback ist aus - Sie koennen nicht die gesamte Datenbank zuruecksetzen, nur einzelne Tabellen koennen zurueckgesetzt werden mittels vorhandenen Rollback-DatenCreation of restore point failedAnlegen von Restore-Point gescheitertRestore point '%s' will be created nowRestore-Point '%s' wird jetzt angelegtRestore point '%s' will be dropped nowRestore-Point '%s' wird jetzt geloeschtNormal restore point '%s' created successfullyNormaler Restore-Point '%s' erfolgreich angelegtGuaranteed restore point '%s' created successfullyGarantierter Restore-Point '%s' erfolgreich angelegtCreation of normal restore point '%s' failedAnlegen von normalen Restore-Point '%s' gescheitertCreation of guaranteed restore point '%s' failedAnlegen von garantiertem Restore-Point '%s' gescheitertNormal restore point '%s' dropped successfullyNormaler Restore-Point '%s' erfolgreich geloeschtGuaranteed restore point '%s' dropped successfullyGarantierter Restore-Point '%s' erfolgreich geloeschtDrop of normal restore point '%s' failedLoeschen von normalen Restore-Point '%s' gescheitertDrop of guaranteed restore point '%s' failedLoeschen von garantiertem Restore-Point '%s' gescheitertRestore point '%s' not foundRestore-Point '%s' nicht gefundenNo restore point found for action '%s'Kein Restore-Point fuer Aktion '%s' gefundenControl file is not 'CURRENT' - database flashback cannot be usedSteuerdatei ist nicht 'CURRENT' - Datenbank-Flashback kann nicht benutzt werdenSelected recovery point-in-time/SCN is older than the oldest time/SCN contained in flashback data - database flashback cannot be usedAusgewaehlter Recovery-Zeitpunkt/-SCN ist aelter als die aelteste Zeit/SCN enthalten in Flashback-Daten - Datenbank-Flashback kann nicht benutzt werdenSome normal restore points are older than the oldest time/SCN contained in flashback data - they cannot be usedAll normal restore points are older than the oldest time/SCN contained in flashback data - they cannot be usedManche normale Restore-Points sind aelter als die aelteste Zeit/SCN enthalten in Flashback-Daten - sie koennen nicht benutzt werdenAlle normalen Restore-Points sind aelter als die aelteste Zeit/SCN enthalten in Flashback-Daten - sie koennen nicht benutzt werdenSelected recovery point-in-time/-SCN is before the last database resetlogs time/SCNAusgewaehlter Recovery-Zeitpunkt/SCN liegt vor der letzten Datenbank-Resetlogs-Zeit/-SCNSelected restore point '%s' is before the last database resetlogs time/SCNAusgewaehlter Restore-Point '%s' liegt vor der letzten Datenbank-Resetlogs-Zeit/-SCNNo archivelog processing needed for flashback for database instance %s - probably all required redo data is in online redolog filesKeine Archivelog-Verarbeitung fuer Flashback fuer Datenbank-Instanz %s notwendig - wahrscheinlich sind alle benoetigten Redo-Daten in Online-Redolog-DateienDatabase will be flash back now to target '%s'Datenbank wird jetzt zurueckgesetzt auf Ziel '%s'Flashing back database to target '%s'...Zuruecksetzung der Datenbank auf Ziel '%s'...Database has been successfully flashed back to target '%s'Datenbank ist erfolgreich zurueckgesetzt worden auf Ziel '%s'Database flashback to target '%s' failedZuruecksetzung der Datenbank auf Ziel '%s' gescheitertPlease go back to the main menu and repeat the restore of archivelog filesBitte zum Hauptmenue zurueckgehen und das Zurueckladen von Archivelog-Dateien wiederholenApplying archivelog files to database instance %s probably not requiredEinspielen der Archivelog-Dateien in die Datenbank-Instanz %s wahrscheinlich nicht notwendigParameters of tape device %s: %sParameter von Bandgeraet %s: %sEmpty file cannot be copied to tape by brtools - file: %s device: %sLeere Datei kann nicht von brtools auf Band kopiert werden - Datei: %s Geraet: %sFile '%s' not found on tape in device %sDatei '%s' gefunden auf Band in Geraet %sInvalid file header - probably not a brtools tape file on volume in device %sUngueltiger Dateikopf - wahrscheinlich keine brtools Banddatei auf Datentraeger in Geraet %sInvalid header type in first block of tape file - found: %hu expected: %hu file: %s device: %sUngueltiger Kopftyp im ersten Block von Banddatei - gefunden: %hu erwartet: %hu Datei: %s Geraet: %sInvalid header size in first block of tape file - size: %hu file: %s device: %sUngueltige Kopfgroesse im ersten Block von Banddatei - Groesse: %hu Datei: %s Geraet: %sInvalid length of file name in first block of tape file - length: %u file: %s device: %sUngueltige Laenge des Dateinamens im ersten Block von Banddatei - Laenge: %u Datei: %s Geraet: %sWrong block sequence number in first block of tape file - found: %u expected: %u file: %s device: %sFehlerhafte Blockreihenfolgenummer im ersten Block von Banddatei - gefunden: %u erwartet: %u Datei: %s Geraet: %sInvalid data size in first block of tape file - size: %u file: %s device: %sUngueltige Datengroesse im ersten Block von Banddatei - Groesse: %u Datei: %s Geraet: %sWrong block sequence number tape file - found: %u expected: %u file: %s device: %sFehlerhafte Blockreihenfolgenummer in Banddatei - gefunden: %u erwartet: %u Datei: %s Geraet: %sInvalid data size in tape file - size: %u block: %u file: %s device: %sUngueltige Datengroesse in Banddatei - Groesse: %u Block: %u Datei: %s Geraet: %sTablespace %s has %d files - approaching limit of 1022 filesTablespace %s hat %d Dateien - Annaeherung an Limit von 1022 DateienEmpty file cannot be compressedLeere Datei kann nicht komprimiert werdenEmpty file cannot be decompressedLeere Datei kann nicht dekomprimiert werdenTruncated compressed file headerAbgeschnittener komprimierter DateikopfInvalid data size in compressed file headerUngueltige Datengroesse in komprimiertem DateikopfCompress buffer overflow - possible compressed file corruptionKomprimierungspuffer-Ueberlauf - moegliche Beschaedigung der komprimierten DateiTruncated compressed file dataAbgeschnittene komprimierte DateidatenCorrupt compressed fileBeschaedigte komprimierte DateiInvalid character '%c' in database passwordUngueltiges Zeichen '%c' in DatenbankkennwortA online redolog group in 'ACTIVE' status found - the backup may be inconsistentEine Online-Redolog-Gruppe im Status 'ACTIVE' gefunden - die Sicherung kann inkonsistent seinNo database block corruption records found in %sKeine Datenbankblock-Beschaedigungssaetze gefunden in %sNumber of database block corruption records found in %s: %dAnzahl der Datenbankblock-Beschaedigungssaetze gefunden in %s: %dList of database block corruptions found in %s:Liste der Datenbankblock-Beschaedigungen gefunden in %s:No redolog files found for action '%s'Keine Redolog-Dateien fuer Aktion '%s' gefundenRedolog thread %d does not exist in database %sRedolog-Thread %d existiert nicht in Datenbank %sRedolog group %d does not exist in database %sRedolog-Gruppe %d existiert nicht in Datenbank %sRedolog member %d not found in group %d in database %sRedolog-Mitglied %d nicht gefunden in Gruppe %d in Datenbank %sRedolog group %d already exists in database %sRedolog-Gruppe %d existiert bereits in Datenbank %sRedolog member %d already exists in group %d in database %sRedolog-Mitglied %d existiert bereits in Gruppe %d in Datenbank %sRedolog file %s already exists in database %sRedolog-Datei %s existiert bereits in Datenbank %sNot enough free space in %s for new redolog file(s), missing at least %4.3f MBNot enough free space in %s for redolog file(s) to be moved, missing at least %4.3f MBNicht genug freier Platz in %s fuer neue Redolog-Datei(en), es fehlen mindestens %4.3f MBNicht genug freier Platz in %s fuer die zu verschiebende(n) Redolog-Datei(en), es fehlen mindestens %4.3f MBOnly members of a single redolog group can be selected for action '%s'Nur Mitglieder von einer einzigen Redolog-Gruppe koennen fuer Aktion '%s' ausgewaehlt werdenAll members of a single redolog group have to be selected for action '%s'Alle Mitglieder von einer einzigen Redolog-Gruppe muessen fuer Aktion '%s' ausgewaehlt werdenNot all members of a redolog group can be selected for action '%s'Nicht alle Mitglieder von einer Redolog-Gruppe koennen fuer Aktion '%s' ausgewaehlt werdenOnly members of a single redolog thread can be selected for action '%s'Nur Mitglieder von einem einzigen Redolog-Thread koennen fuer Aktion '%s' ausgewaehlt werdenAll members of a single redolog thread have to be selected for action '%s'Alle Mitglieder von einer einzigen Redolog-Thread muessen fuer Aktion '%s' ausgewaehlt werdenWaiting till active redolog group %d becomes inactive...Warten bis aktive Redolog-Gruppe %d inaktiv wird...Redolog group %d created successfully with file: %sRedolog group %d created successfully with files: %sRedolog-Gruppe %d erfolgreich angelegt mit Datei: %sRedolog-Gruppe %d erfolgreich angelegt mit Dateien: %sRedolog member %d created successfully in group %d with file: %sRedolog members %d created successfully in all groups of thread %d with files: %sRedolog-Mitglied %d erfolgreich angelegt in Gruppe %d mit Datei: %sRedolog-Mitglieder %d erfolgreich angelegt in allen Gruppen von Thread %d mit Dateien: %sRedolog group %d dropped successfully with file: %sRedolog group %d dropped successfully with files: %sRedolog-Gruppe %d erfolgreich geloescht mit Datei: %sRedolog-Gruppe %d erfolgreich geloescht mit Dateien: %sRedolog member %d dropped successfully from group %d with file: %sRedolog members %s dropped successfully from group %d with files: %sRedolog-Mitglied %d erfolgreich geloescht von Gruppe %d mit Datei: %sRedolog-Mitglieder %s erfolgreich geloescht von Gruppe %d mit Dateien: %sThe size of redolog %d files of groups %s changed successfully from %d MB to %d MBThe size of redolog %d files of groups %s changed successfully from %d KB to %d MBDie Groesse von %d Redolog-Dateien von Gruppen %s erfolgreich geaendert von %d MB auf %d MBDie Groesse von %d Redolog-Dateien von Gruppen %s erfolgreich geaendert von %d KB auf %d MBRedolog member %s renamed successfully to %sRedolog-Mitglied %s erfolgreich umbenannt auf %sRedolog member %s moved successfully to %sRedolog-Mitglied %s erfolgreich verschoben auf %sTimeout while waiting till active redolog group %d becomes inactiveTimeout beim Warten bis aktive Redolog-Gruppe %d inaktiv wirdWaiting till active redolog group %d becomes inactive failedWarten bis aktive Redolog-Gruppe %d inaktiv wird gescheitertCreating redolog group %d ...Anlegen von Redolog-Gruppe %d ...Creating redolog member %d in group %d ...Creating redolog member %d in all groups of thread %d ...Anlegen von Redolog-Mitglied %d in Gruppe %d ...Anlegen von Redolog-Mitglied %d in allen Gruppen von Thread %d ...Enter password for encryption wallet (max. %d ASCII chars):Reenter password for encryption wallet (max. %d ASCII chars):Eingabe Kennwort fuer Encryption-Wallet (max. %d ASCII-Zeichen):Wiedereingabe Kennwort fuer Encryption-Wallet (max. %d ASCII-Zeichen):Wallet directory entry ('%s') not found in %sWallet-Verzeichniseintrag ('%s') nicht gefunden in %sWallet directory '%s' not found or not a directoryWallet-Verzeichnis '%s' nicht gefunden oder kein VerzeichnisWallet directory '%s' not set to the recommended value of '%s'Wallet directory '%s' not set to the recommended value '%s' or '%s'Wallet-Verzeichnis '%s' nicht gesetzt auf den empfohlenen Wert von '%s'Wallet-Verzeichnis '%s' nicht gesetzt auf den empfohlenen Wert '%s' oder '%s'Encryption wallet '%s' not found though encrypted tables existEncryption-Wallet '%s' nicht gefunden obwohl verschluesselte Tabellen vorhandenEncryption wallet %s is openEncryption wallet %s already openEncryption-Wallet %s ist geoeffnetEncryption-Wallet %s bereits geoeffnetEncryption wallet %s is closedEncryption wallet %s already closedEncryption-Wallet %s ist geschlossenEncryption-Wallet %s bereits geschlossenEncryption wallet %s already existsEncryption-Wallet %s existiert bereitsEncryption wallet %s does not existEncryption-Wallet %s existiert nichtEncryption wallet %s cannot be deleted because encrypted tables/tablespaces still existEncryption-Wallet %s kann nicht geloescht werden, weil verschluesselte Tabellen/Tablespaces noch vorhandenEncrypted table %s not foundVerschluesselte Tabelle %s nicht gefundenNo encrypted tables found for action '%s'Keine verschluesselten Tabellen fuer Aktion '%s' gefundenEncryption wallet %s opened successfullyEncryption-Wallet %s erfolgreich geoeffnetEncryption wallet %s closed successfullyEncryption-Wallet %s erfolgreich geschlossenEncryption wallet %s created successfullyEncryption-Wallet %s erfolgreich angelegtEncryption wallet %s deleted successfullyEncryption-Wallet %s erfolgreich geloeschtEncryption wallet %s saved successfullyEncryption-Wallet %s erfolgreich gespeichertNew master key generated successfullyNeuer Hauptschluessel erfolgreich generiertEncrypted table %s.%s re-keyed successfullyVerschluesselte Tabelle %s.%s erfolgreich neu verschluesseltNo encrypted tablespaces found for action '%s'Keine verschluesselten Tablespaces fuer Aktion '%s' gefundenEnter new password for encryption wallet (max. %d ASCII chars):Reenter new password for encryption wallet (max. %d ASCII chars):Eingabe neues Kennwort fuer Encryption-Wallet (max. %d ASCII-Zeichen):Wiedereingabe neues Kennwort fuer Encryption-Wallet (max. %d ASCII-Zeichen):Encryption wallet %s will be closed and reopened nowEncryption-Wallet %s wird jetzt geschlossen und wiedereroeffnetEncryption wallet password changed successfullyEncryption-Wallet-Kennwort erfolgreich geaendertChanging encryption wallet password failedAenderung von Encryption-Wallet-Kennwort gescheitertAuto-open wallet %s is already enabledAuto-Open-Wallet %s ist bereits aktivAuto-open wallet %s is not enabledAuto-Open-Wallet %s ist nicht aktivAuto-open wallet %s enabled successfullyLocal auto-open wallet %s enabled successfullyAuto-Open-Wallet %s erfolgreich aktiviertLokales Auto-Open-Wallet %s erfolgreich aktiviertAuto-open wallet %s disabled successfullyAuto-open wallet %s disabled successfully - encryption wallet remains openAuto-Open-Wallet %s erfolgreich deaktiviertAuto-Open-Wallet %s erfolgreich deaktiviert - Encryption-Wallet bleibt geoeffnetEnabling of auto-open wallet %s failedAktivierung von Auto-Open--Wallet %s gescheitertDisplaying information of database wallet %s:Anzeige der Informationen von Datenbank-Wallet %s:Database wallet information displayed successfullyDatenbank-Wallet-Informationen erfolgreich angezeigtDisplaying information of database wallet %s failedAnzeige der Informationen von Datenbank-Wallet %s gescheitertDatabase wallet will be saved: %sDatenbank-Wallet wird gesichert: %sEncryption wallet %s is closed - please open it firstEncryption-Wallet %s ist geschlossen - bitte es zuerst eroeffnenAuto-open wallet %s is enabled - please disable it firstAuto-Open-Wallet %s ist aktiv - bitte es zuerst deaktivierenInvalid database wallet '%s' found - should be located only in directory %sUngueltiges Datenbank-Wallet '%s' gefunden - sollte sich befinden nur im Verzeichnis %sSave sets will be not unpacked by RMANSavesets werden nicht entpackt von RMANSave set piece %d verifiedSave set number %d verifiedSaveset-Teil %d verifiziertSaveset-Nummer %d verifiziertControl file name '%s' in selected backup %s.%s not found in Oracle parameter 'control_files'Steuerdateiname '%s' in ausgewaehlter Sicherung %s.%s nicht gefunden in Oracle-Parameter 'control_files'Restored control file is not a standby control fileZurueckgeladene Stuerdatei is keine Standby-StuerdateiOriginal disk backup %s not found for backup copy %s.%sOriginal-Plattensicherungen %s nicht gefunden fuer Sicherungskopie %s.%sExecuting pre-archive command '%s'...Ausfuehrung von Pre-Archive-Kommando '%s'...Pre-archive command '%s' executed successfullyPre-Archive-Kommando '%s' erfolgreich ausgefuehrtExecution of pre-archive command '%s' failedAusfuehrung von Pre-Archive-Kommando '%s' gescheitertExecuting post-archive command '%s'...Ausfuehrung von Post-Archive-Kommando '%s'...Post-archive command '%s' executed successfullyPost-Archive-Kommando '%s' erfolgreich ausgefuehrtExecution of post-archive command '%s' failedAusfuehrung von Post-Archive-Kommando '%s' gescheitertExecuting pre-backup command '%s'...Ausfuehrung von Pre-Backup-Kommando '%s'...Pre-backup command '%s' executed successfullyPre-Backup-Kommando '%s' erfolgreich ausgefuehrtExecution of pre-backup command '%s' failedAusfuehrung von Pre-Backup-Kommando '%s' gescheitertExecuting post-backup command '%s'...Ausfuehrung von Post-Backup-Kommando '%s'...Post-backup command '%s' executed successfullyPost-Backup-Kommando '%s' erfolgreich ausgefuehrtExecution of post-backup command '%s' failedAusfuehrung von Post-Backup-Kommando '%s' gescheitertExecuting init-archive command '%s'...Ausfuehrung von Init-Archive-Kommando '%s'...Init-archive command '%s' executed successfullyInit-Archive-Kommando '%s' erfolgreich ausgefuehrtExecution of init-archive command '%s' failedAusfuehrung von Init-Archive-Kommando '%s' gescheitertExecuting cont-archive command '%s'...Ausfuehrung von Cont-Archive-Kommando '%s'...Cont-archive command '%s' executed successfullyCont-Archive-Kommando '%s' erfolgreich ausgefuehrtExecution of cont-archive command '%s' failedAusfuehrung von Cont-Archive-Kommando '%s' gescheitertExecuting term-archive command '%s'...Ausfuehrung von Term-Archive-Kommando '%s'...Term-archive command '%s' executed successfullyTerm-Archive-Kommando '%s' erfolgreich ausgefuehrtExecution of term-archive command '%s' failedAusfuehrung von Term-Archive-Kommando '%s' gescheitertExecuting init-backup command '%s'...Ausfuehrung von Init-Backup-Kommando '%s'...Init-backup command '%s' executed successfullyInit-Backup-Kommando '%s' erfolgreich ausgefuehrtExecution of init-backup command '%s' failedAusfuehrung von Init-Backup-Kommando '%s' gescheitertExecuting cont-backup command '%s'...Ausfuehrung von Cont-Backup-Kommando '%s'...Cont-backup command '%s' executed successfullyCont-Backup-Kommando '%s' erfolgreich ausgefuehrtExecution of cont-backup command '%s' failedAusfuehrung von Cont-Backup-Kommando '%s' gescheitertExecuting term-backup command '%s'...Ausfuehrung von Term-Backup-Kommando '%s'...Term-backup command '%s' executed successfullyTerm-Backup-Kommando '%s' erfolgreich ausgefuehrtExecution of term-backup command '%s' failedAusfuehrung von Term-Backup-Kommando '%s' gescheitertParameter '%s' not correctly set in Oracle profile %s for database instance %s, expected value: %dParameter '%s' nicht richtig gesetzt in Oracle-Profil %s fuer Datenbankinstanz %s, erwarteter Wert: %dDatabase file %s is not droppableDatenbankdatei %s ist nicht loeschbarOracle spfile '%s' not foundOracle-Spfile '%s' nicht gefundenOracle spfile %s is not a regular fileOracle-Spfile %s ist keine normale DateiSeparate SAPPROF directory not supported if spfile is not usedSeparates SAPPROF-Verzeichnis nicht unterstuetzt, wenn Spfile nicht benutzt wirdOracle spfile %s created from pfile %sOracle-Spfile %s erstellt aus Pfile %sRestored Oracle profile %s can be copied now to its original location: %sZurueckgeladenes Oracle-Profil %s kann jetzt zu seiner Ursprungslokation kopiert werden: %sOracle profile %s (containing only '%s' parameter) can be recreated now by %sOracle-Profil %s (nur mit '%s'-Parameter) kann jetzt von %s neu angelegt werdenOracle profile %s has been recreated by %sOracle-Profil %s ist von %s neu angelegt wordenRestored Oracle spfile %s can be copied now to its original location: %sOracle spfile %s can be copied now to its original location: %sZurueckgeladenes Oracle-Spfile %s kann jetzt zu seiner Ursprungslokation kopiert werden: %sOracle-Spfile %s kann jetzt zu seiner Ursprungslokation kopiert werden: %sOracle spfile %s will be created from pfile %sOracle-Spfile %s wird aus Pfile %s erstelltDirectory %s already exists in file systemDirectory/file %s already exists in file systemVerzeichnis %s existiert bereits im DateisystemVerzeichnis/Datei %s existiert bereits im DateisystemDatabase instance name mismatch at connection '@%s' - parallel_instances: %s, V$INSTANCE: %sUngleichheit in Namen der Datenbankinstanzen auf Verbindung '@%s' - parallel_instances: %s, V$INSTANCE: %sBigfile tablespace %s cannot be extended with a new fileBigfile-Tablespace %s kann nicht mit einer neuen Datei erweitert werdenTable data class (tabart) handling will be executed nowBehandlung der Tabellen-Datenarten (Tabarten) wird jetzt ausgefuehrtTable data class (tabart) handling executed successfullyBehandlung der Tabellen-Datenarten (Tabarten) erfolgreich ausgefuehrtTable data class (tabart) handling not successfulBehandlung der Tabellen-Datenarten (Tabarten) nicht erfolgreichSelected database files have different block sizesAusgewaehlte Datenbankdateien haben unterschiedliche BlockgroessenSelected database files are a mix of big and small filesAusgewaehlte Datenbankdateien sind eine Mischung von Bigfiles und SmallfilesFix statistics set for table %s.%sFeste Statistiken gesetzt fuer Tabelle %s.%sFix statistics set for index %s.%sFeste Statistiken gesetzt fuer Index %s.%sFix statistics set for table column %s.%s.%sFeste Statistiken gesetzt fuer Tabellespalte %s.%s.%sDatabase table %s.%s dropped at %s selected for purgeDatenbanktabelle %s.%s geloescht am %s zur Beseitigung ausgewaehltDatabase table %s.%s dropped at %s has been purgedDatenbanktabelle %s.%s geloescht am %s wurde beseitigt%d table selected for purge from database %s%d tables selected for purge from database %s%d Tabelle zur Beseitigung aus Datenbank %s ausgewaehlt%d Tabellen zur Beseitigung aus Datenbank %s ausgewaehlt%d table purged from database %s%d tables purged from database %s%d Tabelle beseitigt aus Datenbank %s%d Tabellen beseitigt aus Datenbank %sTable selected to collect statistics due to small sample size: %s.%s: (%1.0f/%1.0f/%1.0f)Tabelle bestimmt zur Sammlung der Statistiken aufgrund kleiner Probengroesse: %s.%s (%1.0f/%1.0f/%1.0f)Name of supplemetal log %s.%s longer than %d charactersName des Supplemetal-Logs %s.%s ist laenger als %d ZeichenTablespace %s must be a ASSM tablespace for migration to SecureFile LOBsTablespace %s muss ein ASSM-Tablespace sein fuer Migration zu SecureFile-LOBsTable %s.%s with SecureFile LOBs cannot be moved into a non-ASSM tablespace %sTabelle %s.%s mit SecureFile-LOBs kann nicht in einen Nicht-ASSM-Tablespace verschoben werdenUncompressed tables will be moved into compressed tablespace %s - consider to set the 'compress' option to '%s'Uncompressed table partitions will be moved into compressed tablespace %s - consider to set the 'compress' option to '%s'Unkomprimierte Tabellen werden in komprimierten Tablespace %s verschoben - erwaegen Sie die 'compress'-Option auf '%s' zu setzenUnkomprimierte Tabellen-Partitionen werden in komprimierten Tablespace %s verschoben - erwaegen Sie die 'compress'-Option auf '%s' zu setzenUncompressed LOBs will be moved into compressed tablespace %s - consider to set the 'compress' option to '%s'Uncompressed LOB partitions will be moved into compressed tablespace %s - consider to set the 'compress' option to '%s'Unkomprimierte LOBs werden in komprimierten Tablespace %s verschoben - erwaegen Sie die 'compress'-Option auf '%s' zu setzenUnkomprimierte LOB-Partitionen werden in komprimierten Tablespace %s verschoben - erwaegen Sie die 'compress'-Option auf '%s' zu setzenCompression action '%s' not supported for reorganization action '%s'Komprimierungsaktion '%s' nicht unterstuetzt fuer Reorganisationsaktion '%s'Table compression not supported for index-organized table %s.%sTabellenkomprimierung nicht unterstuetzt fuer index-organisierte Tabelle %s.%sCompression action '%s' not needed for table %s.%sCompression action '%s' not needed for table partition %s.%s.%sKomprimierungsaktion '%s' nicht erforderlich fuer Tabelle %s.%sKomprimierungsaktion '%s' nicht erforderlich fuer Tabellen-Partition %s.%s.%sCompression action '%s' not supported for Oracle version lower than %sKomprimierungsaktion '%s' nicht unterstuetzt fuer Oracle-Version kleiner als %sTable %s.%s is emptyTable %s.%s is not emptyTabelle %s.%s ist leerTabelle %s.%s ist nicht leerTable %s.%s has no segmentTabelle %s.%s hat kein SegmentIndex %s.%s has no segmentIndex %s.%s hat kein SegmentTable %s.%s is an Oracle compressed tableTabelle %s.%s ist eine Oracle komprimierte TabelleTable %s.%s is a SAP compressed tableTabelle %s.%s ist eine SAP komprimierte TabelleTable %s.%s is a SAP exceptional tableTabelle %s.%s ist eine SAP AusnahmetabelleSmall table %s.%s (%1.0f/%1.0f) will not be processedKleine Tabelle %s.%s (%1.0f/%1.0f) wird nicht prozessiertLarge table %s.%s (%1.0f/%1.0f) will not be processedGrosse Tabelle %s.%s (%1.0f/%1.0f) wird nicht prozessiertTable %s not found for LOB %s.%s - ignoring LOBTable %s not found for LOB partition %s.%s.%s - ignoring LOB partitionTabelle %s fuer LOB %s.%s nicht gefunden - LOB wird ignoriertTabelle %s fuer LOB-Partition %s.%s.%s nicht gefunden - LOB-Partition wird ignoriertLOB %s not found for LOB partition %s.%s.%s - ignoring LOB partitionLOB %s fuer LOB-Partition %s.%s.%s nicht gefunden - LOB-Partition wird ignoriertChecking indexes for rebuild...Ueberpruefung der Indizes fuer Neuaufbau...Rebuild of index %s.%s will be skippedRebuild of index partition %s.%s.%s will be skippedNeuaufbau des Index %s.%s wird uebersprungenNeuaufbau der Index-Partition %s.%s.%s wird uebersprungenBitmap index %s.%s cannot be compressedBitmap-Index %s.%s kann nicht komprimiert werdenGenerated index %s.%s will not be compressedGenerierter Index %s.%s wird nicht komprimiertUnique index with only one key column %s.%s cannot be compressedUnique-Index mit nur einem Schluesselfeld %s.%s kann nicht komprimiert werdenIndex %s.%s has no statistics - it cannot be check for compressionIndex %s.%s hat keine Statistiken - er kann nicht fuer Komprimierung geprueft werdenSmall index %s.%s will not be compressedKleiner Index %s.%s wird nicht komprimiertCompression of index partitions by rebuild not possible for uncompressed partitioned index %s.%sKomprimierung von Index-Partitionen durch Rebuild nicht moeglich fuer unkomprimierten partitionierten Index %s.%sIndex %s.%s can be decompressedIndex %s.%s kann dekomprimiert werdenCompression action '%s' not needed for index %s.%sCompression action '%s' not needed for index partition %s.%s.%sKomprimierungsaktion '%s' nicht erforderlich fuer Index %s.%sKomprimierungsaktion '%s' nicht erforderlich fuer Index-Partition %s.%s.%sNumber of compressed columns of unique index %s.%s will be reduced to %dNumber of compressed columns of non-unique index %s.%s will be reduced to %dAnzahl der komprimierten Spalten von Unique-Index %s.%s wird reduziert auf %dAnzahl der komprimierten Spalten von Non-Unique-Index %s.%s wird reduziert auf %dPartitioned index %s.%s will retain the global compress attribute after decompress by rebuild of all its partitionsPartitionierte Index %s.%s wird nach der Dekomprimierung durch Rebuild von allen seinen Partitionen das globale Komprimierungsattribut beibehaltenEvaluation procedure '%s' called successfully for index %s.%s, number of columns to compress: %dEvaluation procedure '%s' called successfully for index %s.%s, number of columns to compress: %d (savings %d%%)Evaluations-Prozedur '%s' erfolgreich aufgerufen fuer Index %s.%s, Anzahl der zu komprimierenden Spalten: %dEvaluations-Prozedur '%s' erfolgreich aufgerufen fuer Index %s.%s, Anzahl der zu komprimierenden Spalten: %d (Ersparnis %d%%)Call of evaluation procedure '%s' failed for index %s.%sCall of evaluation procedure '%s' failed for index %s.%s, return code: %d (%s)Aufruf von Evaluations-Prozedur '%s' gescheitert fuer Index %s.%sAufruf von Evaluations-Prozedur '%s' gescheitert fuer Index %s.%s, Return-Code: %d (%s)Index %s.%s has no statistics - evaluation procedure '%s' cannot be called for itIndex %s.%s hat keine Statistiken - Evaluations-Prozedur '%s' kann fuer ihn nicht aufgerufen werdenSmall index %s.%s (%1.0f/%1.0f) will not be processedKleiner Index %s.%s (%1.0f/%1.0f) wird nicht prozessiertLarge index %s.%s (%1.0f/%1.0f) will not be processedGrosser Index %s.%s (%1.0f/%1.0f) wird nicht prozessiertCalling evaluation procedure '%s' called for index %s.%s ...Evaluations-Prozedur '%s' wird aufgerufen fuer Index %s.%s ...Index %s.%s is already compressedIndex %s.%s ist bereits komprimiertTable %s.%s has already a segmentTabelle %s.%s hat bereits ein SegmentTable %s.%s has a materialized view logTabelle %s.%s hat ein Materialized-View-LogIndex %s.%s cannot be selected for function '%s'Index %s.%s cannot be selected for action '%s'Index %s.%s kann fuer Funktion '%s' nicht ausgewaehlt werdenIndex %s.%s kann fuer Aktion '%s' nicht ausgewaehlt werdenIndex %s.%s altered successfully into status '%s'Index %s.%s erfolgreich geaendert in den Status '%s'Interim materialized view log created for table %s.%sVorlaeufiges Materialized-View-Log erstellt fuer Tabelle %s.%sTable %s.%s with NOLOGGING selected for reorganization - table's data can be lost during recoveryTabelle %s.%s mit NOLOGGING wurde fuer Reorganisation ausgewaehlt - Tabellendaten koennen waehrend eines Recovery verloren gehenTable %s.%s with disabled primary key selected for reorganization - table will be reorganized using ROWIDTabelle %s.%s mit deaktiviertem Primaerschluessel wurde fuer Reorganisation ausgewaehlt - Tabellen wird mittels ROWID reorganisiertIngnoring external table %s.%s ...Externe Tabelle %s.%s wird ignoriert...Table %s.%s has been already reorganizedTable partition %s.%s.%s has been already reorganizedTabelle %s.%s ist bereits reorgnisiert wordenTabellen-Partition %s.%s.%s ist bereits reorgnisiert wordenIndex %s.%s has been already rebuiltIndex partition %s.%s.%s has been already rebuiltIndex %s.%s ist bereits neu aufgebaut wordenIndex-Partition %s.%s.%s ist bereits neu aufgebaut wordenTable %s.%s has only BasicFile LOB columns - LOB compression action will be skipped for itTabelle %s.%s hat nur BasicFile-LOB-Spalten - LOB-Komprimierungsaktion wird fuer sie uebersprungenTable %s.%s has no BasicFile LOB columnsTable %s.%s has no SecureFile LOB columnsTabelle %s.%s hat keine BasicFile-LOB-SpaltenTabelle %s.%s hat keine SecureFile-LOB-SpaltenIndex %s.%s selected for compressionIndex partition %s.%s.%s selected for compressionIndex %s.%s ausgwaehlt fuer KomprimierungIndex-Partition %s.%s.%s ausgwaehlt fuer KomprimierungTable partition(s) '%s' not foundTabellen-Partition(en) '%s' nicht gefundenIndex partition(s) '%s' not foundIndex-Partition(en) '%s' nicht gefundenSegment of type '%s' not found for extent %s.%s:%d - ignoring extentSegment of type '%s' not found for extent %s.%s.%s:%d - ignoring extentSegment von Typ '%s' fuer Extent %s.%s:%d nicht gefunden - Extent wird ignoriertSegment von Typ '%s' fuer Extent %s.%s.%s:%d nicht gefunden - Extent wird ignoriertNo appropriate table partitions found for function '%s'No appropriate table partitions found for action '%s'Keine passenden Tabellen-Partitionen fuer Funktion '%s' gefundenKeine passenden Tabellen-Partitionen fuer Aktion '%s' gefundenNo appropriate index partitions found for function '%s'No appropriate index partitions found for action '%s'Keine passenden Index-Partitionen fuer Funktion '%s' gefundenKeine passenden Index-Partitionen fuer Aktion '%s' gefundenTable %s.%s has unused columns - reorganization of partitions not possibleTabelle %s.%s hat unbenutzte Spalten - Reorganisation von Partitionen nicht moeglichNo index partitions found with NOLOGGING created during or after the selected backup: %sKeine Index-Partitionen gefunden mit NOLOGGING angelegt waehrend oder nach der ausgewaehlten Sicherung: %s%d index partition found with NOLOGGING created during or after the selected backup %s - it can be rebuilt now%d index partitions found with NOLOGGING created during or after the selected backup %s - they can be rebuilt now%d Index-Partition mit NOLOGGING gefunden, die waehrend oder nach der ausgewaehlten Sicherung %s angelegt wurde - sie kann jetzt neu aufgebaut werden%d Index-Partitionen mit NOLOGGING gefunden, die waehrend oder nach der ausgewaehlten Sicherung %s angelegt wurden - sie koennen jetzt neu aufgebaut werdenPartitions of compressed table %s.%s cannot be reorganized using ROWIDPartitionen von komprimierte Tabelle %s.%s koennen nicht mittel ROWID reorganisiert werdenTable %s.%s has more than %d columnsTabelle %s.%s hat mehr als %d SpaltenTable %s.%s has no indexesTabelle %s.%s hat keine IndizesTable %s.%s has only bitmap indexesTabelle %s.%s hat nur Bitmap-IndizesIndex %s.%s selected for decompressionIndex partition %s.%s.%s selected for decompressionIndex %s.%s ausgwaehlt fuer DekomprimierungIndex-Partition %s.%s.%s ausgwaehlt fuer Dekomprimierung%s.%s is a compressed table without unique index - reorganization of partitions not possible%s.%s ist eine komprimierte Tabelle ohne Unique-Index - Reorganisation von Partitionen nicht moeglichTable %s.%s would be implicitly decompressed during reorganizationTabelle %s.%s wuerde waehrend der Reorganisation implizit dekomprimiert werdenTable %s.%s is a path tableTabelle %s.%s ist eine Path-TabelleSegment(s) created successfully for table %s.%sSegment(e) erfolgreich angelegt fuer Tabelle %s.%sSegment(s) not created for table %s.%s for unknown reasonsSegment(e) aus unbekannten Gruenden nicht angelegt fuer Tabelle %s.%sSegment(s) dropped successfully for table %s.%sSegment(e) erfolgreich geloescht fuer Tabelle %s.%sSegment(s) couldn't be dropped for table %s.%s - table probably not emptySegment(e) konnte(n) nicht geloescht werden fuer Tabelle %s.%s - Tabelle wahrscheinlich nicht leerCollection of information on ASM database files...Collection of information on ASM archivelog files...Sammlung der Informationen ueber ASM-Datenbankdateien...Sammlung der Informationen ueber ASM-Archivelog-Dateien...Collection of information on ASM files failedCollection of information on ASM disk groups failedSammlung der Informationen ueber ASM-Dateien gescheitertSammlung der Informationen ueber ASM-Disk-Gruppen gescheitertDatabase file '%s' not found in ASMFile '%s' not found in ASMDatenbandatei '%s' nicht gefunden in ASMDatei '%s' nicht gefunden in ASMArchivelog file '%s' not found in ASMArchivelog-Datei '%s' nicht gefunden in ASMDisk group '%s' not found in ASMDisk group '%s' not found in ASM for '%s'Disk-Gruppe '%s' nicht gefunden in ASMDisk-Gruppe '%s' nicht gefunden in ASM fuer '%s'Directory '%s' not found in ASMVerzeichnis '%s' nicht gefunden in ASMASM file not found for ASM alias '%s'ASM-Datei nicht gefunden fuer ASM-Alias '%s'Control file '%s' is not an ASM alias (standard name '%s') or is not part of database %sSpfile '%s' is not an ASM alias (standard name '%s') or is not part of database %sSteuerdatei '%s' ist kein ASM-Alias (Standardname '%s') oder gehoert nicht zu Datenbank %sSpfile '%s' ist kein ASM-Alias (Standardname '%s') oder gehoert nicht zu Datenbank %sUnknown database file '%s' found in ASM - it is not part of database %sUnknown database file '%s' -> '%s' found in ASM - it is not part of database %sUnbekannte Datenbandatei '%s' in ASM gefunden - sie gehoert nicht zu Datenbank %sUnbekannte Datenbandatei '%s' -> '%s' in ASM gefunden - sie gehoert nicht zu Datenbank %sIncompatible ASM and Oracle file types of file '%s'Inkompatibele ASM- und Oracle-Dateitypen von Datei '%s'ASM size %1.0f of file %s is different from database file size %1.0fASM-Groesse %1.0f der Datei %s ist verschieden von Datenbank-Dateigroesse %1.0fOnly RMAN backups supported for ASM database filesOnly RMAN backups supported for ASM archivelog filesNur RMAN-Sicherungen unterstuetzt fuer ASM-DatenbankdateienNur RMAN-Sicherungen unterstuetzt fuer ASM-Archivelog-DateienASM file %s cannot be restored to file system / raw disk %sASM-Datei %s kann nicht auf Dateisystem/Raw-Platte %s zurueckgeladen werdenFile system file %s cannot be restored to ASMRaw disk file %s cannot be restored to ASMDateisystem-Datei %s kann nicht in ASM zurueckgeladen werdenRaw-Platte-Datei %s kann nicht in ASM zurueckgeladen werdenASM alias %s may be used for restore of only one ASM fileASM-Alias %s darf fuer Zurueckladen von nur einer ASM-Datei benutzt werdenOnly RMAN verification supported for ASM database filesNur RMAN-Verifikation unterstuetzt fuer ASM-DatenbankdateienDevice type '%s' not supported for ASM databaseGeraetetyp '%s' nicht unterstuetzt fuer ASM-DatenbankSoftware compression not supported for ASM database filesSoftware compression not supported for ASM archivelog filesSoftware-Komprimierung nicht unterstuetzt fuer ASM-DatenbankdateienSoftware-Komprimierung nicht unterstuetzt fuer ASM-Archivelog-DateienDBVERIFY not supported for ASM database filesDBVERIFY nicht unterstuetzt fuer ASM-DatenbankdateienASM database file %s will be overwrittenASM database file %s might be overwrittenASM-Datenbankatei %s wird ueberschriebenASM-Datenbankatei %s koennte ueberschrieben werdenASM database file %s deletedASM archivelog file %s deletedASM-Datenbankdatei %s geloeschtASM-Archivelog-Datei %s geloeschtASM alias %s created for file %sASM-Alias %s angelegt fuer Datei %sASM alias %s deletedASM-Alias %s geloeschtASM directory %s createdASM-Verzeichnis %s angelegtASM directory %s deletedASM-Verzeichnis %s geloeschtASM alias %s must be located underneath of database root directory '%s' of disk group %sASM-Alias %s muss sich befinden unterhalb von Datenbank-Root-Verzeichnis '%s' von Disk-Gruppe %sASM file %s cannot be renamed to non-ASM fileNon-ASM file %s cannot be renamed to ASM fileASM-Datei %s kann nicht auf Nicht-ASM-Datei umbennant werdenNicht-ASM-Datei %s kann nicht auf ASM-Datei umbennant werdenOnly one file may be selected for rename to an ASM aliasOnly one file may be selected for renameNur eine Datei darf fuer Umbennenung zu einem ASM-Alias ausgewaehlt werdenNur eine Datei darf fuer Umbennenung ausgewaehlt werdenThe new alias name '%s' for file '%s' must be located on ASM disk group %sDer neue Alias-Name '%s' fuer Datei '%s' muss sich auf ASM-Disk-Gruppe %s befindenCannot rename ASM/OMF file '%s' to another OMF fileASM/OMF-Datei '%s' kann nicht auf eine andere OMF-Datei umbenannt werdenASM file '%s' selected for rename is not located on disk group %sDie fuer Umbenennung ausgewaehlte ASM-Datei '%s' muss sich auf ASM-Disk-Gruppe %s befindenOnly one data file may be selected to be moved using ASM aliasOnly one redo file may be selected to be moved using ASM aliasNur eine Datendatei darf ausgewaehlt werden, um mittels ASM-Alias verschoben zu werdenNur eine Redo-Datei darf ausgewaehlt werden, um mittels ASM-Alias verschoben zu werdenASM file %s cannot be moved to file systemASM file %s cannot be moved to raw diskASM-Datei %s kann nicht auf Dateisystem verschoben werdenASM-Datei %s kann nicht auf Raw-Platte verschoben werdenFile system file %s cannot be moved to ASMRaw disk file %s cannot be moved to ASMDateisystem-Datei %s kann nicht in ASM verschoben werdenRaw-Platte-Datei %s kann nicht in ASM verschoben werdenASM destination not supported for this functionASM destination not supported for this actionASM-Destination nicht unterstuetzt fuer diese FunktionASM-Destination nicht unterstuetzt fuer diese AktionASM file %s is not located underneath of database root directory '%s' of disk group %sASM-Datei %s befinded sich nicht unterhalb von Datenbank-Root-Verzeichnis '%s' von Disk-Gruppe %sLast message BR2050Letzte Meldung BR2050Last messageLetzte MeldungBR*Tools main menu 1 - Instance management 2 - Space management 3 - Segment management 4 - Backup and database copy 5 - Restore and recovery 6 - Check and verification 7 - Database statistics 8 - Additional functions 9 - Exit program BR*Tools-Hauptmenue 1 - Instanzverwaltung 2 - Platzverwaltung 3 - Segmentverwaltung 4 - Sicherung und Datenbankkopie 5 - Zurueckladen und Wiederherstellung 6 - Ueberpruefung und Verifikation 7 - Datenbankstatistiken 8 - Weitere Funktionen 9 - Programm beenden Additional BR*Tools functions 1 - Show profiles and logs 2 - Clean up DBA logs and tables 3 - Adapt NEXT extents 4 - Change password of database user 5 - Create/change synonyms for DBA tables 6 - Reset program status Weitere BR*Tools-Funktionen 1 - Profile und Protokolle anzeigen 2 - Aufraeumen von DBA-Protokollen und -Tabellen 3 - Anpassung von NEXT-Extents 4 - Aenderung des Kennworts von Datenbankbenutzer 5 - Anlegen/Aenderung der Synonyme fuer DBA-Tabellen 6 - Programmstatus zuruecksetzen Database instance management 1 - Start up database 2 - Shut down database 3 - Alter database instance 4 - Alter database parameters 5 - Recreate database 6 - Manage online redolog 7 - Manage data encryption 8 - Additional instance functions 9 - Reset program status Verwaltung der Datenbankinstanz 1 - Datenbank starten 2 - Datenbank stoppen 3 - Datenbankinstanz aendern 4 - Datenbankparameter aendern 5 - Datenbank neu anlegen 6 - Online-Redolog verwalten 7 - Datenverschluesselung verwalten 8 - Weitere Instanzfunktionen 9 - Programmstatus zuruecksetzen Additional database instance functions 1 - Show instance status 2 - Show database parameters 3 - Show database owners 4 - Show flashback status 5 - Show encryption status Weitere Datenbankinstanz-Funktionen 1 - Instanzstatus anzeigen 2 - Datenbankparameter anzeigen 3 - Datenbankbesitzer anzeigen 4 - Flashback-Status anzeigen 5 - Verschluesselungsstatus anzeigen Database space management 1 - Extend tablespace 2 - Create tablespace 3 - Drop tablespace 4 - Alter tablespace 5 - Alter data file 6 - Move data file 7 - Additional space functions 8 - Reset program status Verwaltung des Datenbankplatzes 1 - Tablespace erweitern 2 - Tablespace anlegen 3 - Tablespace loeschen 4 - Tablespace aendern 5 - Datendatei aendern 6 - Datendatei verschieben 7 - Weitere Platzfunktionen 8 - Programmstatus zuruecksetzen Additional database space functions 1 - Show tablespaces 2 - Show data files 3 - Show redolog files 4 - Show control files 5 - Show disk volumes Weitere Datenbankplatz-Funktionen 1 - Tablespaces anzeigen 2 - Datendateien anzeigen 3 - Redolog-Dateien anzeigen 4 - Steuerdateien anzeigen 5 - Plattendatentraeger anzeigen Database segment management 1 - Reorganize tables 2 - Rebuild indexes 3 - Export tables 4 - Import tables 5 - Alter tables 6 - Alter indexes 7 - Additional segment functions 8 - Reset program status Verwaltung der Datenbanksegmente 1 - Tabellen reorganisieren 2 - Indizes neu aufbauen 3 - Tabellen exportieren 4 - Tabellen importieren 5 - Tabellen aendern 6 - Indizes aendern 7 - Weitere Segmentfunktionen 8 - Programmstatus zuruecksetzen Additional database segment functions 1 - Show tables 2 - Show indexes 3 - Show table partitions 4 - Show index partitions 5 - Show segments 6 - Show segment extents 7 - Show free extents Weitere Datenbanksegment-Funktionen 1 - Tabellen anzeigen 2 - Indizes anzeigen 3 - Tabellen-Partitionen anzeigen 4 - Index-Partitionen anzeigen 5 - Segmente anzeigen 6 - Extents der Segmente anzeigen 7 - Freie Extents anzeigen Backup and database copy 1 - Database backup 2 - Archivelog backup 3 - Database copy 4 - Non-database backup 5 - Backup of database disk backup 6 - Verification of database backup 7 - Verification of archivelog backup 8 - Additional functions 9 - Reset program status Sicherung und Datenbankkopie 1 - Datenbanksicherung 2 - Archivelog-Sicherung 3 - Datenbankkopie 4 - Nicht-Datenbanksicherung 5 - Sicherung der Datenbank-Plattensicherung 6 - Verifikation der Datenbanksicherung 7 - Verifikation der Archivelog-Sicherung 8 - Weitere Funktionen 9 - Programmstatus zuruecksetzen Additional functions for backup and copy 1 - Update of compression rates 2 - Preparation of RMAN backups 3 - Deletion of database disk backups 4 - Deletion of archivelog disk backups 5 - Controlling of BRARCHIVE run 6 - Initialization of BRBACKUP tape volumes 7 - Initialization of BRARCHIVE tape volumes Weitere Funktionen fuer Sicherung und Kopie 1 - Aktualisierung der Kompressionsraten 2 - Vorbereitung der RMAN-Sicherungen 3 - Loeschen der Datenbank-Plattensicherungen 4 - Loeschen der Archivelog-Plattensicherungen 5 - Steuerung des BRARCHIVE-Laufs 6 - Initialisierung der BRBACKUP-Banddatentraeger 7 - Initialisierung der BRARCHIVE-Banddatentraeger Restore and recovery 1 - Complete database recovery 2 - Database point-in-time recovery 3 - Tablespace point-in-time recovery 4 - Whole database reset 5 - Restore of individual backup files 6 - Restore and application of archivelog files 7 - Disaster recovery 8 - Manage flashback database 9 - Reset program status Zurueckladen und Wiederherstellung 1 - Vollstaendige Wiederherstellung der Datenbank 2 - Point-in-Time-Wiederherstellung der Datenbank 3 - Point-in-Time-Wiederherstellung der Tablespaces 4 - Zuruecksetzen der ganzen Datenbank 5 - Zurueckladen einzelner Sicherungsdateien 6 - Zurueckladen und Einspielen der Archivelog-Dateien 7 - Katastrophen-Wiederherstellung 8 - Datenbank-Flashback verwalten 9 - Programmstatus zuruecksetzen Database check and verification 1 - Database system check 2 - Validation of database structure 3 - Verification of database blocks 4 - Reset program status Ueberpruefung und Verifikation der Datenbank 1 - Ueberpruefung des Datenbanksystems 2 - Validierung der Datenbankstruktur 3 - Verifikation der Datenbankbloecke 4 - Programmstatus zuruecksetzen Processing database statistics 1 - Update database statistics 2 - Collect missing statistics 3 - Delete harmful statistics 4 - Manage database statistics 5 - Collect dictionary statistics 6 - Collect system statistics 7 - Reset program status Bearbeitung der Datenbankstatistiken 1 - Datenbankstatistiken aktualisieren 2 - Fehlende Datenbankstatistiken sammeln 3 - Schaedliche Datenbankstatistiken loeschen 4 - Datenbankstatistiken verwalten 5 - Dictionary-Statistiken sammeln 6 - System-Statistiken sammeln 7 - Programmstatus zuruecksetzen Show profiles and logs 1 - Oracle profile 2 - BR*Tools profile 3 - BRBACKUP logs 4 - BRARCHIVE logs 5 - BRRESTORE logs 6 - BRRECOVER logs 7 - BRCONNECT logs 8 - BRSPACE logs Anzeige der Profile und Protokolle 1 - Oracle-Profil 2 - BR*Tools-Profil 3 - BRBACKUP-Protokolle 4 - BRARCHIVE-Protokolle 5 - BRRESTORE-Protokolle 6 - BRRECOVER-Protokolle 7 - BRCONNECT-Protokolle 8 - BRSPACE-Protokolle %s main options for backup and database copy 1 - BRBACKUP profile (profile) ....... [%s] 2 - Backup device type (device) ...... [%s] 3 - Tape volumes for backup (volume) . [%s] 4 - BACKINT/Mount profile (parfile) .. [%s] 5 - Database user/password (user) .... [%s] 6 - Backup type (type) ............... [%s] 7 - Disk backup for backup (backup) .. [%s] 8 - Delete disk backup (delete) ...... [%s] 9 - Files for backup (mode) .......... [%s] %s-Hauptoptionen fuer Sicherung und Datenbankkopie 1 - BRBACKUP-Profil (profile) ................ [%s] 2 - Geraetetyp fuer Sicherung (device) ....... [%s] 3 - Banddatentraeger fuer Sicherung (volume) . [%s] 4 - BACKINT/Mount-Profil (parfile) ........... [%s] 5 - Datenbankbenutzer/-Kennwort (user) ....... [%s] 6 - Sicherungstyp (type) ..................... [%s] 7 - Plattensicherung zum Sichern (backup) .... [%s] 8 - Plattensicherung loeschen (delete) ....... [%s] 9 - Dateien fuer Sicherung (mode) ............ [%s] Additional %s options for backup and database copy 1 - Confirmation mode (confirm) ....... [%s] 2 - Query mode (query) ................ [%s] 3 - Compression mode (compress) ....... [%s] 4 - Verification mode (verify) ........ [%s] 5 - Fill-up previous backups (fillup) . [%s] 6 - Parallel execution (execute) ...... [%s] 7 - Additional output (output) ........ [%s] 8 - Message language (language) ....... [%s] 9 - BRBACKUP command line (command) ... [%s] Weitere %s-Optionen fuer Sicherung und Datenbankkopie 1 - Bestaetigungsmodus (confirm) ........ [%s] 2 - Abfragemodus (query) ................ [%s] 3 - Komprimierungsmodus (compress) ...... [%s] 4 - Verifikationsmodus (verify) ......... [%s] 5 - Auffuellen von Sicherungen (fillup) . [%s] 6 - Parallele Ausfuehrung (execute) ..... [%s] 7 - Zusaetzliche Ausgabe (output) ....... [%s] 8 - Meldungssprache (language) .......... [%s] 9 - BRBACKUP-Kommandozeile (command) .... [%s] %s main options for archivelog backup and verification 1 - BRARCHIVE profile (profile) ...... [%s] 2 - BRARCHIVE function (function) .... [%s] 3 - Backup device type (device) ...... [%s] 4 - Tape volumes for backup (volume) . [%s] 5 - BACKINT/Mount profile (parfile) .. [%s] 6 - Database user/password (user) .... [%s] 7 - Maximum number of files (number) . [%s] 8 - Back up disk backup (archive) .... [%s] %s-Hauptoptionen fuer Archivelog-Sicherung und -Verifikation 1 - BRARCHIVE-Profil (profile) ............... [%s] 2 - BRARCHIVE-Funktion (function) ............ [%s] 3 - Geraetetyp fuer Sicherung (device) ....... [%s] 4 - Banddatentraeger fuer Sicherung (volume) . [%s] 5 - BACKINT/Mount-Profil (parfile) ........... [%s] 6 - Datenbankbenutzer/-Kennwort (user) ....... [%s] 7 - Maximale Anzahl der Dateien (number) ..... [%s] 8 - Plattensicherung sichern (archive) ....... [%s] Additional %s options for archivelog backup 1 - Confirmation mode (confirm) ....... [%s] 2 - Query mode (query) ................ [%s] 3 - Compression mode (compress) ....... [%s] 4 - Verification mode (verify) ........ [%s] 5 - Fill mode, group size (fill) ...... [%s] 6 - Modify mode, delay apply (modify) . [%s] 7 - Additional output (output) ........ [%s] 8 - Message language (language) ....... [%s] 9 - BRARCHIVE command line (command) .. [%s] Weitere %s-Optionen fuer Archivelog-Sicherung 1 - Bestaetigungsmodus (confirm) ........ [%s] 2 - Abfragemodus (query) ................ [%s] 3 - Komprimierungsmodus (compress) ...... [%s] 4 - Verifikationsmodus (verify) ......... [%s] 5 - Fuellmodus, Gruppengroesse (fill) ... [%s] 6 - Modifikation, Verzoegerung (modify) . [%s] 7 - Zusaetzliche Ausgabe (output) ....... [%s] 8 - Meldungssprache (language) .......... [%s] 9 - BRARCHIVE-Kommandozeile (command) ... [%s] BRBACKUP disk backups for backup Pos. Log Start Type Files Status Rc BRBACKUP-Plattensicherungen zum Sichern Pos. Protokoll Start Typ Dateien Status Rc BRBACKUP database backups for verification Pos. Log Start Type Files Device Rc BRBACKUP-Datenbanksicherungen fuer Verifikation Pos. Protokoll Start Typ Dateien Geraet Rc %s main options for verification of database backup 1 - BRRESTORE profile (profile) ....... [%s] 2 - BRBACKUP backup run (backup) ...... [%s] 3 - Verification device type (device) . [%s] 4 - BACKINT/Mount profile (parfile) ... [%s] 5 - Database user/password (user) ..... [%s] 6 - Recovery interval (interval) ...... [%s] 7 - Verification mode (verify) ........ [%s] 8 - Files for verification (mode) ..... [%s] %s-Hauptoptionen fuer Verifikation der Datenbanksicherung 1 - BRRESTORE-Profil (profile) ............. [%s] 2 - BRBACKUP-Sicherungslauf (backup) ....... [%s] 3 - Geraetetyp fuer Verifikation (device) .. [%s] 4 - BACKINT/Mount-Profil (parfile) ......... [%s] 5 - Datenbankbenutzer/-Kennwort (user) ..... [%s] 6 - Wiederherstellungsintervall (interval) . [%s] 7 - Verifikationsmodus (verify) ............ [%s] 8 - Dateien fuer Verifikation (mode) ....... [%s] Additional %s options for verification of database backup 1 - Confirmation mode (confirm) ...... [%s] 2 - Query mode (query) ............... [%s] 3 - Compression mode (compress) ...... [%s] 4 - Parallel execution (execute) ..... [%s] 5 - Additional output (output) ....... [%s] 6 - Message language (language) ...... [%s] 7 - BRRESTORE command line (command) . [%s] Weitere %s-Optionen fuer Verifikation der Datenbanksicherung 1 - Bestaetigungsmodus (confirm) ...... [%s] 2 - Abfragemodus (query) .............. [%s] 3 - Komprimierungsmodus (compress) .... [%s] 4 - Parallele Ausfuehrung (execute) ... [%s] 5 - Zusaetzliche Ausgabe (output) ..... [%s] 6 - Meldungssprache (language) ........ [%s] 7 - BRRESTORE-Kommandozeile (command) . [%s] BRARCHIVE archivelog backups for verification Pos. Log Start Device Rc Copy First Last BRARCHIVE-Archivelog-Sicherungen fuer Verifikation Pos. Protokoll Start Geraet Rc Kopie Erste Letzte BRRESTORE main options for verification of archivelog backup of database instance %s 1 - BRRESTORE profile (profile) ....... [%s] 2 - First sequence number (first_seq) . [%s] 3 - Last sequence number (last_seq) ... [%s] 4 - Verification device type (device) . [%s] 5 - BACKINT/Mount profile (parfile) ... [%s] 6 - Database user/password (user) ..... [%s] 7 - Recovery interval (interval) ...... [%s] 8 - Verification mode (verify) ........ [%s] 9 - Verify second copy (sec_copy) ..... [%s] BRRESTORE-Hauptoptionen fuer Verifikation der Archivelog-Sicherung von Datenbankinstanz %s 1 - BRRESTORE-Profil (profile) ............. [%s] 2 - Erste Sequenznummer (first_seq) ........ [%s] 3 - Letzte Sequenznummer (last_seq) ........ [%s] 4 - Geraetetyp fuer Verifikation (device) .. [%s] 5 - BACKINT/Mount-Profil (parfile) ......... [%s] 6 - Datenbankbenutzer/-Kennwort (user) ..... [%s] 7 - Wiederherstellungsintervall (interval) . [%s] 8 - Verifikationsmodus (verify) ............ [%s] 9 - Zweite Kopie verifizieren (sec_copy) ... [%s] Additional BRRESTORE options for verification of archivelog backup of database instance %s 1 - Confirmation mode (confirm) ...... [%s] 2 - Query mode (query) ............... [%s] 3 - Compression mode (compress) ...... [%s] 4 - Additional output (output) ....... [%s] 5 - Message language (language) ...... [%s] 6 - BRRESTORE command line (command) . [%s] Weitere BRRESTORE-Optionen fuer Verifikation der Archivelog-Sicherung von Datenbankinstanz %s 1 - Bestaetigungsmodus (confirm) ...... [%s] 2 - Abfragemodus (query) .............. [%s] 3 - Komprimierungsmodus (compress) .... [%s] 4 - Zusaetzliche Ausgabe (output) ..... [%s] 5 - Meldungssprache (language) ........ [%s] 6 - BRRESTORE-Kommandozeile (command) . [%s] %s options for determination of compression rates 1 - BRBACKUP profile (profile) ...... [%s] 2 - Database user/password (user) ... [%s] 3 - BRBACKUP run type (type) ........ [%s] 4 - Files for compression (mode) .... [%s] 5 - Confirmation mode (confirm) ..... [%s] 6 - Query mode (query) .............. [%s] 7 - Parallel execution (execute) .... [%s] 8 - Additional output (output) ...... [%s] 9 - Message language (language) ..... [%s] 10 - BRBACKUP command line (command) . [%s] %s-Optionen fuer Bestimmung der Komprimierungsraten 1 - BRBACKUP-Profil (profile) .......... [%s] 2 - Datenbankbenutzer/-Kennwort (user) . [%s] 3 - BRBACKUP-Laufstyp (type) ........... [%s] 4 - Dateien fuer Komprimierung (mode) .. [%s] 5 - Bestaetigungsmodus (confirm) ....... [%s] 6 - Abfragemodus (query) ............... [%s] 7 - Parallele Ausfuehrung (execute) .... [%s] 8 - Zusaetzliche Ausgabe (output) ...... [%s] 9 - Meldungssprache (language) ......... [%s] 10 - BRBACKUP-Kommandozeile (command) ... [%s] %s options for RMAN preparation 1 - BRBACKUP profile (profile) ...... [%s] 2 - Database user/password (user) ... [%s] 3 - BRBACKUP run type (type) ........ [%s] 4 - Files for preparation (mode) .... [%s] 5 - Confirmation mode (confirm) ..... [%s] 6 - Query mode (query) .............. [%s] 7 - Parallel execution (execute) .... [%s] 8 - Additional output (output) ...... [%s] 9 - Message language (language) ..... [%s] 10 - BRBACKUP command line (command) . [%s] %s-Optionen fuer RMAN-Vorbereitung 1 - BRBACKUP-Profil (profile) .......... [%s] 2 - Datenbankbenutzer/-Kennwort (user) . [%s] 3 - BRBACKUP-Laufstyp (type) ........... [%s] 4 - Dateien fuer Vorbereitung (mode) ... [%s] 5 - Bestaetigungsmodus (confirm) ....... [%s] 6 - Abfragemodus (query) ............... [%s] 7 - Parallele Ausfuehrung (execute) .... [%s] 8 - Zusaetzliche Ausgabe (output) ...... [%s] 9 - Meldungssprache (language) ......... [%s] 10 - BRBACKUP-Kommandozeile (command) ... [%s] BRBACKUP disk backups for deletion Pos. Log Start Type Files Status Rc BRBACKUP-Plattensicherungen zum Loeschen Pos. Protokoll Start Typ Dateien Status Rc %s options for deletion of disk backups 1 - BRBACKUP profile (profile) ...... [%s] 2 - Database user/password (user) ... [%s] 3 - BRBACKUP backup run (backup) .... [%s] 4 - Files for delete (mode) ......... [%s] 5 - Confirmation mode (confirm) ..... [%s] 6 - Query mode (query) .............. [%s] 7 - Additional output (output) ...... [%s] 8 - Message language (language) ..... [%s] 9 - BRBACKUP command line (command) . [%s] %s-Optionen fuer Loeschen der Plattensicherungen 1 - BRBACKUP-Profil (profile) .......... [%s] 2 - Datenbankbenutzer/-Kennwort (user) . [%s] 3 - BRBACKUP-Sicherungslauf (backup) ... [%s] 4 - Dateien fuer Loeschen (mode) ....... [%s] 5 - Bestaetigungsmodus (confirm) ....... [%s] 6 - Abfragemodus (query) ............... [%s] 7 - Zusaetzliche Ausgabe (output) ...... [%s] 8 - Meldungssprache (language) ......... [%s] 9 - BRBACKUP-Kommandozeile (command) ... [%s] %s options for deletion of disk backups 1 - BRARCHIVE profile (profile) ......... [%s] 2 - Database user/password (user) ....... [%s] 3 - Backup device type (device) ......... [%s] 4 - Delete after second copy (sec_copy) . [%s] 5 - Maximum number of files (number) .... [%s] 6 - Confirmation mode (confirm) ......... [%s] 7 - Query mode (query) .................. [%s] 8 - Additional output (output) .......... [%s] 9 - Message language (language) ......... [%s] 10 - BRARCHIVE command line (command) .... [%s] %s-Optionen fuer Loeschen der Plattensicherungen 1 - BRARCHIVE-Profil (profile) ............ [%s] 2 - Datenbankbenutzer/-Kennwort (user) .... [%s] 3 - Geraetetyp fuer Sicherung (device) .... [%s] 4 - Loeschen nach zweite Kopie (sec_copy) . [%s] 5 - Maximale Anzahl der Dateien (number) .. [%s] 6 - Bestaetigungsmodus (confirm) .......... [%s] 7 - Abfragemodus (query) .................. [%s] 8 - Zusaetzliche Ausgabe (output) ......... [%s] 9 - Meldungssprache (language) ............ [%s] 10 - BRARCHIVE-Kommandozeile (command) ..... [%s] Options for controlling of %s run with option '-f' 1 - BRARCHIVE profile (profile) ...... [%s] 2 - Run control function (function) .. [%s] 3 - Confirmation mode (confirm) ...... [%s] 4 - Message language (language) ...... [%s] 5 - BRARCHIVE command line (command) . [%s] Optionen fuer Steuerung des %s-Laufs mit Option '-f' 1 - BRARCHIVE-Profil (profile) ........ [%s] 2 - Laufsteuerungsfunktion (function) . [%s] 3 - Bestaetigungsmodus (confirm) ...... [%s] 4 - Meldungssprache (language) ........ [%s] 5 - BRARCHIVE-Kommandozeile (command) . [%s] Options for initialization of %s tape volumes 1 - BRBACKUP profile (profile) ....... [%s] 2 - Initialization type (initialize) . [%s] 3 - Number of volumes (number) ....... [%s] 4 - Confirmation mode (confirm) ...... [%s] 5 - Message language (language) ...... [%s] 6 - Tape volume names (volume) ....... [%s] 7 - BRBACKUP command line (command) .. [%s] Optionen fuer Initialisierung der %s-Banddatentraeger 1 - BRBACKUP-Profil (profile) ........... [%s] 2 - Initialisierungstyp (initialize) .... [%s] 3 - Anzahl der Datentraeger (number) .... [%s] 4 - Bestaetigungsmodus (confirm) ........ [%s] 5 - Meldungssprache (language) .......... [%s] 6 - Namen der Banddatentraeger (volume) . [%s] 7 - BRBACKUP-Kommandozeile (command) .... [%s] Options for initialization of %s tape volumes 1 - BRARCHIVE profile (profile) ...... [%s] 2 - Initialization type (initialize) . [%s] 3 - Number of volumes (number) ....... [%s] 4 - Confirmation mode (confirm) ...... [%s] 5 - Message language (language) ...... [%s] 6 - Tape volume names (volume) ....... [%s] 7 - BRARCHIVE command line (command) . [%s] Optionen fuer Initialisierung der %s-Banddatentraeger 1 - BRARCHIVE-Profil (profile) .......... [%s] 2 - Initialisierungstyp (initialize) .... [%s] 3 - Anzahl der Datentraeger (number) .... [%s] 4 - Bestaetigungsmodus (confirm) ........ [%s] 5 - Meldungssprache (language) .......... [%s] 6 - Namen der Banddatentraeger (volume) . [%s] 7 - BRARCHIVE-Kommandozeile (command) ... [%s] %s options for restore and recovery 1 - Recovery type (type) ............. [%s] 2 - BRRECOVER profile (profile) ...... [%s] 3 - BACKINT/Mount profile (parfile) .. [%s] 4 - Database user/password (user) .... [%s] 5 - Recovery interval (interval) ..... [%s] 6 - Confirmation mode (confirm) ...... [%s] 7 - Scrolling line count (scroll) .... [%s] 8 - Message language (language) ...... [%s] 9 - BRRECOVER command line (command) . [%s] %s-Optionen fuer Zurueckladen und Wiederherstellung 1 - Recovery-Typ (type) .................... [%s] 2 - BRRECOVER-Profil (profile) ............. [%s] 3 - BACKINT/Mount-Profil (parfile) ......... [%s] 4 - Datenbankbenutzer/-Kennwort (user) ..... [%s] 5 - Wiederherstellungsintervall (interval) . [%s] 6 - Bestaetigungsmodus (confirm) ........... [%s] 7 - Zeilenanzahl fuer Scrolling (scroll) ... [%s] 8 - Meldungssprache (language) ............. [%s] 9 - BRRECOVER-Kommandozeile (command) ...... [%s] %s options for disaster recovery 1 - BRRECOVER profile (profile) ...... [%s] 2 - Restore device type (device) ..... [%s] 3 - BACKINT/Mount profile (parfile) .. [%s] 4 - Recovery interval (interval) ..... [%s] 5 - Confirmation mode (confirm) ...... [%s] 6 - Scrolling line count (scroll) .... [%s] 7 - Message language (language) ...... [%s] 8 - BRRECOVER command line (command) . [%s] %s-Otionen fuer Katastrophen-Wiederherstellung 1 - BRRECOVER-Profil (profile) ............. [%s] 2 - Geraetetyp fuer Zurueckladen (device) .. [%s] 3 - BACKINT/Mount-Profil (parfile) ......... [%s] 4 - Wiederherstellungsintervall (interval) . [%s] 5 - Bestaetigungsmodus (confirm) ........... [%s] 6 - Zeilenanzahl fuer Scrolling (scroll) ... [%s] 7 - Meldungssprache (language) ............. [%s] 8 - BRRECOVER-Kommandozeile (command) ...... [%s] %s main options for database system check 1 - BRCONNECT profile (profile) .......... [%s] 2 - Database user/password (user) ........ [%s] 3 - Use default check settings (default) . [%s] 4 - Database owner for check (owner) ..... [%s] 5 - Ignore DBCHECKORA table (ignore) ..... [%s] 6 - Ignore DBSTATC table (igndbs) ........ [%s] 7 - Exclude from check (exclude) ......... [%s] %s-Hauptoptionen fuer Ueberpruefung des Datenbanksystems 1 - BRCONNECT-Profil (profile) ................... [%s] 2 - Datenbankbenutzer/-Kennwort (user) ........... [%s] 3 - Benutze Pruefvoreinstellungen (default) ...... [%s] 4 - Datenbankbesitzer fuer Ueberpruefung (owner) . [%s] 5 - DBCHECKORA-Tabelle ignorieren (ignore) ....... [%s] 6 - DBSTATC-Tabelle ignorieren (igndbs) .......... [%s] 7 - Von Ueberpruefung ausschliessen (exclude) .... [%s] Additional %s options for database system check 1 - Confirmation mode (confirm) ...... [%s] 2 - Query mode (query) ............... [%s] 3 - Extended output (output) ......... [%s] 4 - Message language (language) ...... [%s] 5 - BRCONNECT command line (command) . [%s] Weitere %s-Optionen fuer Ueberpruefung des Datenbanksystems 1 - Bestaetigungsmodus (confirm) ...... [%s] 2 - Abfragemodus (query) .............. [%s] 3 - Erweiterte Ausgabe (output) ....... [%s] 4 - Meldungssprache (language) ........ [%s] 5 - BRCONNECT-Kommandozeile (command) . [%s] %s main options for validation of database structure 1 - BRCONNECT profile (profile) ......... [%s] 2 - Database user/password (user) ....... [%s] 3 - Validate mode (validate) ............ [%s] 4 - Database owner for validate (owner) . [%s] 5 - Exclude from validate (exclude) ..... [%s] 6 - Tables for validate (table) ......... [%s] %s-Hauptoptionen fuer Validierung der Datenbankstruktur 1 - BRCONNECT-Profil (profile) ................. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ......... [%s] 3 - Validierungsmodus (validate) ............... [%s] 4 - Datenbankbesitzer fuer Validierung (owner) . [%s] 5 - Von Validierung ausschliessen (exclude) .... [%s] 6 - Tabellen fuer Validierung (table) .......... [%s] Additional %s options for validation of database structure 1 - Confirmation mode (confirm) ...... [%s] 2 - Query mode (query) ............... [%s] 3 - Parallel threads (parallel) ...... [%s] 4 - Time limit in minutes (limit) .... [%s] 5 - Force time limit (force) ......... [%s] 6 - Extended output (output) ......... [%s] 7 - Message language (language) ...... [%s] 8 - BRCONNECT command line (command) . [%s] Weitere %s-Optionen fuer Validierung der Datenbankstruktur 1 - Bestaetigungsmodus (confirm) ...... [%s] 2 - Abfragemodus (query) .............. [%s] 3 - Parallele Threads (parallel) ...... [%s] 4 - Zeitlimit in Minuten (limit) ...... [%s] 5 - Erzwinge Zeitlimit (force) ........ [%s] 6 - Erweiterte Ausgabe (output) ....... [%s] 7 - Meldungssprache (language) ........ [%s] 8 - BRCONNECT-Kommandozeile (command) . [%s] %s main options for verification of database blocks 1 - BRBACKUP profile (profile) .... [%s] 2 - Database user/password (user) . [%s] 3 - BRBACKUP run type (type) ...... [%s] 4 - Verification mode (verify) .... [%s] 5 - Files for verification (mode) . [%s] %s-Hauptoptionen fuer Verifikation der Datenbankbloecke 1 - BRBACKUP-Profil (profile) .......... [%s] 2 - Datenbankbenutzer/-Kennwort (user) . [%s] 3 - BRBACKUP-Laufstyp (type) ........... [%s] 4 - Verifikationsmodus (verify) ........ [%s] 5 - Dateien fuer Verification (mode) ... [%s] Additional %s options for verification of database blocks 1 - Confirmation mode (confirm) ..... [%s] 2 - Query mode (query) .............. [%s] 3 - Parallel execution (execute) .... [%s] 4 - Additional output (output) ...... [%s] 5 - Message language (language) ..... [%s] 6 - BRBACKUP command line (command) . [%s] Weitere %s-Optionen fuer Verifikation der Datenbankbloecke 1 - Bestaetigungsmodus (confirm) ..... [%s] 2 - Abfragemodus (query) ............. [%s] 3 - Parallele Ausfuehrung (execute) .. [%s] 4 - Zusaetzliche Ausgabe (output) .... [%s] 5 - Meldungssprache (language) ....... [%s] 6 - BRBACKUP-Kommandozeile (command) . [%s] %s main options for update statistics 1 - BRCONNECT profile (profile) ......... [%s] 2 - Database user/password (user) ....... [%s] 3 - Collection method (method) .......... [%s] 4 - Sample size (sample) ................ [%s] 5 - Bucket count (buckets) .............. [%s] 6 - DBMS_STATS parallel degree (degree) . [%s] 7 - Change threshold (change) ........... [%s] 8 - Database owner for update (owner) ... [%s] 9 - Ignore DBSTATC table (ignore) ....... [%s] 10 - Exclude from update (exclude) ....... [%s] 11 - Tables for update (table) ........... [%s] %s-Hauptoptionen fuer Aktualisierung der Statistiken 1 - BRCONNECT-Profil (profile) .................... [%s] 2 - Datenbankbenutzer/-Kennwort (user) ............ [%s] 3 - Sammlungsmethode (method) ..................... [%s] 4 - Probengroesse (sample) ........................ [%s] 5 - Anzahl der Koerbchen (buckets) ................ [%s] 6 - DBMS_STATS Parallelitaetsgrad (degree) ........ [%s] 7 - Aenderungsschwellwert (change) ................ [%s] 8 - Datenbankbesitzer fuer Aktualisierung (owner) . [%s] 9 - DBSTATC-Tabelle ignorieren (ignore) ........... [%s] 10 - Von Aktualisierung ausschliessen (exclude) .... [%s] 11 - Tabellen fuer Aktualisierung (table) .......... [%s] Additional %s options for update statistics 1 - Confirmation mode (confirm) ......... [%s] 2 - Query mode (query) .................. [%s] 3 - Parallel threads (parallel) ......... [%s] 4 - Update history tables (history) ..... [%s] 5 - Retain old statistics (retain) ...... [%s] 6 - Time limit in minutes (limit) ....... [%s] 7 - Force options (force) ............... [%s] 8 - Time interval in minutes (interval) . [%s] 9 - Extended output (output) ............ [%s] 10 - Message language (language) ......... [%s] 11 - BRCONNECT command line (command) .... [%s] Weitere %s-Optionen fuer Aktualisierung der Statistiken 1 - Bestaetigungsmodus (confirm) ............. [%s] 2 - Abfragemodus (query) ..................... [%s] 3 - Parallele Threads (parallel) ............. [%s] 4 - Historietabellen aktualisieren (history) . [%s] 5 - Alte Statistiken aufbewahren (retain) .... [%s] 6 - Zeitlimit in Minuten (limit) ............. [%s] 7 - Zwangsoptionen (force) ................... [%s] 8 - Zeitinterval in Minuten (interval) ....... [%s] 9 - Erweiterte Ausgabe (output) .............. [%s] 10 - Meldungssprache (language) ............... [%s] 11 - BRCONNECT-Kommandozeile (command) ........ [%s] %s main options for collection of missing statistics 1 - BRCONNECT profile (profile) ......... [%s] 2 - Database user/password (user) ....... [%s] 3 - Collection method (method) .......... [%s] 4 - Sample size (sample) ................ [%s] 5 - Bucket count (buckets) .............. [%s] 6 - DBMS_STATS parallel degree (degree) . [%s] 7 - Change threshold (change) ........... [%s] 8 - Database owner for collect (owner) .. [%s] 9 - Ignore DBSTATC table (ignore) ....... [%s] 10 - Exclude from collect (exclude) ...... [%s] 11 - Tables for collect (table) .......... [%s] %s-Hauptoptionen fuer Sammlung der fehlenden Statistiken 1 - BRCONNECT-Profil (profile) .............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ...... [%s] 3 - Sammlungsmethode (method) ............... [%s] 4 - Probengroesse (sample) .................. [%s] 5 - Anzahl der Koerbchen (buckets) .......... [%s] 6 - DBMS_STATS Parallelitaetsgrad (degree) .. [%s] 7 - Aenderungsschwellwert (change) .......... [%s] 8 - Datenbankbesitzer fuer Sammlung (owner) . [%s] 9 - DBSTATC-Tabelle ignorieren (ignore) ..... [%s] 10 - Von Sammlung ausschliessen (exclude) .... [%s] 11 - Tabellen fuer Sammlung (table) .......... [%s] Additional %s options for collection of missing statistics 1 - Confirmation mode (confirm) ...... [%s] 2 - Query mode (query) ............... [%s] 3 - Parallel threads (parallel) ...... [%s] 4 - Update history tables (history) .. [%s] 5 - Retain old statistics (retain) ... [%s] 6 - Time limit in minutes (limit) .... [%s] 7 - Force options (force) ............ [%s] 8 - Extended output (output) ......... [%s] 9 - Message language (language) ...... [%s] 10 - BRCONNECT command line (command) . [%s] Weitere %s-Optionen fuer Sammlung der fehlenden Statistiken 1 - Bestaetigungsmodus (confirm) ............. [%s] 2 - Abfragemodus (query) ..................... [%s] 3 - Parallele Threads (parallel) ............. [%s] 4 - Historietabellen aktualisieren (history) . [%s] 5 - Alte Statistiken aufbewahren (retain) .... [%s] 6 - Zeitlimit in Minuten (limit) ............. [%s] 7 - Zwangsoptionen (force) ................... [%s] 8 - Erweiterte Ausgabe (output) .............. [%s] 9 - Meldungssprache (language) ............... [%s] 10 - BRCONNECT-Kommandozeile (command) ........ [%s] %s main options for deletion of harmful statistics 1 - BRCONNECT profile (profile) ....... [%s] 2 - Database user/password (user) ..... [%s] 3 - Database owner for delete (owner) . [%s] 4 - Ignore DBSTATC table (ignore) ..... [%s] 5 - Exclude from delete (exclude) ..... [%s] 6 - Tables for delete (table) ......... [%s] %s-Hauptoptionen fuer Loeschen der schaedlichen Statistiken 1 - BRCONNECT-Profil (profile) .............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ...... [%s] 3 - Datenbankbesitzer fuer Loeschen (owner) . [%s] 4 - DBSTATC-Tabelle ignorieren (ignore) ..... [%s] 5 - Von Loeschen ausschliessen (exclude) .... [%s] 6 - Tabellen fuer Loeschen (table) .......... [%s] Additional %s options for deletion of harmful statistics 1 - Confirmation mode (confirm) ...... [%s] 2 - Query mode (query) ............... [%s] 3 - Force options (force) ............ [%s] 4 - Extended output (output) ......... [%s] 5 - Message language (language) ...... [%s] 6 - BRCONNECT command line (command) . [%s] Weitere %s-Optionen fuer Loeschen der schaedlichen Statistiken 1 - Bestaetigungsmodus (confirm) ...... [%s] 2 - Abfragemodus (query) .............. [%s] 3 - Zwangsoptionen (force) ............ [%s] 4 - Erweiterte Ausgabe (output) ....... [%s] 5 - Meldungssprache (language) ........ [%s] 6 - BRCONNECT-Kommandozeile (command) . [%s] Display of BRBACKUP logs Pos. Log Start Type Mode Device Rc Anzeige der BRBACKUP-Protokolle Pos. Protokoll Start Typ Modus Geraet Rc Display of BRARCHIVE logs Pos. Log Start Function Device Rc Anzeige der BRARCHIVE-Protokolle Pos. Protokoll Start Funktion Geraet Rc Display of BRRESTORE logs Pos. Log Start Type Device Rc Anzeige der BRRESTORE-Protokolle Pos. Protokoll Start Typ Geraet Rc Display of BRRECOVER logs Pos. Log Start Type Rc Anzeige der BRRECOVER-Protokolle Pos. Protokoll Start Typ Rc Display of BRCONNECT logs Pos. Log Start Function Rc Object Anzeige der BRCONNECT-Protokolle Pos. Protokoll Start Funktion Rc Objekt Display of BRSPACE logs Pos. Log Start Function Rc Objects Anzeige der BRSPACE-Protokolle Pos. Protokoll Start Funktion Rc Objekte %s main options for cleanup of DBA logs (1) 1 - BRCONNECT profile (profile) ........ [%s] 2 - Database user/password (user) ...... [%s] 3 - Database owner for cleanup (owner) . [%s] 4 - BRBACKUP logs (backup) ............. [%s] 5 - BRARCHIVE logs (archive) ........... [%s] 6 - BRRESTORE logs (restore) ........... [%s] 7 - BRRECOVER logs (recover) ........... [%s] 8 - BRCONNECT logs (connect) ........... [%s] 9 - BRSPACE logs (space) ............... [%s] %s-Hauptoptionen fuer Aufraeumen von DBA-Protokollen (1) 1 - BRCONNECT-Profil (profile) ................ [%s] 2 - Datenbankbenutzer/-Kennwort (user) ........ [%s] 3 - Datenbankbesitzer fuer Aufraeumen (owner) . [%s] 4 - BRBACKUP-Protokolle (backup) .............. [%s] 5 - BRARCHIVE-Protokolle (archive) ............ [%s] 6 - BRRESTORE-Protokolle (restore) ............ [%s] 7 - BRRECOVER-Protokolle (recover) ............ [%s] 8 - BRCONNECT-Protokolle (connect) ............ [%s] 9 - BRSPACE-Protokolle (space) ................ [%s] %s main options for cleanup of DBA logs (2) 1 - BRBACKUP disk backups (diskback) ......... [%s] 2 - BRARCHIVE disk backups (diskarch) ........ [%s] 3 - BRSPACE export dumps (expdump) ........... [%s] 4 - Oracle trace files (trace) ............... [%s] 5 - Database logs in SDBAH and SDBAD (dblog) . [%s] 6 - XDB logs in DBA-tables (xdblog) .......... [%s] 7 - Check messages in DBMSGORA (checkmsg) .... [%s] %s-Hauptoptionen fuer Aufraeumen von DBA-Protokollen (2) 1 - BRABCKUP-Plattensicherungen (backup) ........... [%s] 2 - BRARCHIVE-Plattensicherungen (archive) ......... [%s] 3 - BRSPACE-Exportdumps (expdump) .................. [%s] 4 - Oracle-Trace-Dateien (trace) ................... [%s] 5 - Datenbankprotokolle in SDBAH und SDBAD (dblog) . [%s] 6 - XDB-Protokolle in DBA-Tabelen (xdblog) ......... [%s] 7 - Pruemeldungen in DBMSGORA (checkmsg) ........... [%s] Additional %s options for cleanup of DBA logs 1 - Confirmation mode (confirm) ......... [%s] 2 - Query mode (query) .................. [%s] 3 - Clean up selected logs only (limit) . [%s] 4 - Extended output (output) ............ [%s] 5 - Message language (language) ......... [%s] 6 - BRCONNECT command line (command) .... [%s] Weitere %s-Optionen fuer Aufraeumen von DBA-Protokollen 1 - Bestaetigungsmodus (confirm) ................... [%s] 2 - Abfragemodus (query) ........................... [%s] 3 - Nur ausgewaehlte Protokolle aufraeumen (limit) . [%s] 4 - Erweiterte Ausgabe (output) .................... [%s] 5 - Meldungssprache (language) ..................... [%s] 6 - BRCONNECT-Kommandozeile (command) .............. [%s] %s main options for adaption of NEXT extents 1 - BRCONNECT profile (profile) ...... [%s] 2 - Database user/password (user) .... [%s] 3 - Database owner for adapt (owner) . [%s] 4 - Maximum extent size in KB (max) .. [%s] 5 - Maximum extent count (limit) ..... [%s] 6 - Special NEXT extents (special) ... [%s] 7 - Exclude from adapt (exclude) ..... [%s] 8 - Tables for adapt (table) ......... [%s] %s-Hauptoptionen fuer Anpassung von NEXT-Extents 1 - BRCONNECT-Profil (profile) ............... [%s] 2 - Datenbankbenutzer/-Kennwort (user) ....... [%s] 3 - Datenbankbesitzer fuer Anpassung (owner) . [%s] 4 - Maximale Extent-Groesse in KB (max) ...... [%s] 5 - Maximale Anzahl der Extents (limit) ...... [%s] 6 - Spezielle NEXT-Extents (special) ......... [%s] 7 - Von Anpassung ausschliessen (exclude) .... [%s] 8 - Tabellen fuer Anpassung (table) .......... [%s] Additional %s options for adaption of NEXT extents 1 - Confirmation mode (confirm) ...... [%s] 2 - Query mode (query) ............... [%s] 3 - Force options (force) ............ [%s] 4 - Extended output (output) ......... [%s] 5 - Message language (language) ...... [%s] 6 - BRCONNECT command line (command) . [%s] Weitere %s-Optionen fuer Anpassung von NEXT-Extents 1 - Bestaetigungsmodus (confirm) ...... [%s] 2 - Abfragemodus (query) .............. [%s] 3 - Zwangsoptionen (force) ............ [%s] 4 - Erweiterte Ausgabe (output) ....... [%s] 5 - Meldungssprache (language) ........ [%s] 6 - BRCONNECT-Kommandozeile (command) . [%s] %s options for changing password of database user 1 - BRCONNECT profile (profile) ............... [%s] 2 - Database user/password (user) ............. [%s] 3 - Database owner to change password (owner) . [%s] 4 - User type for secure storage (secstore) ... [%s] 5 - Log file name (log) ....................... [%s] 6 - Message language (language) ............... [%s] 7 - BRCONNECT command line (command) .......... [%s] %s-Optionen fuer Aenderung des Kennworts von Datenbankbenutzer 1 - BRCONNECT-Profil (profile) ....................... [%s] 2 - Datenbankbenutzer/-Kennwort (user) ............... [%s] 3 - Datanbankbesitzer fuer Kennwortaenderung (owner) . [%s] 4 - Benutzertyp fuer Secure-Storage (secstore) ....... [%s] 5 - Name der Protokolldatei (log) .................... [%s] 6 - Meldungssprache (language) ....................... [%s] 7 - BRCONNECT-Kommandozeile (command) ................ [%s] %s options for creation of SAP/DBA synonyms 1 - BRCONNECT profile (profile) ......... [%s] 2 - Database user/password (user) ....... [%s] 3 - Database owner for synonyms (owner) . [%s] 4 - Log file name (log) ................. [%s] 5 - Message language (language) ......... [%s] 6 - BRCONNECT command line (command) .... [%s] %s-Optionen fuer Anlegen der SAP/DBA-Synonyme 1 - BRCONNECT-Profil (profile) .............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ...... [%s] 3 - Datenbankbesitzer fuer Synonyme (owner) . [%s] 4 - Name der Protokolldatei (log) ........... [%s] 5 - Meldungssprache (language) .............. [%s] 6 - BRCONNECT-Kommandozeile (command) ....... [%s] %s main options for managing database statistics 1 - BRSPACE profile (profile) ..... [%s] 2 - Database user/password (user) . [%s] 3 - Statistics action (action) .... [%s] 4 - Statistics export Id (expid) .. [%s] 5 - Tablespace names (tablespace) . [%s] 6 - Table owner (owner) ........... [%s] 7 - Table names (table) ........... [%s] %s-Hauptoptionen fuer Verwaltung von Datenbankstatistiken 1 - BRSPACE-Profil (profile) ........... [%s] 2 - Datenbankbenutzer/-Kennwort (user) . [%s] 3 - Statistikaktion (action) ........... [%s] 4 - Statistikexport-Id (expid) ......... [%s] 5 - Tablespace-Namen (tablespace) ...... [%s] 6 - Tabellen-Besitzer (owner) .......... [%s] 7 - Tabellen-Namen (table) ............. [%s] Additional %s options for managing database statistics 1 - Confirmation mode (confirm) .... [%s] 2 - Extended output (output) ....... [%s] 3 - Scrolling line count (scroll) .. [%s] 4 - Message language (language) .... [%s] 5 - BRSPACE command line (command) . [%s] Weitere %s-Optionen fuer Verwaltung von Datenbankstatistiken 1 - Bestaetigungsmodus (confirm) ......... [%s] 2 - Erweiterte Ausgabe (output) .......... [%s] 3 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 4 - Meldungssprache (language) ........... [%s] 5 - BRSPACE-Kommandozeile (command) ...... [%s] %s main options for managing flashback database 1 - BRSPACE profile (profile) ...... [%s] 2 - Database user/password (user) .. [%s] 3 - Flashback action (action) ...... [%s] 4 - Restore point (point) .......... [%s] 5 - Confirmation mode (confirm) .... [%s] 6 - Scrolling line count (scroll) .. [%s] 7 - Message language (language) .... [%s] 8 - BRSPACE command line (command) . [%s] %s-Hauptoptionen fuer Verwaltung von Datenbank-Flashback 1 - BRSPACE-Profil (profile) ............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ... [%s] 3 - Flashback-Aktion (action) ............ [%s] 4 - Restore-Point (point) ................ [%s] 5 - Bestaetigungsmodus (confirm) ......... [%s] 6 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 7 - Meldungssprache (language) ........... [%s] 8 - BRSPACE-Kommandozeile (command) ...... [%s] %s options for collection of dictionary statistics 1 - BRCONNECT profile (profile) ......... [%s] 2 - Database user/password (user) ....... [%s] 3 - Collection method (method) .......... [%s] 4 - Sample size (sample) ................ [%s] 5 - DBMS_STATS parallel degree (degree) . [%s] 6 - Force options (force) ............... [%s] 7 - Confirmation mode (confirm) ......... [%s] 8 - Message language (language) ......... [%s] 9 - BRCONNECT command line (command) .... [%s] %s-Optionen fuer Sammlung der Dictionary-Statistiken 1 - BRCONNECT-Profil (profile) ............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ..... [%s] 3 - Sammlungsmethode (method) .............. [%s] 4 - Probengroesse (sample) ................. [%s] 5 - DBMS_STATS Parallelitaetsgrad (degree) . [%s] 6 - Zwangsoptionen (force) ................. [%s] 7 - Bestaetigungsmodus (confirm) ........... [%s] 8 - Meldungssprache (language) ............. [%s] 9 - BRCONNECT-Kommandozeile (command) ...... [%s] %s options for collection of system statistics 1 - BRCONNECT profile (profile) ......... [%s] 2 - Database user/password (user) ....... [%s] 3 - NOWORKLOAD mode (noworkload) ........ [%s] 4 - Time interval in minutes (interval) . [%s] 5 - Confirmation mode (confirm) ......... [%s] 6 - Message language (language) ......... [%s] 7 - BRCONNECT command line (command) .... [%s] %s-Optionen fuer Sammlung der System-Statistiken 1 - BRCONNECT-Profil (profile) ......... [%s] 2 - Datenbankbenutzer/-Kennwort (user) . [%s] 3 - NOWORKLOAD-Modus (noworkload) ...... [%s] 4 - Bestaetigungsmodus (confirm) ....... [%s] 5 - Zeitinterval in Minuten (interval) . [%s] 6 - Meldungssprache (language) ......... [%s] 7 - BRCONNECT-Kommandozeile (command) .. [%s] Changing password of database user %s 1 - New database password (password) ......... [%s] 2 - Confirmation of new password (password2) . [%s] Aenderung des Kennworts von Datenbankbenutzer %s 1 - Neues Datenbankkennwort (password) ........... [%s] 2 - Bestaetigung des neuen Kennworts (password2) . [%s] %s options for database instance startup 1 - BRSPACE profile (profile) ...... [%s] 2 - Database user/password (user) .. [%s] 3 - Database instance (instance) ... [%s] 4 - Confirmation mode (confirm) .... [%s] 5 - Message language (language) .... [%s] 6 - BRSPACE command line (command) . [%s] %s-Optionen fuer Starten der Datenbankinstanz 1 - BRSPACE-Profil (profile) ........... [%s] 2 - Datenbankbenutzer/-Kennwort (user) . [%s] 3 - Datenbankinstanz (instance) ........ [%s] 4 - Bestaetigungsmodus (confirm) ....... [%s] 5 - Meldungssprache (language) ......... [%s] 6 - BRSPACE-Kommandozeile (command) .... [%s] %s options for database instance shutdown 1 - BRSPACE profile (profile) ...... [%s] 2 - Database user/password (user) .. [%s] 3 - Database instance (instance) ... [%s] 4 - Confirmation mode (confirm) .... [%s] 5 - Message language (language) .... [%s] 6 - BRSPACE command line (command) . [%s] %s-Optionen fuer Stoppen der Datenbankinstanz 1 - BRSPACE-Profil (profile) ........... [%s] 2 - Datenbankbenutzer/-Kennwort (user) . [%s] 3 - Datenbankinstanz (instance) ........ [%s] 4 - Bestaetigungsmodus (confirm) ....... [%s] 5 - Meldungssprache (language) ......... [%s] 6 - BRSPACE-Kommandozeile (command) .... [%s] %s options for alter database instance 1 - BRSPACE profile (profile) ...... [%s] 2 - Database user/password (user) .. [%s] 3 - Alter database action (action) . [%s] 4 - Database instance (instance) ... [%s] 5 - Confirmation mode (confirm) .... [%s] 6 - Message language (language) .... [%s] 7 - BRSPACE command line (command) . [%s] %s-Optionen fuer Aenderung von Datenbankinstanz 1 - BRSPACE-Profil (profile) ............ [%s] 2 - Datenbankbenutzer/-Kennwort (user) .. [%s] 3 - Datenbank-Aenderungsaktion (action) . [%s] 4 - Datenbankinstanz (instance) ......... [%s] 5 - Bestaetigungsmodus (confirm) ........ [%s] 6 - Meldungssprache (language) .......... [%s] 7 - BRSPACE-Kommandozeile (command) ..... [%s] %s options for alter database parameter 1 - BRSPACE profile (profile) ....... [%s] 2 - Database user/password (user) ... [%s] 3 - Alter parameter action (action) . [%s] 4 - Database parameter (parameter) .. [%s] 5 - Confirmation mode (confirm) ..... [%s] 6 - Scrolling line count (scroll) ... [%s] 7 - Message language (language) ..... [%s] 8 - BRSPACE command line (command) .. [%s] %s-Optionen fuer Aenderung von Datenbankparameter 1 - BRSPACE-Profil (profile) ............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ... [%s] 3 - Parameter-Aenderungsaktion (action) .. [%s] 4 - Datenbankparameter (parameter) ....... [%s] 5 - Bestaetigungsmodus (confirm) ......... [%s] 6 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 7 - Meldungssprache (language) ........... [%s] 8 - BRSPACE-Kommandozeile (command) ...... [%s] %s main options for showing database information 1 - BRSPACE profile (profile) ........ [%s] 2 - Database user/password (user) .... [%s] 3 - Database instance (instance) ..... [%s] 4 - Database parameter (parameter) ... [%s] 5 - Database tablespace (tablespace) . [%s] 6 - Database file (file) ............. [%s] 7 - Database owner (owner) ........... [%s] 8 - Database tables (table) .......... [%s] 9 - Database indexes (index) ......... [%s] 10 - Table partitions (tabpart) ....... [%s] 11 - Index partitions (indpart) ....... [%s] %s-Hauptoptionen fuer Anzeige der Datenbankinformationen 1 - BRSPACE-Profil (profile) ........... [%s] 2 - Datenbankbenutzer/-Kennwort (user) . [%s] 3 - Datenbankinstanz (instance) ........ [%s] 4 - Datenbankparameter (parameter) ..... [%s] 5 - Datenbank-Tablespace (tablespace) .. [%s] 6 - Datenbankdatei (file) .............. [%s] 7 - Datenbank-Besitzer (owner) ......... [%s] 8 - Datenbank-Tabellen (table) ......... [%s] 9 - Datenbank-Indizes (index) .......... [%s] 10 - Tabellen-Partitionen (tabpart) ..... [%s] 11 - Index-Partitionen (indpart) ........ [%s] Additional %s options for showing database information 1 - Create log file (log) .......... [%s] 2 - Confirmation mode (confirm) .... [%s] 3 - Extended output (output) ....... [%s] 4 - Scrolling line count (scroll) .. [%s] 5 - Message language (language) .... [%s] 6 - BRSPACE command line (command) . [%s] Weitere %s-Optionen fuer Anzeige der Datenbankinformationen 1 - Protokolldatei anlegen (log) ......... [%s] 2 - Bestaetigungsmodus (confirm) ......... [%s] 3 - Erweiterte Ausgabe (output) .......... [%s] 4 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 5 - Meldungssprache (language) ........... [%s] 6 - BRSPACE-Kommandozeile (command) ...... [%s] %s options for recreate database 1 - BRSPACE profile (profile) ...... [%s] 2 - Database user/password (user) .. [%s] 3 - Confirmation mode (confirm) .... [%s] 4 - Extended output (output) ....... [%s] 5 - Message language (language) .... [%s] 6 - BRSPACE command line (command) . [%s] %s-Optionen fuer Neuanlegen von Datenbank 1 - BRSPACE-Profil (profile) ........... [%s] 2 - Datenbankbenutzer/-Kennwort (user) . [%s] 3 - Bestaetigungsmodus (confirm) ....... [%s] 4 - Erweiterte Ausgabe (output) ........ [%s] 5 - Meldungssprache (language) ......... [%s] 6 - BRSPACE-Kommandozeile (command) .... [%s] %s options for manage online redolog 1 - BRSPACE profile (profile) ...... [%s] 2 - Database user/password (user) .. [%s] 3 - Manage redolog action (action) . [%s] 4 - Redolog thread number (thread) . [%s] 5 - Redolog group number (group) ... [%s] 6 - Redolog member number (member) . [%s] 7 - Redolog file names (file) ...... [%s] 8 - Confirmation mode (confirm) .... [%s] 9 - Extended output (output) ....... [%s] 10 - Message language (language) .... [%s] 11 - BRSPACE command line (command) . [%s] %s-Optionen fuer Verwalten von Online-Redolog 1 - BRSPACE-Profil (profile) ........... [%s] 2 - Datenbankbenutzer/-Kennwort (user) . [%s] 3 - Redolog-Verwaltungsaktion (action) . [%s] 4 - Redolog-Thread-Nummer (thread) ..... [%s] 5 - Redolog-Gruppennummer (group) ...... [%s] 6 - Redolog-Mitgliedsnummer (member) ... [%s] 7 - Redolog-Dateinamen (file) .......... [%s] 8 - Bestaetigungsmodus (confirm) ....... [%s] 9 - Erweiterte Ausgabe (output) ........ [%s] 10 - Meldungssprache (language) ......... [%s] 11 - BRSPACE-Kommandozeile (command) .... [%s] %s options for manage data encryption 1 - BRSPACE profile (profile) ........... [%s] 2 - Database user/password (user) ....... [%s] 3 - Manage encryption action (action) ... [%s] 4 - Encrypted tables for re-key (table) . [%s] 5 - Confirmation mode (confirm) ......... [%s] 6 - Extended output (output) ............ [%s] 7 - Message language (language) ......... [%s] 8 - BRSPACE command line (command) ...... [%s] %s-Optionen fuer Verwalten von Datenverschluesselung 1 - BRSPACE-Profil (profile) ..................... [%s] 2 - Datenbankbenutzer/-Kennwort (user) ........... [%s] 3 - Verschluesselungs-Verwaltungsaktion (action) . [%s] 4 - Tabellen fuer Neuverschluesselung (table) .... [%s] 5 - Bestaetigungsmodus (confirm) ................. [%s] 6 - Erweiterte Ausgabe (output) .................. [%s] 7 - Meldungssprache (language) ................... [%s] 8 - BRSPACE-Kommandozeile (command) .............. [%s] %s options for showing database information 1 - BRSPACE profile (profile) ........ [%s] 2 - Database user/password (user) .... [%s] 3 - Database instance (instance) ..... [%s] 4 - Database parameter (parameter) ... [%s] 5 - Database tablespace (tablespace) . [%s] 6 - Database file (file) ............. [%s] 7 - Database owner (owner) ........... [%s] 8 - Database tables (table) .......... [%s] 9 - Database indexes (index) ......... [%s] 10 - Table partitions (tabpart) ....... [%s] 11 - Index partitions (indpart) ....... [%s] 12 - Create log file (log) ............ [%s] 13 - Confirmation mode (confirm) ...... [%s] 14 - Extended output (output) ......... [%s] 15 - Scrolling line count (scroll) .... [%s] 16 - Message language (language) ...... [%s] 17 - BRSPACE command line (command) ... [%s] %s-Optionen fuer Anzeige der Datenbankinformationen 1 - BRSPACE-Profil (profile) ............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ... [%s] 3 - Datenbankinstanz (instance) .......... [%s] 4 - Datenbankparameter (parameter) ....... [%s] 5 - Datenbank-Tablespace (tablespace) .... [%s] 6 - Datenbankdatei (file) ................ [%s] 7 - Datenbank-Besitzer (owner) ........... [%s] 8 - Datenbank-Tabellen (table) ........... [%s] 9 - Datenbank-Indizes (index) ............ [%s] 10 - Tabellen-Partitionen (tabpart) ....... [%s] 11 - Index-Partitionen (indpart) .......... [%s] 12 - Protokolldatei anlegen (log) ......... [%s] 13 - Bestaetigungsmodus (confirm) ......... [%s] 14 - Erweiterte Ausgabe (output) .......... [%s] 15 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 16 - Meldungssprache (language) ........... [%s] 17 - BRSPACE-Kommandozeile (command) ...... [%s] %s options for tablespace extension 1 - BRSPACE profile (profile) ...... [%s] 2 - Database user/password (user) .. [%s] 3 - Tablespace name (tablespace) ... [%s] 4 - Confirmation mode (confirm) .... [%s] 5 - Scrolling line count (scroll) .. [%s] 6 - Message language (language) .... [%s] 7 - BRSPACE command line (command) . [%s] %s-Optionen fuer Tablespace-Erweiterung 1 - BRSPACE-Profil (profile) ............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ... [%s] 3 - Tablespace-Name (tablespace) ......... [%s] 4 - Bestaetigungsmodus (confirm) ......... [%s] 5 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 6 - Meldungssprache (language) ........... [%s] 7 - BRSPACE-Kommandozeile (command) ...... [%s] %s options for create tablespace 1 - BRSPACE profile (profile) ...... [%s] 2 - Database user/password (user) .. [%s] 3 - Tablespace name (tablespace) ... [%s] 4 - Confirmation mode (confirm) .... [%s] 5 - Scrolling line count (scroll) .. [%s] 6 - Message language (language) .... [%s] 7 - BRSPACE command line (command) . [%s] %s-Optionen fuer Anlegen von Tablespace 1 - BRSPACE-Profil (profile) ............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ... [%s] 3 - Tablespace-Name (tablespace) ......... [%s] 4 - Bestaetigungsmodus (confirm) ......... [%s] 5 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 6 - Meldungssprache (language) ........... [%s] 7 - BRSPACE-Kommandozeile (command) ...... [%s] %s options for drop tablespace 1 - BRSPACE profile (profile) ...... [%s] 2 - Database user/password (user) .. [%s] 3 - Tablespace name (tablespace) ... [%s] 4 - Confirmation mode (confirm) .... [%s] 5 - Scrolling line count (scroll) .. [%s] 6 - Message language (language) .... [%s] 7 - BRSPACE command line (command) . [%s] %s-Optionen fuer Loeschen von Tablespace 1 - BRSPACE-Profil (profile) ............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ... [%s] 3 - Tablespace-Name (tablespace) ......... [%s] 4 - Bestaetigungsmodus (confirm) ......... [%s] 5 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 6 - Meldungssprache (language) ........... [%s] 7 - BRSPACE-Kommandozeile (command) ...... [%s] %s options for alter tablespace 1 - BRSPACE profile (profile) ........ [%s] 2 - Database user/password (user) .... [%s] 3 - Alter tablespace action (action) . [%s] 4 - Tablespace names (tablespace) .... [%s] 5 - Confirmation mode (confirm) ...... [%s] 6 - Scrolling line count (scroll) .... [%s] 7 - Message language (language) ...... [%s] 8 - BRSPACE command line (command) ... [%s] %s-Optionen fuer Aenderung von Tablespace 1 - BRSPACE-Profil (profile) ............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ... [%s] 3 - Tablespace-Aenderungsaktion (action) . [%s] 4 - Tablespace-Namen (tablespace) ........ [%s] 5 - Bestaetigungsmodus (confirm) ......... [%s] 6 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 7 - Meldungssprache (language) ........... [%s] 8 - BRSPACE-Kommandozeile (command) ...... [%s] %s options for alter data file 1 - BRSPACE profile (profile) ....... [%s] 2 - Database user/password (user) ... [%s] 3 - Alter data file action (action) . [%s] 4 - Tablespace names (tablespace) ... [%s] 5 - Data file names (file) .......... [%s] 6 - Confirmation mode (confirm) ..... [%s] 7 - Scrolling line count (scroll) ... [%s] 8 - Message language (language) ..... [%s] 9 - BRSPACE command line (command) .. [%s] %s-Optionen fuer Aenderung von Datendatei 1 - BRSPACE-Profil (profile) ............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ... [%s] 3 - Datendatei-Aenderungsaktion (action) . [%s] 4 - Tablespace-Namen (tablespace) ........ [%s] 5 - Datendateien-Namen (file) ............ [%s] 6 - Bestaetigungsmodus (confirm) ......... [%s] 7 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 8 - Meldungssprache (language) ........... [%s] 9 - BRSPACE-Kommandozeile (command) ...... [%s] %s options for move data file 1 - BRSPACE profile (profile) ...... [%s] 2 - Database user/password (user) .. [%s] 3 - Tablespace names (tablespace) .. [%s] 4 - Data file names (file) ......... [%s] 5 - Confirmation mode (confirm) .... [%s] 6 - Scrolling line count (scroll) .. [%s] 7 - Message language (language) .... [%s] 8 - BRSPACE command line (command) . [%s] %s-Optionen fuer Verschiebung von Datendatei 1 - BRSPACE-Profil (profile) ............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ... [%s] 3 - Tablespace-Namen (tablespace) ........ [%s] 4 - Datendateien-Namen (file) ............ [%s] 5 - Bestaetigungsmodus (confirm) ......... [%s] 6 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 7 - Meldungssprache (language) ........... [%s] 8 - BRSPACE-Kommandozeile (command) ...... [%s] %s options for reorganization of tables 1 - BRSPACE profile (profile) ...... [%s] 2 - Database user/password (user) .. [%s] 3 - Reorganization action (action) . [%s] 4 - Tablespace names (tablespace) .. [%s] 5 - Table owner (owner) ............ [%s] 6 - Table names (table) ............ [%s] 7 - Table partitions (tabpart) ..... [%s] 8 - Confirmation mode (confirm) .... [%s] 9 - Extended output (output) ....... [%s] 10 - Scrolling line count (scroll) .. [%s] 11 - Message language (language) .... [%s] 12 - BRSPACE command line (command) . [%s] %s-Optionen fuer Reorganisation von Tabellen 1 - BRSPACE-Profil (profile) ............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ... [%s] 3 - Reorganisationsaktion (action) ....... [%s] 4 - Tablespace-Namen (tablespace) ........ [%s] 5 - Tabellen-Besitzer (owner) ............ [%s] 6 - Tabellen-Namen (table) ............... [%s] 7 - Tabellen-Partitionen (tabpart) ... .. [%s] 8 - Bestaetigungsmodus (confirm) ......... [%s] 9 - Erweiterte Ausgabe (output) .......... [%s] 10 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 11 - Meldungssprache (language) ........... [%s] 12 - BRSPACE-Kommandozeile (command) ...... [%s] %s options for rebuild of indexes 1 - BRSPACE profile (profile) ...... [%s] 2 - Database user/password (user) .. [%s] 3 - Rebuild action (action) ........ [%s] 4 - Tablespace names (tablespace) .. [%s] 5 - Index owner (owner) ............ [%s] 6 - Table names (table) ............ [%s] 7 - Index names (index) ............ [%s] 8 - Index partitions (indpart) ..... [%s] 9 - Confirmation mode (confirm) .... [%s] 10 - Extended output (output) ....... [%s] 11 - Scrolling line count (scroll) .. [%s] 12 - Message language (language) .... [%s] 13 - BRSPACE command line (command) . [%s] %s-Optionen fuer Neuaufbau von Indizes 1 - BRSPACE-Profil (profile) ............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ... [%s] 3 - Neuaufbauaktion (action) ............. [%s] 4 - Tablespace-Namen (tablespace) ........ [%s] 5 - Index-Besitzer (owner) ............... [%s] 6 - Tabellen-Namen (table) ............... [%s] 7 - Index-Namen (index) .................. [%s] 8 - Index-Partitionen (indpart) .......... [%s] 9 - Bestaetigungsmodus (confirm) ......... [%s] 10 - Erweiterte Ausgabe (output) .......... [%s] 11 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 12 - Meldungssprache (language) ........... [%s] 13 - BRSPACE-Kommandozeile (command) ...... [%s] %s options for export tables 1 - BRSPACE profile (profile) ....... [%s] 2 - Database user/password (user) ... [%s] 3 - Export utility (utility) ........ [%s] 4 - Tablespace names (tablespaces) .. [%s] 5 - Table owner (owner) ............. [%s] 6 - Table names (tables) ............ [%s] 7 - Export dump directory (dumpdir) . [%s] 8 - Confirmation mode (confirm) ..... [%s] 9 - Extended output (output) ........ [%s] 10 - Scrolling line count (scroll) ... [%s] 11 - Message language (language) ..... [%s] 12 - BRSPACE command line (command) .. [%s] %s-Optionen fuer Export von Tabellen 1 - BRSPACE-Profil (profile) ............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ... [%s] 3 - Export-Utility (utility) ............. [%s] 4 - Tablespace-Namen (tablespaces) ....... [%s] 5 - Tabellen-Besitzer (owner) ............ [%s] 6 - Tabellen-Namen (tables) .............. [%s] 7 - Export-Dump-Verzeichnis (dumpdir) .... [%s] 8 - Bestaetigungsmodus (confirm) ......... [%s] 9 - Erweiterte Ausgabe (output) .......... [%s] 10 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 11 - Meldungssprache (language) ........... [%s] 12 - BRSPACE-Kommandozeile (command) ...... [%s] %s options for import tables 1 - BRSPACE profile (profile) ............... [%s] 2 - Database user/password (user) ........... [%s] 3 - BRSPACE export run / dump file (export) . [%s] 4 - Import type (type) ...................... [%s] 5 - Table owner (owner) ..................... [%s] 6 - Table names (tables) .................... [%s] 7 - Confirmation mode (confirm) ............. [%s] 8 - Extended output (output) ................ [%s] 9 - Scrolling line count (scroll) ........... [%s] 10 - Message language (language) ............. [%s] 11 - BRSPACE command line (command) .......... [%s] %s-Optionen fuer Import von Tabellen 1 - BRSPACE-Profil (profile) ............... [%s] 2 - Datenbankbenutzer/-Kennwort (user) ..... [%s] 3 - BRSPACE-Exportlauf/Dump-Datei (export) . [%s] 4 - Import-Typ (type) ...................... [%s] 5 - Tabellen-Besitzer (owner) .............. [%s] 6 - Tabellen-Namen (tables) ................ [%s] 7 - Bestaetigungsmodus (confirm) ........... [%s] 8 - Erweiterte Ausgabe (output) ............ [%s] 9 - Zeilenanzahl fuer Scrolling (scroll) ... [%s] 10 - Meldungssprache (language) ............. [%s] 11 - BRSPACE-Kommandozeile (command) ........ [%s] %s options for alter tables 1 - BRSPACE profile (profile) ...... [%s] 2 - Database user/password (user) .. [%s] 3 - Alter table action (action) .... [%s] 4 - Tablespace names (tablespace) .. [%s] 5 - Table owner (owner) ............ [%s] 6 - Table names (table) ............ [%s] 7 - Confirmation mode (confirm) .... [%s] 8 - Extended output (output) ....... [%s] 9 - Scrolling line count (scroll) .. [%s] 10 - Message language (language) .... [%s] 11 - BRSPACE command line (command) . [%s] %s-Optionen fuer Aenderung von Tabellen 1 - BRSPACE-Profil (profile) ............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ... [%s] 3 - Tabellen-Aenderungsaktion (action) ... [%s] 4 - Tablespace-Namen (tablespace) ........ [%s] 5 - Tabellen-Besitzer (owner) ............ [%s] 6 - Tabellen-Namen (table) ............... [%s] 7 - Bestaetigungsmodus (confirm) ......... [%s] 8 - Erweiterte Ausgabe (output) .......... [%s] 9 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 10 - Meldungssprache (language) ........... [%s] 11 - BRSPACE-Kommandozeile (command) ...... [%s] %s options for alter indexes 1 - BRSPACE profile (profile) ...... [%s] 2 - Database user/password (user) .. [%s] 3 - Alter index action (action) .... [%s] 4 - Tablespace names (tablespace) .. [%s] 5 - Index owner (owner) ............ [%s] 6 - Table names (table) ............ [%s] 7 - Index names (index) ............ [%s] 8 - Confirmation mode (confirm) .... [%s] 9 - Extended output (output) ....... [%s] 10 - Scrolling line count (scroll) .. [%s] 11 - Message language (language) .... [%s] 12 - BRSPACE command line (command) . [%s] %s-Optionen fuer Aenderung von Indizes 1 - BRSPACE-Profil (profile) ............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ... [%s] 3 - Index-Aenderungsaktion (action) ...... [%s] 4 - Tablespace-Namen (tablespace) ........ [%s] 5 - Index-Besitzer (owner) ............... [%s] 6 - Tabellen-Namen (table) ............... [%s] 7 - Index-Namen (index) .................. [%s] 8 - Bestaetigungsmodus (confirm) ......... [%s] 9 - Erweiterte Ausgabe (output) .......... [%s] 10 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 11 - Meldungssprache (language) ........... [%s] 12 - BRSPACE-Kommandozeile (command) ...... [%s] Complete database recovery main menu 1 - Check the status of database files 2 - Select database backup 3 - Restore split/standby control files 4 - Restore data files 5 - Restore split incremental control files 6 - Restore and apply incremental backup 7 - Restore and apply archivelog files 8 - Open database and post-processing 9 - Exit program 10 - Reset program status Hauptmenue fuer vollstaendige Wiederherstellung der Datenbank 1 - Status der Datenbankdateien ueberpruefen 2 - Datenbanksicherung auswaehlen 3 - Split/Standby-Steuerdateien zurueckladen 4 - Datendateien zurueckladen 5 - Split-inkrementelle Steuerdateien zurueckladen 6 - Inkrementelle Sicherung zurueckladen und einspielen 7 - Archivelog-Dateien zurueckladen und einspielen 8 - Datenbank oeffnen und Nachbearbeitung 9 - Programm beenden 10 - Programmstatus zuruecksetzen Database backups for complete database recovery Pos. Log Start Type Mode Device Rc Database backups for complete database recovery Pos. Log Start Type Mode Device Rc UVol1/Stat. Datenbanksicherungen fuer vollstaendige Wiederherstellung der Datenbank Pos. Protokoll Start Typ Modus Geraet Rc Datenbanksicherungen fuer vollstaendige Wiederherstellung der Datenbank Pos. Protokoll Start Typ Modus Geraet Rc UVol1/Stat. Database point-in-time recovery main menu 1 - Set point-in-time for recovery 2 - Select database backup or flashback 3 - Check the status of database files 4 - Restore control files 5 - Restore data files 6 - Restore split incremental control files 7 - Restore and apply incremental backup 8 - Restore and apply archivelog files 9 - Restore archivelog files and flashback 10 - Open database and post-processing 11 - Exit program 12 - Reset program status Hauptmenue fuer Point-in-Time-Wiederherstellung der Datenbank 1 - Zeitpunkt fuer Wiederherstellung setzen 2 - Datenbanksicherung oder Flashback auswaehlen 3 - Status der Datenbankdateien ueberpruefen 4 - Steuerdateien zurueckladen 5 - Datendateien zurueckladen 6 - Split-inkrementelle Steuerdateien zurueckladen 7 - Inkrementelle Sicherung zurueckladen und einspielen 8 - Archivelog-Dateien zurueckladen und einspielen 9 - Archivelog-Dateien zurueckladen und Flashback 10 - Datenbank oeffnen und Nachbearbeitung 11 - Programm beenden 12 - Programmstatus zuruecksetzen Options for point-in-time recovery of database %s 1 - Database instance of archivelog thread (instance) . [%s] 2 - Last archivelog sequence to apply (last_seq) ...... [%s] 3 - Last system change number to apply (last_scn) ..... [%s] 4 - End point-in-time for recovery (end_pit) .......... [%s] Optionen fuer Point-in-Time-Wiederherstellung der Datenbank %s 1 - Datenbankinstanz von Archivelog-Thread (instance) ..... [%s] 2 - Letzte Archivelog-Sequenz zum Einspielen (last_seq) ... [%s] 3 - Letzte System-Change-Number zum Einspielen (last_scn) . [%s] 4 - Ende-Zeitpunkt fuer Wiederherstellung (end_pit) ....... [%s] Database backups / flashback for database point-in-time recovery Pos. Log/FBack Start time Type/SCN Mode Device Rc Database backups / flashback for database point-in-time recovery Pos. Log/FBack Start time Type/SCN Mode Device Rc UVol1/Stat. Datenbanksicherungen / Flashback fuer Point-in-Time-Wiederherstellung der Datenbank Pos. Prot./FBack Startzeit Typ/SCN Modus Geraet Rc Datenbanksicherungen / Flashback fuer Point-in-Time-Wiederherstellung der Datenbank Pos. Prot./FBack Startzeit Typ/SCN Modus Geraet Rc UVol1/Stat. Tablespace point-in-time recovery main menu 1 - Set point-in-time and tablespaces for recovery 2 - Select database backup 3 - Check the status of tablespaces 4 - Export tablespaces not being recovered 5 - Restore required data files 6 - Restore and apply incremental backup 7 - Restore and apply archivelog files 8 - Open database and plug in exported tablespaces 9 - Exit program 10 - Reset program status Hauptmenue fuer Point-in-Time-Wiederherstellung der Tablespaces 1 - Zeitpunkt und Tablespaces fuer Wiederherstellung setzen 2 - Datenbanksicherung auswaehlen 3 - Status der Tablespaces ueberpruefen 4 - Nicht-wiederherzustellende Tablespaces exportieren 5 - Notwendige Datendateien zurueckladen 6 - Inkrementelle Sicherung zurueckladen und einspielen 7 - Archivelog-Dateien zurueckladen und einspielen 8 - Datenbank oeffnen und exportierte Tablespaces einhaengen 9 - Programm beenden 10 - Programmstatus zuruecksetzen Options for tablespace point-in-time recovery of database %s 1 - Database instance of archivelog thread (instance) . [%s] 2 - Last archivelog sequence to apply (last_seq) ...... [%s] 3 - Last system change number to apply (last_scn) ..... [%s] 4 - End point-in-time for recovery (end_pit) .......... [%s] 5 - Database owner for recovery (owner) ............... [%s] 6 - Tablespaces for recovery (tablespace) ............. [%s] Optionen fuer Point-in-Time-Wiederherstellung der Tablespaces von Datenbank %s 1 - Datenbankinstanz von Archivelog-Thread (instance) ..... [%s] 2 - Letzte Archivelog-Sequenz zum Einspielen (last_seq) ... [%s] 3 - Letzte System-Change-Number zum Einspielen (last_scn) . [%s] 4 - Ende-Zeitpunkt fuer Wiederherstellung (end_pit) ....... [%s] 5 - Datenbankbesitzer fuer Wiederherstellung (owner) ...... [%s] 6 - Tablespaces fuer Wiederherstellung (tablespace) ....... [%s] Database backups for tablespace point-in-time recovery Pos. Log Start Type Mode Device Rc Database backups for tablespace point-in-time recovery Pos. Log Start Type Mode Device Rc UVol1/Stat. Datenbanksicherungen fuer Point-in-Time-Wiederherstellung der Tablespaces Pos. Protokoll Start Typ Modus Geraet Rc Datenbanksicherungen fuer Point-in-Time-Wiederherstellung der Tablespaces Pos. Protokoll Start Typ Modus Geraet Rc UVol1/Stat. Whole database reset main menu 1 - Select database backup or restore point 2 - Check the status of database files 3 - Restore control files and redolog files 4 - Restore data files 5 - Restore and apply incremental backup 6 - Restore and apply archivelog files 7 - Restore archivelog files and flashback 8 - Open database and post-processing 9 - Exit program 10 - Reset program status Hauptmenue fuer Zuruecksetzen der ganzen Datenbank 1 - Datenbanksicherung oder Restore-Point auswaehlen 2 - Status der Datenbankdateien ueberpruefen 3 - Steuerdateien und Redolog-Dateien zurueckladen 4 - Datendateien zurueckladen 5 - Inkrementelle Sicherung zurueckladen und einspielen 6 - Archivelog-Dateien zurueckladen und einspielen 7 - Archivelog-Dateien zurueckladen und Flashback 8 - Datenbank oeffnen und Nachbearbeitung 9 - Programm beenden 10 - Programmstatus zuruecksetzen Consistent database backups / restore points for whole database reset Pos. Log/RPoint Start time Type/SCN Mode Device Rc Consistent database backups / restore points for whole database reset Pos. Log/RPoint Start time Type/SCN Mode Device Rc UVol1/Stat. Konsistente Datenbanksicherungen / Restore-Points fuer Zuruecksetzen der ganzen Datenbank Pos. Prot./RPoint Startzeit Typ/SCN Modus Geraet Rc Konsistente Datenbanksicherungen / Restore-Points fuer Zuruecksetzen der ganzen Datenbank Pos. Prot./RPoint Startzeit Typ/SCN Modus Geraet Rc UVol1/Stat. %s main options for restore of database files 1 - BRRESTORE profile (profile) ........ [%s] 2 - BRBACKUP backup run (backup) ....... [%s] 3 - Fill-up previous restores (fillup) . [%s] 4 - Restore device type (device) ....... [%s] 5 - BACKINT/Mount profile (parfile) .... [%s] 6 - Database user/password (user) ...... [%s] 7 - Files for restore (mode) ........... [%s] %s-Hauptoptionen fuer Zurueckladen der Datenbankdateien 1 - BRRESTORE-Profil (profile) ............ [%s] 2 - BRBACKUP-Sicherungslauf (backup) ...... [%s] 3 - Auffuellen von Zurueckladens (fillup) . [%s] 4 - Geraetetyp fuer Zurueckladen (device) . [%s] 5 - BACKINT/Mount-Profil (parfile) ........ [%s] 6 - Datenbankbenutzer/-Kennwort (user) .... [%s] 7 - Dateien fuer Zurueckladen (mode) ...... [%s] Additional %s options for restore of database files 1 - Confirmation mode (confirm) ...... [%s] 2 - Query mode (query) ............... [%s] 3 - Compression mode (compress) ...... [%s] 4 - Parallel execution (execute) ..... [%s] 5 - Additional output (output) ....... [%s] 6 - Message language (language) ...... [%s] 7 - BRRESTORE command line (command) . [%s] Weitere %s-Otionen fuer Zurueckladen der Datenbankdateien 1 - Bestaetigungsmodus (confirm) ...... [%s] 2 - Abfragemodus (query) .............. [%s] 3 - Komprimierungsmodus (compress) .... [%s] 4 - Parallele Ausfuehrung (execute) ... [%s] 5 - Zusaetzliche Ausgabe (output) ..... [%s] 6 - Meldungssprache (language) ........ [%s] 7 - BRRESTORE-Kommandozeile (command) . [%s] Archivelog files to apply of database instance %s Pos. Sequence Status Apply From Disk Tape Util. Rman Stage Archivelog-Dateien zum Einspielen von Datenbankinstanz %s Pos. Sequenz Status Einsp. Von Disk Band Util. Rman Stage Change the source for applying archivelog files of database instance %s 1 - First sequence number (first_seq) . [%s] 2 - Last sequence number (last_seq) ... [%s] 3 - New source for applying (source) .. [%s] Aenderung der Quelle fuer Einspielen der Archivelog-Dateien von Datenbankinstanz %s 1 - Erste Sequenznummer (first_seq) ...... [%s] 2 - Letzte Sequenznummer (last_seq) ...... [%s] 3 - Neue Quelle fuer Einspielen (source) . [%s] %s main options for restore of archivelog files 1 - BRRESTORE main profile (profile) ..... [%s] 2 - Profile for cpio (prof_cpio) ......... [%s] 3 - Profile for dd (prof_dd) ............. [%s] 4 - Profile for rman (prof_rman) ......... [%s] 5 - Profile for rman_dd (prof_rman_dd) ... [%s] 6 - Profile for rman_set (prof_rman_set) . [%s] 7 - Profile for brtools (prof_brtools) ... [%s] 8 - BACKINT/Mount profile (parfile) ...... [%s] 9 - Database user/password (user) ........ [%s] 10 - Destination directory (dest_dir) ..... [%s] %s-Hauptoptionen fuer Zurueckladen der Archivelog-Dateien 1 - BRRESTORE-Hauptprofil (profile) ...... [%s] 2 - Profil fuer cpio (prof_cpio) ......... [%s] 3 - Profil fuer dd (prof_dd) ............. [%s] 4 - Profil fuer rman (prof_rman) ......... [%s] 5 - Profil fuer rman_dd (prof_rman_dd) ... [%s] 6 - Profil fuer rman_set (prof_rman_set) . [%s] 7 - Profil fuer brtools (prof_brtools) ... [%s] 8 - BACKINT/Mount-Profil (parfile) ....... [%s] 9 - Datenbankbenutzer/-Kennwort (user) ... [%s] 10 - Zielverzeichnis (dest_dir) ........... [%s] Additional %s options for restore of archivelog files 1 - Confirmation mode (confirm) . [%s] 2 - Additional output (output) .. [%s] 3 - Message language (language) . [%s] Weitere %s-Optionen fuer Zurueckladen der Archivelog-Dateien 1 - Bestaetigungsmodus (confirm) .. [%s] 2 - Zusaetzliche Ausgabe (output) . [%s] 3 - Meldungssprache (language) .... [%s] Applying archivelog files of database instance %s 1 - First sequence number (first_seq) .. [%s] 2 - Last sequence number (last_seq) .... [%s] 3 - Use backup control file (back_ctl) . [%s] 4 - Parallel recovery (degree) ......... [%s] Einspielen der Archivelog-Dateien von Datenbankinstanz %s 1 - Erste Sequenznummer (first_seq) .......... [%s] 2 - Letzte Sequenznummer (last_seq) .......... [%s] 3 - Benutze Sicherungssteuerdatei (back_ctl) . [%s] 4 - Parallele Wiederherstellung (degree) ..... [%s] %s command line for restore of archivelog group 1 - Restore unattended (unattend) .... [%s] 2 - BRRESTORE command line (command) . [%s] %s-Kommandozeile fuer Zurueckladen einer Archivelog-Gruppe 1 - Unbeaufsichtigt Zurueckladen (unattend) . [%s] 2 - BRRESTORE-Kommandozeile (command) ....... [%s] Applying archivelog group of database instance %s 1 - Apply unattended (unattend) ....... [%s] 2 - First sequence number (first_seq) . [%s] 3 - Last sequence number (last_seq) ... [%s] 4 - SQLPLUS command (command) ......... [%s] Einspielen der Archivelog-Gruppe von Datenbankinstanz %s 1 - Unbeaufsichtigt Einspielen (unattend) . [%s] 2 - Erste Sequenznummer (first_seq) ....... [%s] 3 - Letzte Sequenznummer (last_seq) ....... [%s] 4 - SQLPLUS-Kommando (command) ............ [%s] Restore of individual backup files main menu 1 - Restore files from BRBACKUP backup 2 - Restore individual files from tape 3 - Restore individual files from disk 4 - Restore individual files from backup utility 5 - Restore and apply incremental backup 6 - Exit program 7 - Reset program status Hauptmenue fuer Zurueckladen einzelner Sicherungsdateien 1 - Dateien von BRBACKUP-Sicherung zurueckladen 2 - Einzelne Dateien von Band zurueckladen 3 - Einzelne Dateien von Platte zurueckladen 4 - Einzelne Dateien von Backup-Utility zurueckladen 5 - Inkrementelle Sicherung zurueckladen und einspielen 6 - Programm beenden 7 - Programmstatus zuruecksetzen BRBACKUP database backups for restore Pos. Log Start Type Files Device Rc BRBACKUP-Datenbanksicherungen fuer Zurueckladen Pos. Protokoll Start Typ Dateien Geraet Rc Backup files for restore Pos. Tablespace Id. Name Gesicherte Dateien fuer Zurueckladen Pos. Tablespace Id. Name %s main options for restore from BRBACKUP backup 1 - BRRESTORE profile (profile) ........ [%s] 2 - BRBACKUP backup run (backup) ....... [%s] 3 - Fill-up previous restores (fillup) . [%s] 4 - Restore device type (device) ....... [%s] 5 - BACKINT/Mount profile (parfile) .... [%s] 6 - Database user/password (user) ...... [%s] 7 - Restore destination (rest_dest) .... [%s] 8 - Files for restore (mode) ........... [%s] %s-Hauptoptionen fuer Zurueckladen von BRBACKUP-Sicherung 1 - BRRESTORE-Profil (profile) ............ [%s] 2 - BRBACKUP-Sicherungslauf (backup) ...... [%s] 3 - Auffuellen von Zurueckladens (fillup) . [%s] 4 - Geraetetyp fuer Zurueckladen (device) . [%s] 5 - BACKINT/Mount-Profil (parfile) ........ [%s] 6 - Datenbankbenutzer/-Kennwort (user) .... [%s] 7 - Zurueckladensziel (rest_dest) ......... [%s] 8 - Dateien fuer Zurueckladen (mode) ...... [%s] Additional %s options for restore from BRBACKUP backup 1 - Confirmation mode (confirm) ...... [%s] 2 - Query mode (query) ............... [%s] 3 - Compression mode (compress) ...... [%s] 4 - Parallel execution (execute) ..... [%s] 5 - Additional output (output) ....... [%s] 6 - Message language (language) ...... [%s] 7 - BRRESTORE command line (command) . [%s] Weitere %s-Optionen fuer Zurueckladen von BRBACKUP-Sicherung 1 - Bestaetigungsmodus (confirm) ...... [%s] 2 - Abfragemodus (query) .............. [%s] 3 - Komprimierungsmodus (compress) .... [%s] 4 - Parallele Ausfuehrung (execute) ... [%s] 5 - Zusaetzliche Ausgabe (output) ..... [%s] 6 - Meldungssprache (language) ........ [%s] 7 - BRRESTORE-Kommandozeile (command) . [%s] %s options for restore of individual files from BRBACKUP/BRARCHIVE tape 1 - BRRESTORE profile (profile) ...... [%s] 2 - Tape device type (device) ........ [%s] 3 - File position on tape (number) ... [%s] 4 - Restore destination (rest_dest) .. [%s] 5 - Confirmation mode (confirm) ...... [%s] 6 - Query mode (query) ............... [%s] 7 - Compression mode (compress) ...... [%s] 8 - Additional output (output) ....... [%s] 9 - Message language (language) ...... [%s] 10 - BRRESTORE command line (command) . [%s] %s-Optionen fuer Zurueckladen einzelner Dateien von BRBACKUP/BRARCHIVE-Band 1 - BRRESTORE-Profil (profile) ........ [%s] 2 - Bandgeraetetyp (device) ........... [%s] 3 - Dateiposition auf Band (number) ... [%s] 4 - Zurueckladensziel (rest_dest) ..... [%s] 5 - Bestaetigungsmodus (confirm) ...... [%s] 6 - Abfragemodus (query) .............. [%s] 7 - Komprimierungsmodus (compress) .... [%s] 8 - Zusaetzliche Ausgabe (output) ..... [%s] 9 - Meldungssprache (language) ........ [%s] 10 - BRRESTORE-Kommandozeile (command) . [%s] %s options for restore of individual files from BRBACKUP/BRARCHIVE disk backup 1 - BRRESTORE profile (profile) ...... [%s] 2 - Disk device type (device) ........ [%s] 3 - Backup file name (back_name) ..... [%s] 4 - Restore destination (rest_dest) .. [%s] 5 - Confirmation mode (confirm) ...... [%s] 6 - Query mode (query) ............... [%s] 7 - Compression mode (compress) ...... [%s] 8 - Additional output (output) ....... [%s] 9 - Message language (language) ...... [%s] 10 - BRRESTORE command line (command) . [%s] %s-Optionen fuer Zurueckladen einzelner Dateien von BRBACKUP/BRARCHIVE-Plattensicherung 1 - BRRESTORE-Profil (profile) ........ [%s] 2 - Plattengeraetetyp (device) ........ [%s] 3 - Sicherungsdateiname (back_name) ... [%s] 4 - Zurueckladensziel (rest_dest) ..... [%s] 5 - Bestaetigungsmodus (confirm) ...... [%s] 6 - Komprimierungsmodus (compress) .... [%s] 7 - Abfragemodus (query) .............. [%s] 8 - Zusaetzliche Ausgabe (output) ..... [%s] 9 - Meldungssprache (language) ........ [%s] 10 - BRRESTORE-Kommandozeile (command) . [%s] %s options for restore of individual files from BACKINT backup 1 - BRRESTORE profile (profile) ...... [%s] 2 - BACKINT device type (device) ..... [%s] 3 - BACKINT backup Id (back_id) ...... [%s] 4 - Files for restore (mode) ......... [%s] 5 - Restore destination (rest_dest) .. [%s] 6 - Confirmation mode (confirm) ...... [%s] 7 - Query mode (query) ............... [%s] 8 - Additional output (output) ....... [%s] 9 - Message language (language) ...... [%s] 10 - BRRESTORE command line (command) . [%s] %s-Optionen fuer Zurueckladen einzelner Dateien von BACKINT-Sicherung 1 - BRRESTORE-Profil (profile) ........ [%s] 2 - BACKINT-Geraetetyp (device) ....... [%s] 3 - BACKINT-Sicherungs-Id (back_id) ... [%s] 4 - Dateien fuer Zurueckladen (mode) .. [%s] 5 - Zurueckladensziel (rest_dest) ..... [%s] 6 - Bestaetigungsmodus (confirm) ...... [%s] 7 - Abfragemodus (query) .............. [%s] 8 - Zusaetzliche Ausgabe (output) ..... [%s] 9 - Meldungssprache (language) ........ [%s] 10 - BRRESTORE-Kommandozeile (command) . [%s] Incremental database backups for restore and apply Pos. Log Start Type Device Rc Inkrementelle Datenbanksicherungen fuer Zurueckladen und Einspielen Pos. Protokoll Start Typ Geraet Rc %s main options for restore and apply of incremental backup 1 - BRRESTORE profile (profile) ..... [%s] 2 - BRBACKUP backup run (backup) .... [%s] 3 - Restore device type (device) .... [%s] 4 - BACKINT/Mount profile (parfile) . [%s] 5 - Database user/password (user) ... [%s] %s-Haupoptionen fuer Zurueckladen und Einspielen inkrementeller Sicherung 1 - BRRESTORE-Profil (profile) ............ [%s] 2 - BRBACKUP-Sicherungslauf (backup) ...... [%s] 3 - Geraetetyp fuer Zurueckladen (device) . [%s] 4 - BACKINT/Mount-Profil (parfile) ........ [%s] 5 - Datenbankbenutzer/-Kennwort (user) .... [%s] Additional %s options for restore and apply of incremental backup 1 - Confirmation mode (confirm) ...... [%s] 2 - Query mode (query) ............... [%s] 3 - Compression mode (compress) ...... [%s] 4 - Additional output (output) ....... [%s] 5 - Message language (language) ...... [%s] 6 - BRRESTORE command line (command) . [%s] Weitere %s-Optionen fuer Zurueckladen und Einspielen inkrementeller Sicherung 1 - Bestaetigungsmodus (confirm) ...... [%s] 2 - Abfragemodus (query) .............. [%s] 3 - Komprimierungsmodus (compress) .... [%s] 4 - Zusaetzliche Ausgabe (output) ..... [%s] 5 - Meldungssprache (language) ........ [%s] 6 - BRRESTORE-Kommandozeile (command) . [%s] Restore and application of archivelog files main menu 1 - Restore archivelog files 2 - Apply archivelog files 3 - Open database 4 - Exit program 5 - Reset program status Hauptmenue fuer Zurueckladen und Einspielen der Archivelog-Dateien 1 - Archivelog-Dateien zurueckladen 2 - Archivelog-Dateien einspielen 3 - Datenbank oeffnen 4 - Programm beenden 5 - Programmstatus zuruecksetzen %s main options for restore of archivelog files 1 - BRRESTORE profile (profile) .............. [%s] 2 - Instance of archivelog thread (instance) . [%s] 3 - First sequence number (first_seq) ........ [%s] 4 - Last sequence number (last_seq) .......... [%s] 5 - Restore device type (device) ............. [%s] 6 - BACKINT/Mount profile (parfile) .......... [%s] 7 - Database user/password (user) ............ [%s] 8 - Restore second copy (sec_copy) ........... [%s] 9 - Destination directory (dest_dir) ......... [%s] %s-Hauptoptionen fuer Zurueckladen der Archivelog-Dateien 1 - BRRESTORE-Profil (profile) ............... [%s] 2 - Instanz von Archivelog-Thread (instance) . [%s] 3 - Erste Sequenznummer (first_seq) .......... [%s] 4 - Letzte Sequenznummer (last_seq) .......... [%s] 5 - Geraetetyp fuer Zurueckladen (device) .... [%s] 6 - BACKINT/Mount-Profil (parfile) ........... [%s] 7 - Datenbankbenutzer/-Kennwort (user) ....... [%s] 8 - Zweite Kopie zurueckladen (sec_copy) ..... [%s] 9 - Zielverzeichnis (dest_dir) ............... [%s] Additional %s options for restore of archivelog files 1 - Confirmation mode (confirm) ...... [%s] 2 - Query mode (query) ............... [%s] 3 - Compression mode (compress) ...... [%s] 4 - Additional output (output) ....... [%s] 5 - Message language (language) ...... [%s] 6 - BRRESTORE command line (command) . [%s] Weitere %s-Optionen fuer Zurueckladen der Archivelog-Dateien 1 - Bestaetigungsmodus (confirm) ...... [%s] 2 - Abfragemodus (query) .............. [%s] 3 - Komprimierungsmodus (compress) .... [%s] 4 - Zusaetzliche Ausgabe (output) ..... [%s] 5 - Meldungssprache (language) ........ [%s] 6 - BRRESTORE-Kommandozeile (command) . [%s] Applying archivelog files to database %s 1 - Archivelog directory (archive_dir) ....... [%s] 2 - Instance of archivelog thread (instance) . [%s] 3 - Apply from online redolog (apply_redo) ... [%s] 4 - First sequence number (first_seq) ........ [%s] 5 - Last sequence number (last_seq) .......... [%s] 6 - Last system change number (last_scn) ..... [%s] 7 - End point-in-time (end_pit) .............. [%s] 8 - Use backup control file (back_ctl) ....... [%s] 9 - Parallel recovery (degree) ............... [%s] 10 - SQLPLUS command (command) ................ [%s] Einspielen der Archivelog-Dateien in Datenbank %s 1 - Archivelog-Verzeichnis (archive_dir) ....... [%s] 2 - Instanz von Archivelog-Thread (instance) ... [%s] 3 - Einspielen von Online-Redolog (apply_redo) . [%s] 4 - Erste Sequenznummer (first_seq) ............ [%s] 5 - Letzte Sequenznummer (last_seq) ............ [%s] 6 - Letzte System-Change-Number (last_scn) ..... [%s] 7 - Ende-Zeitpunkt (end_pit) ................... [%s] 8 - Benutze Sicherungssteuerdatei (back_ctl) ... [%s] 9 - Parallele Wiederherstellung (degree) ....... [%s] 10 - SQLPLUS-Kommando (command) ................. [%s] Options for opening database instance %s 1 - Reset logs option (reset_logs) .. [%s] 2 - Open database command (command) . [%s] Optionen fuer Oeffnen der Datenbankinstanz %s 1 - Reset-Logs-Option (reset_logs) ........ [%s] 2 - Datenbankoeffnungs-Kommando (command) . [%s] Disaster recovery main menu 1 - Restore profiles and log files from BRBACKUP backup 2 - Restore profiles and log files from BRARCHIVE backup 3 - Exit program 4 - Reset program status Hauptmenue fuer Katastrophen-Wiederherstellung 1 - Zurueckladen der Profile und Protokolle aus BRBACKUP-Sicherung 2 - Zurueckladen der Profile und Protokolle aus BRARCHIVE-Sicherung 3 - Programm beenden 4 - Programmstatus zuruecksetzen Device type for restoring profiles and log files from %s backup 1 - Local tape 2 - Remote tape 3 - Local disk 4 - Remote disk 5 - Backup utility Device type for restoring control files from %s backup 1 - Local tape 2 - Remote tape 3 - Local disk 4 - Remote disk 5 - Backup utility Geraetetyp fuers Zurueckladen der Profile und Protokolle aus %s-Sicherung 1 - Lokales Band 2 - Remote Band 3 - Lokale Platte 4 - Remote Platte 5 - Backup-Utility Geraetetyp fuers Zurueckladen der Steuerdateien aus %s-Sicherung 1 - Lokales Band 2 - Remote Band 3 - Lokale Platte 4 - Remote Platte 5 - Backup-Utility Parameters for restoring profiles and log files from local %s tape backup 1 - Backup profile (profile) .................. [%s] 2 - Tape drive with no-rewind (tape_address) .. [%s] 3 - Tape drive with rewind (tape_address_rew) . [%s] 4 - Tape copy command (tape_copy_cmd) ......... [%s] 5 - Tape rewind command (rewind) .............. [%s] 6 - Tape positioning command (tape_pos_cmd) ... [%s] 7 - Cpio input options (cpio_in_flags) ........ [%s] 8 - Tape block size in KB (tape_block_size) ... [%s] Parameters for restoring control files from local %s tape backup 1 - Backup profile (profile) .................. [%s] 2 - Tape drive with no-rewind (tape_address) .. [%s] 3 - Tape drive with rewind (tape_address_rew) . [%s] 4 - Tape copy command (tape_copy_cmd) ......... [%s] 5 - Tape rewind command (rewind) .............. [%s] 6 - Tape positioning command (tape_pos_cmd) ... [%s] 7 - Cpio input options (cpio_in_flags) ........ [%s] 8 - Tape block size in KB (tape_block_size) ... [%s] Parameter fuers Zurueckladen der Profile und Protokolle von lokaler %s-Bandsicherung 1 - Sicherungsprofil (profile) ................. [%s] 2 - Bandlauwerk mit no-rewind (tape_address) ... [%s] 3 - Bandlauwerk mit rewind (tape_address_rew) .. [%s] 4 - Bandkopier-Kommando (tape_copy_cmd) ........ [%s] 5 - Kommando fuer Zurueckspulen (rewind) ....... [%s] 6 - Kommando fuer Positionieren (tape_pos_cmd) . [%s] 7 - Input-Optionen fuer cpio (cpio_in_flags) ... [%s] 8 - Bandblockgroesse (tape_block_size) ......... [%s] Parameter fuers Zurueckladen der Steuerdateien von lokaler %s-Bandsicherung 1 - Sicherungsprofil (profile) ................. [%s] 2 - Bandlauwerk mit no-rewind (tape_address) ... [%s] 3 - Bandlauwerk mit rewind (tape_address_rew) .. [%s] 4 - Bandkopier-Kommando (tape_copy_cmd) ........ [%s] 5 - Kommando fuer Zurueckspulen (rewind) ....... [%s] 6 - Kommando fuer Positionieren (tape_pos_cmd) . [%s] 7 - Input-Optionen fuer cpio (cpio_in_flags) ... [%s] 8 - Bandblockgroesse (tape_block_size) ......... [%s] Parameters for restoring profiles and log files from remote %s tape backup 1 - Backup profile (profile) .................. [%s] 2 - Tape drive with no-rewind (tape_address) .. [%s] 3 - Tape drive with rewind (tape_address_rew) . [%s] 4 - Tape rewind command (rewind) .............. [%s] 5 - Tape positioning command (tape_pos_cmd) ... [%s] 6 - Cpio input options (cpio_in_flags) ........ [%s] 7 - Remote host (remote_host) ................. [%s] 8 - Remote user (remote_user) ................. [%s] 9 - Pipe copy command (pipe_copy_cmd) ......... [%s] 10 - Copy-in command (copy_in_cmd) ............. [%s] Parameters for restoring control files from remote %s tape backup 1 - Backup profile (profile) .................. [%s] 2 - Tape drive with no-rewind (tape_address) .. [%s] 3 - Tape drive with rewind (tape_address_rew) . [%s] 4 - Tape rewind command (rewind) .............. [%s] 5 - Tape positioning command (tape_pos_cmd) ... [%s] 6 - Cpio input options (cpio_in_flags) ........ [%s] 7 - Remote host (remote_host) ................. [%s] 8 - Remote user (remote_user) ................. [%s] 9 - Pipe copy command (pipe_copy_cmd) ......... [%s] 10 - Copy-in command (copy_in_cmd) ............. [%s] Parameter fuers Zurueckladen der Profile und Protokolle von remote %s-Bandsicherung 1 - Sicherungsprofil (profile) ................. [%s] 2 - Bandlauwerk mit no-rewind (tape_address) ... [%s] 3 - Bandlauwerk mit rewind (tape_address_rew) .. [%s] 4 - Kommando fuer Zurueckspulen (rewind) ....... [%s] 5 - Kommando fuer Positionieren (tape_pos_cmd) . [%s] 6 - Input-Optionen fuer cpio (cpio_in_flags) ... [%s] 7 - Remote Rechner (remote_host) ............... [%s] 8 - Remote Benutzer (remote_user) .............. [%s] 9 - Pipe-Kopie-Kommand (pipe_copy_cmd) ......... [%s] 10 - Copy-in-Kommando (copy_in_cmd) ............. [%s] Parameter fuers Zurueckladen der Steuerdateien von remote %s-Bandsicherung 1 - Sicherungsprofil (profile) ................. [%s] 2 - Bandlauwerk mit no-rewind (tape_address) ... [%s] 3 - Bandlauwerk mit rewind (tape_address_rew) .. [%s] 4 - Kommando fuer Zurueckspulen (rewind) ....... [%s] 5 - Kommando fuer Positionieren (tape_pos_cmd) . [%s] 6 - Input-Optionen fuer cpio (cpio_in_flags) ... [%s] 7 - Remote Rechner (remote_host) ............... [%s] 8 - Remote Benutzer (remote_user) .............. [%s] 9 - Pipe-Kopie-Kommand (pipe_copy_cmd) ......... [%s] 10 - Copy-in-Kommando (copy_in_cmd) ............. [%s] Parameters for restoring profiles and log files from local %s disk backup 1 - Backup profile (profile) ........... [%s] 2 - Oracle spfile (spfile) ............. [%s] 3 - Backup directory (backup_root_dir) . [%s] Parameter fuers Zurueckladen der Profile und Protokolle von lokaler %s-Plattensicherung 1 - Sicherungsprofil (profile) .............. [%s] 2 - Oracle-Spfile (spfile) .................. [%s] 3 - Sicherungsverzeichnis (backup_root_dir) . [%s] Parameters for restoring profiles and log files from local %s disk backup 1 - Backup profile (profile) ............ [%s] 2 - Oracle spfile (spfile) .............. [%s] 3 - Backup directory (archive_copy_dir) . [%s] Parameters for restoring control files from local %s disk backup 1 - Backup profile (profile) ............ [%s] 2 - Oracle spfile (spfile) .............. [%s] 3 - Backup directory (archive_copy_dir) . [%s] Parameter fuers Zurueckladen der Profile und Protokolle von lokaler %s-Plattensicherung 1 - Sicherungsprofil (profile) ............... [%s] 2 - Oracle-Spfile (spfile) ................... [%s] 3 - Sicherungsverzeichnis (archive_copy_dir) . [%s] Parameter fuers Zurueckladen der Steuerdateien von lokaler %s-Plattensicherung 1 - Sicherungsprofil (profile) ............... [%s] 2 - Oracle-Spfile (spfile) ................... [%s] 3 - Sicherungsverzeichnis (archive_copy_dir) . [%s] Parameters for restoring profiles and log files from remote %s disk backup 1 - Backup profile (profile) ............. [%s] 2 - Oracle spfile (spfile) ............... [%s] 3 - Backup directory (stage_root_dir) .... [%s] 4 - Remote host (remote_host) ............ [%s] 5 - Remote user (remote_user) ............ [%s] 6 - Remote copy command (stage_copy_cmd) . [%s] Parameter fuers Zurueckladen der Profile und Protokolle von remote %s-Plattensicherung 1 - Sicherungsprofil (profile) ............. [%s] 2 - Oracle-Spfile (spfile) ................. [%s] 3 - Sicherungsverzeichnis (stage_root_dir) . [%s] 4 - Remote Rechner (remote_host) ........... [%s] 5 - Remote Benutzer (remote_user) .......... [%s] 6 - Remote Copy-Kommando (stage_copy_cmd) .. [%s] Parameters for restoring profiles and log files from remote %s disk backup 1 - Backup profile (profile) ............. [%s] 2 - Oracle spfile (spfile) ............... [%s] 3 - Backup directory (archive_stage_dir) . [%s] 4 - Remote host (remote_host) ............ [%s] 5 - Remote user (remote_user) ............ [%s] 6 - Remote copy command (stage_copy_cmd) . [%s] Parameters for restoring control files from remote %s disk backup 1 - Backup profile (profile) ............. [%s] 2 - Oracle spfile (spfile) ............... [%s] 3 - Backup directory (archive_stage_dir) . [%s] 4 - Remote host (remote_host) ............ [%s] 5 - Remote user (remote_user) ............ [%s] 6 - Remote copy command (stage_copy_cmd) . [%s] Parameter fuers Zurueckladen der Profile und Protokolle von remote %s-Plattensicherung 1 - Sicherungsprofil (profile) ................ [%s] 2 - Oracle-Spfile (spfile) .................... [%s] 3 - Sicherungsverzeichnis (archive_stage_dir) . [%s] 4 - Remote Rechner (remote_host) .............. [%s] 5 - Remote Benutzer (remote_user) ............. [%s] 6 - Remote Copy-Kommando (stage_copy_cmd) ..... [%s] Parameter fuers Zurueckladen der Steuerdateien von remote %s-Plattensicherung 1 - Sicherungsprofil (profile) ................ [%s] 2 - Oracle-Spfile (spfile) .................... [%s] 3 - Sicherungsverzeichnis (archive_stage_dir) . [%s] 4 - Remote Rechner (remote_host) .............. [%s] 5 - Remote Benutzer (remote_user) ............. [%s] 6 - Remote Copy-Kommando (stage_copy_cmd) ..... [%s] Parameters for restoring profiles and log files from %s backup utility backup 1 - Backup profile (profile) .......... [%s] 2 - Oracle spfile (spfile) ............ [%s] 3 - BACKINT utility profile (parfile) . [%s] Parameters for restoring control files from %s backup utility backup 1 - Backup profile (profile) .......... [%s] 2 - Oracle spfile (spfile) ............ [%s] 3 - BACKINT utility profile (parfile) . [%s] Parameter fuers Zurueckladen der Profile und Protokolle von %s Backup-Utility-Sicherung 1 - Sicherungsprofil (profile) ....... [%s] 2 - Oracle-Spfile (spfile) ........... [%s] 3 - BACKINT-Utility-Profil (parfile) . [%s] Parameter fuers Zurueckladen der Steuerdateien von %s Backup-Utility-Sicherung 1 - Sicherungsprofil (profile) ....... [%s] 2 - Oracle-Spfile (spfile) ........... [%s] 3 - BACKINT-Utility-Profil (parfile) . [%s] Restore of profiles and log files from %s backup 1 - BR*Tools profile (init_sap) ........ [%s] 2 - Oracle profile (init_ora) .......... [%s] 3 - Oracle spfile (sp_file) ............ [%s] 4 - BACKINT utility profile (init_utl) . [%s] 5 - Detail log (det_log) ............... [%s] 6 - Summary log (sum_log) .............. [%s] 7 - BRSPACE summary log (space_log) .... [%s] 8 - BRSPACE structure log (struc_log) .. [%s] 9 - BRSPACE parameter log (param_log) .. [%s] 10 - Control file copy (control_file) ... [%s] 11 - Oracle wallet file (ora_wallet) .... [%s] Zurueckladen der Profile und Protokolle von %s-Sicherung 1 - BR*Tools-Profil (init_sap) ................. [%s] 2 - Oracle-Profil (init_ora) ................... [%s] 3 - Oracle-Spfile (sp_file) .................... [%s] 4 - BACKINT-Utility-Profil (init_utl) .......... [%s] 5 - Detailliertes Protokoll (det_log) .......... [%s] 6 - Summarisches Protokoll (sum_log) ........... [%s] 7 - BRSPACE summarisches Protokoll (space_log) . [%s] 8 - BRSPACE Strukturprotokoll (struc_log) ...... [%s] 9 - BRSPACE Parameterprotokoll (param_log) ..... [%s] 10 - Kopie der Steuerdatei (control_file) ....... [%s] 11 - Oracle Wallet-Datei (ora_wallet) ........... [%s] Restore of BRBACKUP detail logs Pos. Log Start Type Mode Device Rc Zurueckladen der detaillierten Protokolle von BRBACKUP Pos. Protokoll Start Typ Modus Geraet Rc Restore of BRARCHIVE detail logs Pos. Log Start Function Device Rc Zurueckladen der detaillierten Protokolle von BRARCHIVE Pos. Protokoll Start Funktion Geraet Rc BRSPACE options for rebuild of indexes of tablespace %s 1 - BRSPACE profile (profile) .......... [%s] 2 - Database user/password (user) ...... [%s] 3 - New destination tablespace (newts) . [%s] 4 - Parallel threads (iparallel) ....... [%s] 5 - Index parallel degree (idegree) .... [%s] 6 - Confirmation mode (confirm) ........ [%s] 7 - Extended output (output) ........... [%s] 8 - Scrolling line count (scroll) ...... [%s] 9 - Message language (language) ........ [%s] 10 - BRSPACE command line (command) ..... [%s] BRSPACE-Optionen fuer Neuaufbau der Indizes von Tablespace %s 1 - BRSPACE-Profil (profile) ............. [%s] 2 - Datenbankbenutzer/-Kennwort (user) ... [%s] 3 - Neuer Ziel-Tablespace (newts) ........ [%s] 4 - Parallele Threads (iparallel) ........ [%s] 5 - Index-Paralellitaetsgrad (idegree) ... [%s] 6 - Bestaetigungsmodus (confirm) ......... [%s] 7 - Erweiterte Ausgabe (output) .......... [%s] 8 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 9 - Meldungssprache (language) ........... [%s] 10 - BRSPACE-Kommandozeile (command) ...... [%s] List of indexes with NOLOGGING for rebuild Pos. Owner Index Created Part. Tablespace Liste der Indizes mit NOLOGGING fuer Neuaufbau Pos. Besitzer Index Angelegt Part. Tablespace %s options for rebuild of indexes with NOLOGGING 1 - Database user/password (user) ... [%s] 2 - Parallel threads (iparallel) .... [%s] 3 - Index parallel degree (idegree) . [%s] 4 - Confirmation mode (confirm) ..... [%s] 5 - Extended output (output) ........ [%s] 6 - Scrolling line count (scroll) ... [%s] 7 - Message language (language) ..... [%s] 8 - BRSPACE command line (command) .. [%s] %s options for rebuild of index partitions with NOLOGGING 1 - Database user/password (user) ... [%s] 2 - Parallel threads (iparallel) .... [%s] 3 - Index parallel degree (idegree) . [%s] 4 - Confirmation mode (confirm) ..... [%s] 5 - Extended output (output) ........ [%s] 6 - Scrolling line count (scroll) ... [%s] 7 - Message language (language) ..... [%s] 8 - BRSPACE command line (command) .. [%s] %s-Optionen fuer Neuaufbau von Indizes mit NOLOGGING 1 - Datenbankbenutzer/-Kennwort (user) ... [%s] 2 - Parallele Threads (iparallel) ........ [%s] 3 - Index-Paralellitaetsgrad (idegree) ... [%s] 4 - Bestaetigungsmodus (confirm) ......... [%s] 5 - Erweiterte Ausgabe (output) .......... [%s] 6 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 7 - Meldungssprache (language) ........... [%s] 8 - BRSPACE-Kommandozeile (command) ...... [%s] %s-Optionen fuer Neuaufbau von Index-Partition mit NOLOGGING 1 - Datenbankbenutzer/-Kennwort (user) ... [%s] 2 - Parallele Threads (iparallel) ........ [%s] 3 - Index-Paralellitaetsgrad (idegree) ... [%s] 4 - Bestaetigungsmodus (confirm) ......... [%s] 5 - Erweiterte Ausgabe (output) .......... [%s] 6 - Zeilenanzahl fuer Scrolling (scroll) . [%s] 7 - Meldungssprache (language) ........... [%s] 8 - BRSPACE-Kommandozeile (command) ...... [%s] Options for flashback of database %s 1 - Database flashback target (target) ... [%s] 2 - Database flashback command (command) . [%s] Optionen fuer Flashback der Datenbank %s 1 - Datenbank-Flashback-Ziel (target) ...... [%s] 2 - Datenbank-Flashback-Kommando (command) . [%s] List of index partitions with NOLOGGING for rebuild Pos. Owner Index Partition Created Tablespace Liste der Index-Partitionen mit NOLOGGING fuer Neuaufbau Pos. Besitzer Index Partition Angelegt Tablespace Database instance startup main menu 1 - Start up database 2 - Show instance status 3 - Exit program 4 - Reset program status Hauptmenue fuer Starten der Datenbankinstanz 1 - Datenbank starten 2 - Status der Instanz anzeigen 3 - Programm beenden 4 - Programmstatus zuruecksetzen List of database instances for startup Pos. Name No/Th. Status Start time RedoSeq. SapConn. Liste der Datenbankinstanzen fuer Starten Pos. Name Nr/Th. Status Startzeit RedoSeq. SapVerb. Options for starting up database instance %s 1 - Database startup to-state (state) . [%s] 2 - Database open mode (mode) ......... [%s] 3 - Force instance restart (force) .... [%s] 4 - SQLPLUS command (command) ......... [%s] Optionen fuer Starten der Datenbankinstanz %s 1 - Zielstatus fuer Datenbankstart (state) . [%s] 2 - Oeffnungsmodus der Datenbank (mode) .... [%s] 3 - Restart der Instanz erzwingen (force) .. [%s] 4 - SQLPLUS-Kommando (command) ............. [%s] Database instance shutdown main menu 1 - Shut down database 2 - Show instance status 3 - Exit program 4 - Reset program status Hauptmenue fuer Stoppen der Datenbankinstanz 1 - Datenbank stoppen 2 - Status der Instanz anzeigen 3 - Programm beenden 4 - Programmstatus zuruecksetzen List of database instances for shutdown Pos. Name No/Th. Status Start time RedoSeq. SapConn. Liste der Datenbankinstanzen fuer Stoppen Pos. Name Nr/Th. Status Startzeit RedoSeq. SapVerb. Options for shutting down database instance %s 1 - Database close mode (mode) ...... [%s] 2 - Force instance shutdown (force) . [%s] 3 - SQLPLUS command (command) ....... [%s] Optionen fuer Stoppen der Datenbankinstanz %s 1 - Schliessungsmodus der Datenbank (mode) . [%s] 2 - Stoppen der Instanz erzwingen (force) .. [%s] 3 - SQLPLUS-Kommando (command) ............. [%s] Alter database instance main menu 1 - Switch redolog file 2 - Force database checkpoint 3 - Set archivelog mode 4 - Set noarchivelog mode 5 - Show instance status 6 - Exit program 7 - Reset program status Hauptmenue fuer Aenderung von Datenbankinstanz 1 - Redolog-Datei umschalten 2 - Datenbank-Checkpoint erzwingen 3 - Archivelog-Modus setzen 4 - Noarchivelog-Modus setzen 5 - Status der Instanz anzeigen 6 - Programm beenden 7 - Programmstatus zuruecksetzen List of database instances for alter Pos. Name No/Th. Status Start time RedoSeq. SapConn. Liste der Datenbankinstanzen fuer Aenderung Pos. Name Nr/Th. Status Startzeit RedoSeq. SapVerb. Options for alter of database instance %s 1 - Current archivelog mode (mode) .. [%s] 2 - Alter database action (action) .. [%s] 3 - Force instance shutdown (force) . [%s] 4 - SQL command (command) ........... [%s] Optionen fuer Aenderung von Datenbankinstanz %s 1 - Aktueller Archivelog-Modus (mode) ..... [%s] 2 - Datenbank-Aenderungsaktion (action) ... [%s] 3 - Stoppen der Instanz erzwingen (force) . [%s] 4 - SQL-Kommando (command) ................ [%s] Alter database parameter main menu 1 - Change parameter value 2 - Reset parameter value 3 - Create init.ora from spfile 4 - Create init.mem from memory 5 - Show database parameters 6 - Show init.ora profile 7 - Exit program 8 - Reset program status Hauptmenue fuer Aenderung von Datenbankparameter 1 - Parameterwert aendern 2 - Parameterwert zuruecksetzen 3 - Init.ora von spfile erstellen 4 - Init.mem von Memory erstellen 5 - Datenbankparameter anzeigen 6 - Init.ora-Profil anzeigen 7 - Programm beenden 8 - Programmstatus zuruecksetzen List of database parameters for alter Pos. Parameter Modif. Spfile Inst. Deft. Value Liste der Datenbankparameter fuer Aenderung Pos. Parameter Modif. Spfile Inst. Deft. Wert Options for alter of database parameter '%s' 1 - Parameter description (desc) ..... [%s] 2 - Parameter type (type) ............ [%s] 3 - Current parameter value (parval) . [%s] 4 - Value in spfile (spfval) ......... [%s] 5 - New parameter value (value) ...... [%s] 6 - Scope for new value (scope) ...... [%s] 7 - Database instance (instance) ..... [%s] 8 - Comment on update (comment) ...... [%s] 9 - SQL command (command) ............ [%s] Optionen fuer Aenderung von Datenbankparameter '%s' 1 - Parameterbeschreibung (desc) ..... [%s] 2 - Parametertyp (type) .............. [%s] 3 - Aktueller Parameterwert (parval) . [%s] 4 - Wert in spfile (spfval) .......... [%s] 5 - Neuer Parameterwert (value) ...... [%s] 6 - Bereich fuer neuen Wert (scope) .. [%s] 7 - Datenbankinstanz (instance) ...... [%s] 8 - Aenderungskommentar (comment) .... [%s] 9 - SQL-Kommando (command) ........... [%s] Recreate database main menu 1 - Specify new database options 2 - Export user tablespaces 3 - Export global objects 4 - Create new database 5 - Import global objects 6 - Import user tablespaces 7 - Exit program 8 - Reset program status Hauptmenue fuer Neuanlegen von Datenbank 1 - Optionen fuer neue Datenbank spezifizieren 2 - Benutzer-Tablespaces exportieren 3 - Globale Objekte exportieren 4 - Neue Datenbank anlegen 5 - Globale Objekte importieren 6 - Benutzer-Tablespaces importieren 7 - Programm beenden 8 - Programmstatus zuruecksetzen Main options for recreate of database %s 1 - Password for SYS user (pass_sys) ...... [%s] 2 - Password for SYSTEM user (pass_syst) .. [%s] 3 - Max. number of instances (max_inst) ... [%s] 4 - Max. number of data files (max_data) .. [%s] 5 - Max. number of log groups (max_log) ... [%s] 6 - Max. number of log members (max_memb) . [%s] 7 - Max. size of log history (max_hist) ... [%s] Hauptoptionen fuer Neuanlegen von Datenbank %s 1 - Kennwort fuer SYS-Benutzer (pass_sys) ..... [%s] 2 - Kennwort fuer SYSTEM-Benutzer (pass_syst) . [%s] 3 - Max. Anzahl von Instanzen (max_inst) ...... [%s] 4 - Max. Anzahl von Datendateien (max_data) ... [%s] 5 - Max. Anzahl von Log-Gruppen (max_log) ..... [%s] 6 - Max. Anzahl von Log-Members (max_memb) .... [%s] 7 - Max. Groesse von Log-History (max_hist) ... [%s] SYSTEM tablespace options for recreate of database %s 1 - SYSTEM tablespace file (syst_file) ........ [%s] 2 - Raw disk / link target (syst_rawlink) ..... [%s] 3 - Size of the file in MB (syst_size) ........ [%s] 4 - File autoextend mode (syst_autoext) ....... [%s] 5 - Maximum file size in MB (syst_maxsize) .... [%s] 6 - File increment size in MB (syst_incrsize) . [%s] SYSTEM-Tablespace-Optionen fuer Neuanlegen von Datenbank %s 1 - SYSTEM-Tablespace-Datei (syst_file) ......... [%s] 2 - Raw-Platte / Linkziel (syst_rawlink) ........ [%s] 3 - Groesse der Datei in MB (syst_size) ......... [%s] 4 - Autoextend-Modus der Datei (syst_autoext) ... [%s] 5 - Maximale Dateigroesse in MB (syst_maxsize) .. [%s] 6 - Groesse des Zuwachses in MB (syst_incrsize) . [%s] SYSAUX tablespace options for recreate of database %s 1 - SYSAUX tablespace file (aux_file) ........ [%s] 2 - Raw disk / link target (aux_rawlink) ..... [%s] 3 - Size of the file in MB (aux_size) ........ [%s] 4 - File autoextend mode (aux_autoext) ....... [%s] 5 - Maximum file size in MB (aux_maxsize) .... [%s] 6 - File increment size in MB (aux_incrsize) . [%s] SYSAUX-Tablespace-Optionen fuer Neuanlegen von Datenbank %s 1 - SYSAUX-Tablespace-Datei (aux_file) ......... [%s] 2 - Raw-Platte / Linkziel (aux_rawlink) ........ [%s] 3 - Groesse der Datei in MB (aux_size) ......... [%s] 4 - Autoextend-Modus der Datei (aux_autoext) ... [%s] 5 - Maximale Dateigroesse in MB (aux_maxsize) .. [%s] 6 - Groesse des Zuwachses in MB (aux_incrsize) . [%s] Temp and undo tablespace options for recreate of database %s 1 - Temp tablespace name (temp_tsp) ....... [%s] 2 - Temp tablespace file (temp_file) ...... [%s] 3 - Raw disk / link target (temp_rawlink) . [%s] 4 - Size of the file in MB (temp_size) .... [%s] 5 - Undo tablespace name (undo_tsp) ....... [%s] 6 - Undo tablespace file (undo_file) ...... [%s] 7 - Raw disk / link target (undo_rawlink) . [%s] 8 - Size of the file in MB (undo_size) .... [%s] Temp- und Undo-Tablespace-Optionen fuer Neuanlegen von Datenbank %s 1 - Temp-Tablespace-Name (temp_tsp) ...... [%s] 2 - Temp-Tablespace-Datei (temp_file) .... [%s] 3 - Raw-Platte / Linkziel (temp_rawlink) . [%s] 4 - Groesse der Datei in MB (temp_size) .. [%s] 5 - Undo-Tablespace-Name (undo_tsp) ...... [%s] 6 - Undo-Tablespace-Datei (undo_file) .... [%s] 7 - Raw-Platte / Linkziel (undo_rawlink) . [%s] 8 - Groesse der Datei in MB (undo_size) .. [%s] Online redo log options for log group %s 1 - Redo log file size in MB (log_size) ... [%s] 2 - Original redo log file (orig_file) .... [%s] 3 - Raw disk / link target (orig_rawlink) . [%s] 4 - Mirror redo log file (mirr_file) ...... [%s] 5 - Raw disk / link target (mirr_rawlink) . [%s] Online-Redo-Log-Optionen fuer Log-Gruppe %s 1 - Redo-Log-Datei-Groesse in MB (log_size) . [%s] 2 - Original-Redo-Log-Datei (orig_file) ..... [%s] 3 - Raw-Platte / Linkziel (orig_rawlink) .... [%s] 4 - Spiegel-Redo-Log-Datei (mirr_file) ...... [%s] 5 - Raw-Platte / Linkziel (mirr_rawlink) .... [%s] Show database information main menu 1 - Show database instance information 2 - Show database space information 3 - Show database segment information 4 - Exit program Hauptmenue fuer Anzeige der Datenbankinformationen 1 - Datenbankinstanz-Informationen anzeigen 2 - Datenbankplatz-Informationen anzeigen 3 - Datenbanksegment-Informationen anzeigen 4 - Programm beenden Show database instance information 1 - Show instance status 2 - Show database parameters 3 - Show database owners 4 - Show flashback status 5 - Show encryption status 6 - Back to previous menu 7 - Reset program status Anzeige der Datenbankinstanz-Informationen 1 - Instanzstatus anzeigen 2 - Datenbankparameter anzeigen 3 - Datenbankbesitzer anzeigen 4 - Flashback-Status anzeigen 5 - Verschluesselungsstatus anzeigen 6 - Zurueck zum vorigen Menue 7 - Programmstatus zuruecksetzen Show database space information 1 - Show tablespaces 2 - Show data files 3 - Show redolog files 4 - Show control files 5 - Show disk volumes 6 - Back to previous menu 7 - Reset space info Anzeige der Datenbankplatz-Informationen 1 - Tablespaces anzeigen 2 - Datendateien anzeigen 3 - Redolog-Dateien anzeigen 4 - Steuerdateien anzeigen 5 - Plattendatentraeger anzeigen 6 - Zurueck zum vorigen Menue 7 - Platzinfo zuruecksetzen Show database segment information 1 - Show tables 2 - Show indexes 3 - Show table partitions 4 - Show index partitions 5 - Show segments 6 - Show segment extents 7 - Show free extents 8 - Back to previous menu 9 - Reset segment info Anzeige der Datenbanksegment-Informationen 1 - Tabellen anzeigen 2 - Indizes anzeigen 3 - Tabellen-Partitionen anzeigen 4 - Index-Partitionen anzeigen 5 - Segmente anzeigen 6 - Extents der Segmente anzeigen 7 - Freie Extents anzeigen 8 - Zurueck zum vorigen Menue 9 - Segmentinfo zuruecksetzen List of database instances Pos. Name No/Th. Status Start time RedoSeq. SapConn. Liste der Datenbankinstanzen Pos. Name Nr/Th. Status Startzeit RedoSeq. SapVerb. Information about the status of database instance %s 1 - Instance number (number) ........... %s 2 - Instance thread (thread) ........... %s 3 - Instance status (status) ........... %s 4 - Instance start time (start) ........ %s 5 - Oracle version (version) ........... %s 6 - Database creation time (create) .... %s 7 - Last resetlogs time (resetlogs) .... %s 8 - Archivelog mode (archmode) ......... %s 9 - Archiver status (archiver) ......... %s 10 - Current redolog sequence (redoseq) . %s 11 - Current redolog SCN (redoscn) ...... %s 12 - Flashback status (flashback) ....... %s 13 - Block change tracking (tracking) ... %s 14 - Data encryption (encryption) ....... %s 15 - Database vault (dbvault) ........... %s 16 - Number of SAP connections (sapcon) . %s Informationen ueber den Status der Datenbankinstanz %s 1 - Instanznummer (number) ................. %s 2 - Instanz-Thread (thread) ................ %s 3 - Status der Instanz (status) ............ %s 4 - Startzeit der Instanz (start) .......... %s 5 - Oracle-Version (version) ............... %s 6 - Erstellungszeit der Datenbank (create) . %s 7 - Zeit des letzten Resetlogs (resetlogs) . %s 8 - Archivelog-Modus (archmode) ............ %s 9 - Archiver-Status (archiver) ............. %s 10 - Aktuelle Redolog-Sequenz (redoseq) ..... %s 11 - Aktuelle Redolog-SCN (redoscn) ......... %s 12 - Flashback-Status (flashback) ........... %s 13 - Block-Change-Tracking (tracking) ....... %s 14 - Datenverschluesselung (encryption) ..... %s 15 - Datenbank-Vault (dbvault) ... ......... %s 16 - Anzahl der SAP-Verbindingen (sapcon) ... %s List of database parameters Pos. Parameter Modif. Spfile Inst. Deft. Value Liste der Datenbankparameter Pos. Parameter Modif. Spfile Inst. Deft. Wert Information about database parameter '%s' 1 - Parameter description (desc) . %s 2 - Parameter type (type) ........ %s 3 - Modifiable attribute (modif) . %s 4 - Defined in spfile (spfile) ... %s 5 - Database instance (instance) . %s 6 - Default value (default) ...... %s 7 - Parameter value (value) ...... %s 8 - Value in spfile (spfval) ..... %s 9 - Comment on update (comment) .. %s Informationen ueber den Datenbankparameter '%s' 1 - Parameterbeschreibung (desc) .. %s 2 - Parametertyp (type) ........... %s 3 - Aenderungsattribut (modif) .... %s 4 - Definiert in spfile (spfile) .. %s 5 - Datenbankinstanz (instance) ... %s 6 - Default-Wert (default) ........ %s 7 - Parameterwert (value) ......... %s 8 - Wert in spfile (spfval) ....... %s 9 - Aenderungskommentar (comment) . %s List of database tablespaces Pos. Tablespace Type Status ExtMan. SegMan. Back. BigFi. Files/AuEx. Compr. Encr. Total[KB] Used[%] Free[KB] MaxSize[KB] ExtSize[KB] FreeExt. Largest[KB] List of database tablespaces Pos. Tablespace Type Status ExtMan. SegMan. Back. BigFi. Files/AuEx. Total[KB] Used[%] Free[KB] MaxSize[KB] ExtSize[KB] FreeExt. Largest[KB] Liste der Datenbank-Tablespaces Pos. Tablespace Typ Status ExtVerw. SegVerw. Sich. BigFi. Date./AuEx. Kompr. Verschl. Gesamt[KB] Benu.[%] Frei[KB] Maxgroe.[KB] ExtGroe.[KB] FreiExt. Groesste[KB] Liste der Datenbank-Tablespaces Pos. Tablespace Typ Status ExtVerw. SegVerw. Sich. BigFi. Date./AuEx. Gesamt[KB] Benu.[%] Frei[KB] Maxgroe.[KB] ExtGroe.[KB] FreiExt. Groesste[KB] Information about tablespace %s 1 - Tablespace type (type) ................... %s 2 - Tablespace status (status) ............... %s 3 - Extent management (extent) ............... %s 4 - Segment space managenent (space) ......... %s 5 - Backup status (backup) ................... %s 6 - Bigfile tablespace (bigfile) ............. %s 7 - Number of files in tablespace (files) .... %s 8 - Number of autoextensible files (autoext) . %s 9 - Tablespace compression (compression) ..... %s 10 - Tablespace encryption (encryption) ....... %s 11 - Total tablespace size in KB (total) ...... %s 12 - Used space in tablespace in %% (used) ..... %s 13 - Free space in tablespace in KB (free) .... %s 14 - Maximum tablespace size in KB (maxsize) .. %s 15 - Maximum extension size in KB (extsize) ... %s 16 - Used space as to max. size in %% (used) ... %s 17 - Free space as to max. size in KB (free) .. %s 18 - Allocated disk space in KB (space) ....... %s 19 - Number of free extents (freext) .......... %s 20 - Largest free extents (largest) ........... %s Information about tablespace %s 1 - Tablespace type (type) ................... %s 2 - Tablespace status (status) ............... %s 3 - Extent management (extent) ............... %s 4 - Segment space managenent (space) ......... %s 5 - Backup status (backup) ................... %s 6 - Bigfile tablespace (bigfile) ............. %s 7 - Number of files in tablespace (files) .... %s 8 - Number of autoextensible files (autoext) . %s 9 - Total tablespace size in KB (total) ...... %s 10 - Used space in tablespace in %% (used) ..... %s 11 - Free space in tablespace in KB (free) .... %s 12 - Maximum tablespace size in KB (maxsize) .. %s 13 - Maximum extension size in KB (extsize) ... %s 14 - Used space as to max. size in %% (used) ... %s 15 - Free space as to max. size in KB (free) .. %s 16 - Allocated disk space in KB (space) ....... %s 17 - Number of free extents (freext) .......... %s 18 - Largest free extents (largest) ........... %s Informationen ueber Tablespace %s 1 - Tablespace-Typ (type) .......................... %s 2 - Tablespace-Status (status) ..................... %s 3 - Extent-Verwaltung (extent) ..................... %s 4 - Segmentplatz-verwaltung (space) ................ %s 5 - Sicherungsstatus (backup) ...................... %s 6 - Bigfile-Tablespace (bigfile) ................... %s 7 - Anzahl der Dateien im Tablespace (files) ....... %s 8 - Anzahl der Dateien mit Autoextend (autoext) .... %s 9 - Tablespace-Komprimierung (compression) ......... %s 10 - Tablespace-Verschluesselung (encryption) ....... %s 11 - Gesamtgroesse des Tablespace (total) ........... %s 12 - Benutzter Platz im Tablespace in %% (used) ...... %s 13 - Freier Platz im Tablespace in KB (free) ........ %s 14 - Maximale Tablespace-Groesse in KB (maxsize) .... %s 15 - Maximale Erweiterungsgroesse in KB (extsize) ... %s 16 - Benutzter Platz bzgl. max. Groesse in %% (used) . %s 17 - Freier Platz bzgl. max. Groesse in KB (free) ... %s 18 - Allokierter Plattenplatz in KB (space) ......... %s 19 - Anzahl der freien Extents (freext) ............. %s 20 - Groesste freie Extents (largest) ............... %s Informationen ueber Tablespace %s 1 - Tablespace-Typ (type) .......................... %s 2 - Tablespace-Status (status) ..................... %s 3 - Extent-Verwaltung (extent) ..................... %s 4 - Segmentplatz-verwaltung (space) ................ %s 5 - Sicherungsstatus (backup) ...................... %s 6 - Bigfile-Tablespace (bigfile) ................... %s 7 - Anzahl der Dateien im Tablespace (files) ....... %s 8 - Anzahl der Dateien mit Autoextend (autoext) .... %s 9 - Gesamtgroesse des Tablespace (total) ........... %s 10 - Benutzter Platz im Tablespace in %% (used) ...... %s 11 - Freier Platz im Tablespace in KB (free) ........ %s 12 - Maximale Tablespace-Groesse in KB (maxsize) .... %s 13 - Maximale Erweiterungsgroesse in KB (extsize) ... %s 14 - Benutzter Platz bzgl. max. Groesse in %% (used) . %s 15 - Freier Platz bzgl. max. Groesse in KB (free) ... %s 16 - Allokierter Plattenplatz in KB (space) ......... %s 17 - Anzahl der freien Extents (freext) ............. %s 18 - Groesste freie Extents (largest) ............... %s List of database data files Pos. Tablespace Status Type File Id. Size[KB] Device Back. AuExt. MaxSize[KB] IncrSize[KB] Liste der Datenbank-Datendateien Pos. Tablespace Status Typ Datei Id. Groesse[KB] Geraet Sich. AuExt. MaxGroe.[KB] InkrGroe.[KB] Information about data file %s 1 - Data file Id (file_id) ............... %s 2 - Data file status (status) ............ %s 3 - Tablespace name (tablespace) ......... %s 4 - Backup status (backup) ............... %s 5 - Data file type (type) ................ %s 6 - Disk device Id (device) .............. %s 7 - Data file size in KB (size) .......... %s 8 - File autoextend mode (autoextend) .... %s 9 - Maximum file size in KB (maxsize) .... %s 10 - File increment size in KB (incrsize) . %s 11 - Allocated disk space in KB (space) ... %s 12 - Data file creation time (crtime) ..... %s 13 - Data file creation SCN (crscn) ....... %s Informationen ueber Datendatei %s 1 - Datendatei-Id (file_id) ................. %s 2 - Datendateistatus (status) ............... %s 3 - Tablespace-Name (tablespace) ............ %s 4 - Sicherungsstatus (backup) ............... %s 5 - Datendateityp (type) .................... %s 6 - Plattendatentraeger-Id (device) ......... %s 7 - Datendateigroesse in KB (size) .......... %s 8 - Autoextend-Modus der Datei (autoextend) . %s 9 - Maximale Dateigroesse in KB (maxsize) ... %s 10 - Groesse des Zuwachses in KB (incrsize) .. %s 11 - Allokierter Plattenplatz in KB (space) .. %s 12 - Erstellungszeit der Datei (crtime) ...... %s 13 - Erstellungs-SCN der Datei (crscn) ....... %s List of database online redolog files Pos. Status Thd Grp Mmb Sequence Size[KB] Device Type File Liste der Datenbank-Online-Redolog-Dateien Pos. Status Thd Grp Mgl Sequenz Groe.[KB] Geraet Typ Datei Information about online redolog file %s 1 - Redolog thread number (thread) ..... %s 2 - Redolog group number (group) ....... %s 3 - Redolog group member (member) ...... %s 4 - Redolog sequence number (sequence) . %s 5 - Redolog file status (status) ....... %s 6 - Redolog file type (type) ........... %s 7 - Disk device Id (device) ............ %s 8 - Redolog file size in KB (size) ..... %s Informationen ueber Online-Redolog-Datei %s 1 - Redolog-Thread-Nummer (thread) .... %s 2 - Redolog-Gruppennummer (group) ..... %s 3 - Redolog-Gruppenmitglied (member) .. %s 4 - Redolog-Sequenznummer (sequence) .. %s 5 - Redolog-Dateistatus (status) ...... %s 6 - Redolog-Dateityp (type) ........... %s 7 - Plattendatentraeger-Id (device) ... %s 8 - Redolog-Dateigroesse in KB (size) . %s List of database control files Pos. Size[KB] Device Type File Liste der Datenbank-Steuerdateien Pos. Groe.[KB] Geraet Typ Datei Information about control file %s 1 - Control file type (type) ....... %s 2 - Disk device Id (device) ........ %s 3 - Control file size in KB (size) . %s Informationen ueber Steuerdatei %s 1 - Steuerdateityp (type) ........... %s 2 - Plattendatentraeger-Id (device) . %s 3 - Steuerdateigroesse in KB (size) . %s List of database disk volumes Pos. Device Total[KB] Used[%] Free[KB] Usable[KB] Dbfs/Lnks Directory/RawDisk Liste der Datenbank-Plattendatentraeger Pos. Geraet Gesamt[KB] Benu.[%] Frei[KB] Bentzb.[KB] Dbdt/Lnks Verzeichnis/RawPlatte Information about disk volume of %s 1 - Disk device Id (device) ................ %s 2 - Total space in KB (total) .............. %s 3 - Used space in %% (used) ................. %s 4 - Free space in KB (free) ................ %s 5 - Usable space in KB (usable) ............ %s 6 - All free space in KB (afree) ........... %s 7 - Max. still needed space in KB (needed) . %s 8 - Max. missing space in KB (missing) ..... %s 9 - Database file/link count (count) ....... %s Informationen ueber Plattendatentraeger von %s 1 - Plattendatentraeger-Id (device) ............ %s 2 - Gesamte Platz in KB (total) ................ %s 3 - Benutzter Platz in %% (used) ................ %s 4 - Freier Platz in KB (free) .................. %s 5 - Benutzbarer Platz in KB (usable) ........... %s 6 - Ganzer freier Platz in KB (afree) .......... %s 7 - Max. noch benoetigter Platz in KB (needed) . %s 8 - Max. fehlender Platz in KB (missing) ....... %s 9 - Anzahl Datenbankdateien/-Links (count) ..... %s List of database tables Pos. Owner Table Part. Prts Mon. Par. Inds Cmpr. LOBs/Cmp Tablespace Analyzed Rows Space[KB] Used[KB:%] Data[KB:%] List of database tables Pos. Owner Table Part. Parts Monit. Paral. Inds Tablespace Analyzed Rows Space[KB] Used[KB:%] Data[KB:%] Liste der Datenbank-Tabellen Pos. Besitzer Tabelle Part. Prts Mon. Par. Inds Kmpr. LOBs/Kmp Tablespace Analysiert Reihen Platz[KB] Benu.[KB:%] Daten[KB:%] Liste der Datenbank-Tabellen Pos. Besitzer Tabelle Part. Parts Monit. Paral. Inds Tablespace Analysiert Reihen Platz[KB] Benu.[KB:%] Daten[KB:%] Information about table %s 1 - Partitioned table (partitioned) ..... %s 2 - Number of partitions (partitions) ... %s 3 - Monitoring attribute (monitoring) ... %s 4 - Parallel degree (degree) ............ %s 5 - Index-organized table (iot) ......... %s 6 - Number of indexes (indexes) ......... %s 7 - Table compression (compress) ........ %s 8 - LOBs / LOB compression (lobs_compr) . %s 9 - Tablespace name (tablespace) ........ %s 10 - Last analyzed (analyzed) ............ %s 11 - Sample size (sample) ................ %s 12 - Number of rows (rows) ............... %s 13 - Allocated space in KB (space) ....... %s 14 - Used space in KB / %% (used) ......... %s 15 - Pure data in KB / %% (data) .......... %s 16 - Allocated LOB space in KB (lspace) .. %s 17 - Used LOB space in KB / %% (lused) .... %s 18 - Pure LOB data in KB / %% (ldata) ..... %s 19 - Number of chained rows (chained) .... %s 20 - Next extent size in KB (next) ....... %s 21 - Maximum number of extents (maxexts) . %s Information about table %s 1 - Partitioned table (partitioned) ..... %s 2 - Number of partitions (partitions) ... %s 3 - Monitoring attribute (monitoring) ... %s 4 - Parallel degree (degree) ............ %s 5 - Index-organized table (iot) ......... %s 6 - Number of indexes (indexes) ......... %s 7 - Tablespace name (tablespace) ........ %s 8 - Last analyzed (analyzed) ............ %s 9 - Sample size (sample) ................ %s 10 - Number of rows (rows) ............... %s 11 - Allocated space in KB (space) ....... %s 12 - Used space in KB / %% (used) ......... %s 13 - Pure data in KB / %% (data) .......... %s 14 - Allocated LOB space in KB (lspace) .. %s 15 - Used LOB space in KB / %% (lused) .... %s 16 - Pure LOB data in KB / %% (ldata) ..... %s 17 - Number of chained rows (chained) .... %s 18 - Next extent size in KB (next) ....... %s 19 - Maximum number of extents (maxexts) . %s Informationen ueber Tabelle %s 1 - Partitionierte Tabelle (partitioned) .... %s 2 - Anzahl der Partitionen (partitions) ..... %s 3 - Monitoring-Attribut (monitoring) ........ %s 4 - Parallelitaetsgrad (degree) ............. %s 5 - Index-organisierte Tabelle (iot) ........ %s 6 - Anzahl der Indizes (indexes) ............ %s 7 - Tabellenkomprimierung (compress) ........ %s 8 - LOBs / LOB-Komprimierung (lobs_compr) ... %s 9 - Tablespace-Name (tablespace) ............ %s 10 - Letzte Analyse (analyzed) ............... %s 11 - Probengroesse (sample) .................. %s 12 - Anzahl der Reihen (rows) ................ %s 13 - Allokierter Platz in KB (space) ......... %s 14 - Benutzter Platz in KB / %% (used) ........ %s 15 - Reine Daten in KB / %% (data) ............ %s 16 - Allokierter LOB-Platz in KB (lspace) .... %s 17 - Benutzter LOB-Platz in KB / %% (lused) ... %s 18 - Reine LOB-Daten in KB / %% (ldata) ....... %s 19 - Anzahl der verketteten Reihen (chained) . %s 20 - Next-Extent-Groesse in KB (next) ........ %s 21 - Maximale Anzahl der Extents (maxexts) ... %s Informationen ueber Tabelle %s 1 - Partitionierte Tabelle (partitioned) .... %s 2 - Anzahl der Partitionen (partitions) ..... %s 3 - Monitoring-Attribut (monitoring) ........ %s 4 - Parallelitaetsgrad (degree) ............. %s 5 - Index-organisierte Tabelle (iot) ........ %s 6 - Anzahl der Indizes (indexes) ............ %s 7 - Tablespace-Name (tablespace) ............ %s 8 - Letzte Analyse (analyzed) ............... %s 9 - Probengroesse (sample) .................. %s 10 - Anzahl der Reihen (rows) ................ %s 11 - Allokierter Platz in KB (space) ......... %s 12 - Benutzter Platz in KB / %% (used) ........ %s 13 - Reine Daten in KB / %% (data) ............ %s 14 - Allokierter LOB-Platz in KB (lspace) .... %s 15 - Benutzter LOB-Platz in KB / %% (lused) ... %s 16 - Reine LOB-Daten in KB / %% (ldata) ....... %s 17 - Anzahl der verketteten Reihen (chained) . %s 18 - Next-Extent-Groesse in KB (next) ........ %s 19 - Maximale Anzahl der Extents (maxexts) ... %s List of database indexes Pos. Owner Table Index Prt. Prts Mon. Par. Tablespace Analyzed Rows Space[KB] Used[KB:%] Data[KB:%] Liste der Datenbank-Indizes Pos. Besitzer Tabelle Index Prt. Prts Mon. Par. Tablespace Analysiert Reihen Platz[KB] Benu.[KB:%] Daten[KB:%] Information about index %s 1 - Unique index (unique) ............... %s 2 - Bitmap index (bitmap) ............... %s 3 - Partitioned index (partitioned) ..... %s 4 - Number of partitions (partitions) ... %s 5 - Usage monitoring (monitoring) ....... %s 6 - Parallel degree (degree) ............ %s 7 - IOT top index (iot_top) ............. %s 8 - Table name (table) .................. %s 9 - Tablespace name (tablespace) ........ %s 10 - Last analyzed (analyzed) ............ %s 11 - Sample size (sample) ................ %s 12 - Number of rows (rows) ............... %s 13 - Allocated space in KB (space) ....... %s 14 - Used space in KB / %% (used) ......... %s 15 - Pure data in KB / %% (data) .......... %s 16 - Next extent size in KB (next) ....... %s 17 - Maximum number of extents (maxexts) . %s Informationen ueber Index %s 1 - Unique-Index (unique) ................. %s 2 - Bitmap-Index (bitmap) ................. %s 3 - Partitionierter Index (partitioned) ... %s 4 - Anzahl der Partitionen (partitions) ... %s 5 - Verwendungsmonitoring (monitoring) .... %s 6 - Parallelitaetsgrad (degree) ........... %s 7 - IOT-Top-Index (iot_top) ............... %s 8 - Tabellenname (table) .................. %s 9 - Tablespace-Name (tablespace) .......... %s 10 - Letzte Analyse (analyzed) ............. %s 11 - Probengroesse (sample) ................ %s 12 - Anzahl der Reihen (rows) .............. %s 13 - Allokierter Platz in KB (space) ....... %s 14 - Benutzter Platz in KB / %% (used) ...... %s 15 - Reine Daten in KB / %% (data) .......... %s 16 - Next-Extent-Groesse in KB (next) ...... %s 17 - Maximale Anzahl der Extents (maxexts) . %s List of table partitions Pos. Owner Table Partition Compr. LOBs/Cmp. Tablespace Analyzed Rows Space[KB] Used[KB:%] Data[KB:%] List of table partitions Pos. Owner Table Partition Tablespace Analyzed Rows Space[KB] Used[KB:%] Data[KB:%] Liste der Tabellen-Partitionen Pos. Besitzer Tabelle Partition Kompr. LOBs/Kmp. Tablespace Analysiert Reihen Platz[KB] Benu.[KB:%] Daten[KB:%] Liste der Tabellen-Partitionen Pos. Besitzer Tabelle Partition Tablespace Analysiert Reihen Platz[KB] Benu.[KB:%] Daten[KB:%] Information about table partition %s 1 - Hash partition (hash) ............... %s 2 - Partition compression (compress) .... %s 3 - LOBs / LOB compression (lobs_compr) . %s 4 - Tablespace name (tablespace) ........ %s 5 - Last analyzed (analyzed) ............ %s 6 - Sample size (sample) ................ %s 7 - Number of rows (rows) ............... %s 8 - Allocated space in KB (space) ....... %s 9 - Used space in KB / %% (used) ......... %s 10 - Pure data in KB / %% (data) .......... %s 11 - Allocated LOB space in KB (lspace) .. %s 12 - Used LOB space in KB / %% (lused) .... %s 13 - Pure LOB data in KB / %% (ldata) ..... %s 14 - Number of chained rows (chained) .... %s 15 - Next extent size in KB (next) ....... %s 16 - Maximum number of extents (maxexts) . %s Information about table partition %s 1 - Hash partition (hash) ............... %s 2 - Tablespace name (tablespace) ........ %s 3 - Last analyzed (analyzed) ............ %s 4 - Sample size (sample) ................ %s 5 - Number of rows (rows) ............... %s 6 - Allocated space in KB (space) ....... %s 7 - Used space in KB / %% (used) ......... %s 8 - Pure data in KB / %% (data) .......... %s 9 - Allocated LOB space in KB (lspace) .. %s 10 - Used LOB space in KB / %% (lused) .... %s 11 - Pure LOB data in KB / %% (ldata) ..... %s 12 - Number of chained rows (chained) .... %s 13 - Next extent size in KB (next) ....... %s 14 - Maximum number of extents (maxexts) . %s Informationen ueber Tabellen-Partition %s 1 - Hash-Partition (hash) ................... %s 2 - Partitionskomprimierung (compress) ...... %s 3 - LOBs / LOB-Komprimierung (lobs_compr) ... %s 4 - Tablespace-Name (tablespace) ............ %s 5 - Letzte Analyse (analyzed) ............... %s 6 - Probengroesse (sample) .................. %s 7 - Anzahl der Reihen (rows) ................ %s 8 - Allokierter Platz in KB (space) ......... %s 9 - Benutzter Platz in KB / %% (used) ........ %s 10 - Reine Daten in KB / %% (data) ............ %s 11 - Allokierter LOB-Platz in KB (lspace) .... %s 12 - Benutzter LOB-Platz in KB / %% (lused) ... %s 13 - Reine LOB-Daten in KB / %% (ldata) ....... %s 14 - Anzahl der verketteten Reihen (chained) . %s 15 - Next-Extent-Groesse in KB (next) ........ %s 16 - Maximale Anzahl der Extents (maxexts) ... %s Informationen ueber Tabellen-Partition %s 1 - Hash-Partition (hash) ................... %s 2 - Tablespace-Name (tablespace) ............ %s 3 - Letzte Analyse (analyzed) ............... %s 4 - Probengroesse (sample) .................. %s 5 - Anzahl der Reihen (rows) ................ %s 6 - Allokierter Platz in KB (space) ......... %s 7 - Benutzter Platz in KB / %% (used) ........ %s 8 - Reine Daten in KB / %% (data) ............ %s 9 - Allokierter LOB-Platz in KB (lspace) .... %s 10 - Benutzter LOB-Platz in KB / %% (lused) ... %s 11 - Reine LOB-Daten in KB / %% (ldata) ....... %s 12 - Anzahl der verketteten Reihen (chained) . %s 13 - Next-Extent-Groesse in KB (next) ........ %s 14 - Maximale Anzahl der Extents (maxexts) ... %s List of index partitions Pos. Owner Table Index Partition Tablespace Analyzed Rows Space[KB] Liste der Index-Partitionen Pos. Besitzer Tabelle Index Partition Tablespace Analysiert Reihen Platz[KB] Information about index partition %s 1 - Hash partition (hash) ............... %s 2 - Table name (table) .................. %s 3 - Tablespace name (tablespace) ........ %s 4 - Last analyzed (analyzed) ............ %s 5 - Sample size (sample) ................ %s 6 - Number of rows (rows) ............... %s 7 - Allocated space in KB (space) ....... %s 8 - Next extent size in KB (next) ....... %s 9 - Maximum number of extents (maxexts) . %s Informationen ueber Index-Partition %s 1 - Hash-Partition (hash) ................. %s 2 - Tabellenname (table) .................. %s 3 - Tablespace-Name (tablespace) .......... %s 4 - Letzte Analyse (analyzed) ............. %s 5 - Probengroesse (sample) ................ %s 6 - Anzahl der Reihen (rows) .............. %s 7 - Allokierter Platz in KB (space) ....... %s 7 - Next-Extent-Groesse in KB (next) ...... %s 9 - Maximale Anzahl der Extents (maxexts) . %s List of database segments Pos. Owner Type Segment Partition Tablespace Size[KB] Extents NextExt[KB] MaxExts Liste der Datenbank-Segmente Pos. Besitzer Typ Segment Partition Tablespace Groesse[KB] Extents NextExt[KB] MaxExts Information about segment %s 1 - Segment type (type) ................. %s 2 - Tablespace name (tablespace) ........ %s 3 - Segment size in KB (size) ........... %s 4 - Number of extents (extents) ......... %s 5 - Next extent size in KB (next) ....... %s 6 - Maximum number of extents (maxexts) . %s Informationen ueber Segment %s 1 - Segmenttyp (type) ..................... %s 2 - Tablespace-Name (tablespace) .......... %s 3 - Segmentgroesse in KB (size) ........... %s 4 - Anzahl der Extents (extents) .......... %s 5 - Next-Extent-Groesse in KB (next) ...... %s 6 - Maximale Anzahl der Extents (maxexts) . %s List of segment extents Pos. Owner Type Segment Partition Tablespace ExtentId FileId BlockId Size[KB] Liste der Segment-Extents Pos. Besitzer Typ Segment Partition Tablespace ExtentId DateiId BlockId Groesse[KB] Information about extent of segment %s 1 - Segment type (type) ............ %s 2 - Tablespace name (tablespace) ... %s 3 - Data file (file) ............... %s 4 - Extent Id (extent_id) .......... %s 5 - File Id (file_id) .............. %s 6 - Relative file number (file_no) . %s 7 - Block Id (block_id) ............ %s 8 - Extent size in KB (size) ....... %s Informationen ueber Extent von Segment %s 1 - Segmenttyp (type) .............. %s 2 - Tablespace-Name (tablespace) ... %s 3 - Datendatei (file) .............. %s 4 - Extent-Id (extent_id) .......... %s 5 - Datei-Id (file_id) ............. %s 6 - Relative Dateinummer (file_no) . %s 7 - Block-Id (block_id) ............ %s 8 - Extent-Groesse in KB (size) .... %s List of free extents Pos. Tablespace FileId BlockId Size[KB] Liste der freien Extents Pos. Tablespace DateiId BlockId Groesse[KB] Information about free extent in database %s 1 - Tablespace name (tablespace) ... %s 2 - Data file (file) ............... %s 3 - File Id (file_id) .............. %s 4 - Relative file number (file_no) . %s 5 - Block Id (block_id) ............ %s 6 - Extent size in KB (size) ....... %s Informationen ueber freies Extent in Datenbank %s 1 - Tablespace-Name (tablespace) ... %s 2 - Datendatei (file) .............. %s 3 - Datei-Id (file_id) ............. %s 4 - Relative Dateinummer (file_no) . %s 5 - Block-Id (block_id) ............ %s 6 - Extent-Groesse in KB (size) .... %s List of database owners Pos. Owner Id. Created ExpiryDate Deft-Tsp. Temp-Tsp Status Liste der Datenbankbesitzers Pos. Besitzer Id. Erstellt Ablaufsdat. Deft-Tsp. Temp-Tsp Status Information about database owner %s 1 - Owner Id (owner_id) ............. %s 2 - Created date (created) .......... %s 3 - Expiry date (expiry) ............ %s 4 - Default tablespace (deft_tsp) ... %s 5 - Temporary tablespace (temp_tsp) . %s 6 - Owner status (status) ........... %s Informationen ueber Datenbankbesitzer %s 1 - Besitzer-Id (owner_id) ............ %s 2 - Erstellungsdatum (created) ........ %s 3 - Ablaulfsdatum (expiry) ............ %s 4 - Default-Tablespace (deft_tsp) ..... %s 5 - Temporaerer Tablespace (temp_tsp) . %s 6 - Besitzerstatus (status) ........... %s Tablespace extension main menu 1 - Extend tablespace 2 - Show tablespaces 3 - Show data files 4 - Show disk volumes 5 - Exit program 6 - Reset program status Hauptmenue fuer Tablespace-Erweiterung 1 - Tablespace erweitern 2 - Tablespaces anzeigen 3 - Datendateien anzeigen 4 - Plattendatentraeger anzeigen 5 - Programm beenden 6 - Programmstatus zuruecksetzen List of tablespaces for extension Pos. Tablespace Files/AuExt. Total[KB] Used[%] Free[KB] MaxSize[KB] Liste der Tablespaces fuer Erweiterung Pos. Tablespace Datei./AuExt. Gesamt[KB] Benu.[%] Frei[KB] MaxGroe.[KB] Options for extension of tablespace %s 1 - Last added file name (lastfile) ....... [%s] 2 - Last added file size in MB (lastsize) . [%s] 3 - New file to be added (file) ........... [%s] 4 - Raw disk / link target (rawlink) ...... [%s] 5 - Size of the new file in MB (size) ..... [%s] 6 - File autoextend mode (autoextend) ..... [%s] 7 - Maximum file size in MB (maxsize) ..... [%s] 8 - File increment size in MB (incrsize) .. [%s] 9 - SQL command (command) ................. [%s] Optionen fuer Erweiterung von Tablespace %s 1 - Letzte hinzugefuegte Datei (lastfile) ...... [%s] 2 - Groesse der letzten Datei in MB (lastsize) . [%s] 3 - Neu hinzuzufuegende Datei (file) ........... [%s] 4 - Raw-Platte / Linkziel (rawlink) ............ [%s] 5 - Groesse der neuen Datei in MB (size) ....... [%s] 6 - Autoextend-Modus der Datei (autoextend) .... [%s] 7 - Maximale Dateigroesse in MB (maxsize) ...... [%s] 8 - Groesse des Zuwachses in MB (incrsize) ..... [%s] 9 - SQL-Kommando (command) ..................... [%s] Tablespace creation main menu 1 - Create tablespace 2 - Show tablespaces 3 - Show data files 4 - Show disk volumes 5 - Exit program 6 - Reset program status Hauptmenue fuer Anlegen von Tablespace 1 - Tablespace anlegen 2 - Tablespaces anzeigen 3 - Datendateien anzeigen 4 - Plattendatentraeger anzeigen 5 - Programm beenden 6 - Programmstatus zuruecksetzen Main options for creation of tablespace in database %s 1 - Tablespace name (tablespace) ......... [%s] 2 - Tablespace contents (contents) ....... [%s] 3 - Segment space management (space) ..... [%s] 4 - Database owner of tablespace (owner) . [%s] 5 - Table data class / tabart (class) .... [%s] 6 - Data type in tablespace (data) ....... [%s] 7 - Joined index/table tablespace (join) . [%s] 8 - Uniform size in MB (uniform) ......... [%s] 9 - Bigfile tablespace (bigfile) ......... [%s] 10 - Tablespace compression (compress) .... [%s] 11 - Tablespace encryption (encryption) ... [%s] 12 - Encryption algorithm (algorithm) ..... [%s] Hauptoptionen fuer Anlegen von Tablespace in Datenbank %s 1 - Tablespace-Name (tablespace) ............. [%s] 2 - Tablespace-Inhalt (contents) ............. [%s] 3 - Segment-Platzverwaltung (space) .......... [%s] 4 - Datenbankbesitzer des Tablespace (owner) . [%s] 5 - Tabellen-Datenart / Tabart (class) ....... [%s] 6 - Datentyp in Tablespace (data) ............ [%s] 7 - Index-/Tabellen-Tablespace (join) ........ [%s] 8 - Uniform-Groesse in MB (uniform) .......... [%s] 9 - Bigfile-Tablespace (bigfile) ............. [%s] 10 - Tablespace-Komprimierung (compress) ...... [%s] 11 - Tablespace-Verschluesselung (encryption) . [%s] 12 - Verschluesselungsalgorithmus (algorithm) . [%s] Space options for creation of tablespace %s 1 - Tablespace file name (file) .......... [%s] 2 - Raw disk / link target (rawlink) ..... [%s] 3 - File size in MB (size) ............... [%s] 4 - File autoextend mode (autoextend) .... [%s] 5 - Maximum file size in MB (maxsize) .... [%s] 6 - File increment size in MB (incrsize) . [%s] 7 - SQL command (command) ................ [%s] Platz-Optionen fuer Anlegen von Tablespace %s 1 - Tablespace-Dateiname (file) ............. [%s] 2 - Raw-Platte / Linkziel (rawlink) ......... [%s] 3 - Groesse der Datei in MB (size) .......... [%s] 4 - Autoextend-Modus der Datei (autoextend) . [%s] 5 - Maximale Dateigroesse in MB (maxsize) ... [%s] 6 - Groesse des Zuwachses in MB (incrsize) .. [%s] 7 - SQL-Kommando (command) .................. [%s] Space options for creation of index tablespace %s 1 - Index tablespace file name (xfile) .... [%s] 2 - Raw disk / link target (xrawlink) ..... [%s] 3 - File size in MB (xsize) ............... [%s] 4 - File autoextend mode (xautoextend) .... [%s] 5 - Maximum file size in MB (xmaxsize) .... [%s] 6 - File increment size in MB (xincrsize) . [%s] 7 - SQL command (command) ................. [%s] Platz-Optionen fuer Anlegen von Index-Tablespace %s 1 - Index-Tablespace-Dateiname (xfile) ....... [%s] 2 - Raw-Platte / Linkziel (xrawlink) ......... [%s] 3 - Groesse der Datei in MB (xsize) .......... [%s] 4 - Autoextend-Modus der Datei (xautoextend) . [%s] 5 - Maximale Dateigroesse in MB (xmaxsize) ... [%s] 6 - Groesse des Zuwachses in MB (xincrsize) .. [%s] 7 - SQL-Kommando (command) ................... [%s] Tablespace drop main menu 1 - Drop tablespace 2 - Show tablespaces 3 - Show data files 4 - Show disk volumes 5 - Exit program 6 - Reset program status Hauptmenue fuer Loeschen von Tablespace 1 - Tablespace loeschen 2 - Tablespaces anzeigen 3 - Datendateien anzeigen 4 - Plattendatentraeger anzeigen 5 - Programm beenden 6 - Programmstatus zuruecksetzen List of tablespaces for dropping Pos. Tablespace Files/AuExt. Total[KB] Used[%] Free[KB] MaxSize[KB] Liste der Tablespaces fuer Loeschen Pos. Tablespace Datei./AuExt. Gesamt[KB] Benu.[%] Frei[KB] MaxGroe.[KB] Options for dropping of tablespace %s 1 - Number of files in tablespace (files) . [%s] 2 - Total tablespace size in MB (size) .... [%s] 3 - Force tablespace drop (force) ......... [%s] 4 - SQL command (command) ................. [%s] Optionen fuer Loeschen von Tablespace %s 1 - Anzahl der Dateien in Tablespace (files) ... [%s] 2 - Gesammtgroesse des Tablespace in MB (size) . [%s] 3 - Loeschen des Tablespace erzwingen (force) .. [%s] 4 - SQL-Kommando (command) ..................... [%s] Alter tablespace main menu 1 - Set tablespace online 2 - Set tablespace offline 3 - Set backup status 4 - Reset backup status 5 - Coalesce free extents 6 - Rename tablespace 7 - Show tablespaces 8 - Show data files 9 - Exit program 10 - Reset program status Hauptmenue fuer Aenderung von Tablespace 1 - Tablespace online setzen 2 - Tablespace offline setzen 3 - Sicherungsstatus setzen 4 - Sicherungsstatus zuruecksetzen 5 - Freie Extents zusammenfuegen 6 - Tablespace umbenennen 7 - Tablespaces anzeigen 8 - Datendateien anzeigen 9 - Programm beenden 10 - Programmstatus zuruecksetzen List of tablespaces for alter Pos. Tablespace Files/AuExt. Type Status SegMan. ExtMan. Backup Liste der Tablespaces fuer Aenderung Pos. Tablespace Datei./AuExt. Type Status SegVerw. ExtVerw. Sicher. Options for alter of tablespace %s 1 - Current tablespace status (status) . [%s] 2 - Current backup status (backup) ..... [%s] 3 - Alter tablespace action (action) ... [%s] 4 - Set offline mode (mode) ............ [%s] 5 - New tablespace name (name) ......... [%s] 6 - Force tablespace alter (force) ..... [%s] 7 - SQL command (command) .............. [%s] Optionen fuer Aenderung von Tablespace %s 1 - Aktueller Tablespace-Status (status) ... [%s] 2 - Aktueller Sicherungsstatus (backup) .... [%s] 3 - Tablespace-Aenderungsaktion (action) ... [%s] 4 - Setzen-Offline-Modus (mode) ............ [%s] 5 - Neuer Tablespace-Name (name) ........... [%s] 6 - Tablespace-Aenderung erzwingen (force) . [%s] 7 - SQL-Kommando (command) ................. [%s] Alter data file main menu 1 - Set data file online 2 - Set data file offline 3 - Turn on and maintain autoextend 4 - Turn off autoextend 5 - Resize data file 6 - Rename data file 7 - Drop empty data file 8 - Show data files 9 - Show tablespaces 10 - Show disk volumes 11 - Exit program 12 - Reset program status Hauptmenue fuer Aenderung von Datendatei 1 - Datendatei online setzen 2 - Datendatei offline setzen 3 - Autoextend einschalten und pflegen 4 - Autoextend ausschalten 5 - Groesse der Datendatei aendern 6 - Datendatei umbenennen 7 - Leere Datendatei loeschen 8 - Datendateien anzeigen 9 - Tablespaces anzeigen 10 - Plattendatentraeger anzeigen 11 - Programm beenden 12 - Programmstatus zuruecksetzen List of data files for alter Pos. Tablespace Status Type Size[KB] AuExt. File Liste der Datendateien fuer Aenderung Pos. Tablespace Status Typ Groesse[KB] AuExt. Datei Options for alter of data file %s 1 - Current data file status (status) ....... [%s] 2 - Current data file size in MB (currsize) . [%s] 3 - Alter data file action (action) ......... [%s] 4 - Maximum file size in MB (maxsize) ....... [%s] 5 - File increment size in MB (incrsize) .... [%s] 6 - New data file size in MB (size) ......... [%s] 7 - New data file name (name) ............... [%s] 8 - Force data file alter (force) ........... [%s] 9 - SQL command (command) ................... [%s] Optionen fuer Aenderung von Datendatei %s 1 - Aktueller Datendatei-Status (status) ........ [%s] 2 - Aktuelle Datendateigroesse in MB (currsize) . [%s] 3 - Datendatei-Aenderungsaktion (action) ........ [%s] 4 - Maximale Dateigroesse in MB (maxsize) ....... [%s] 5 - Groesse des Zuwachses in MB (incrsize) ...... [%s] 6 - Neue Datendateigroesse in MB (size) ......... [%s] 7 - Neuer Datendateiname (name) ................. [%s] 8 - Datendatei-Aenderung erzwingen (force) ...... [%s] 9 - SQL-Kommando (command) ...................... [%s] Move data file main menu 1 - Move data file 2 - Show data files 3 - Show tablespaces 4 - Show disk volumes 5 - Exit program 6 - Reset program status Hauptmenue fuer Verschiebung von Datendatei 1 - Datendatei verschieben 2 - Datendateien anzeigen 3 - Tablespaces anzeigen 4 - Plattendatentraeger anzeigen 5 - Programm beenden 6 - Programmstatus zuruecksetzen List of data files for moving Pos. Tablespace Status Type Size[KB] File Liste der Datendateien fuer Verschiebung Pos. Tablespace Status Typ Groesse[KB] Datei Options for moving data file %s 1 - Current file size in MB (currsize) . [%s] 2 - Current link target (currlink) ..... [%s] 3 - Move destination (destination) ..... [%s] 4 - Raw disk / link target (rawlink) ... [%s] 5 - Parallel copy processes (parallel) . [%s] 6 - Force instance shutdown (force) .... [%s] 7 - SQL command (command) .............. [%s] Optionen fuer Verschiebung von Datendatei %s 1 - Aktuelle Dateigroesse in MB (currsize) . [%s] 2 - Aktuelles Linkziel (currlink) .......... [%s] 3 - Verschiebungsziel (destination) ........ [%s] 4 - Raw-Platte / Linkziel (rawlink) ........ [%s] 5 - Parallele Kopierprozesse (parallel) .... [%s] 6 - Stoppen der Instanz erzwingen (force) .. [%s] 7 - SQL-Kommando (command) ................. [%s] Table reorganization main menu 1 - Reorganize tables 2 - Reorganize table partitions 3 - Check tables for reorganization 4 - Cleanup after aborted reorganization 5 - Convert LONG fields to LOBs 6 - Convert old LOBs to new LOBs 7 - Convert heap tables to IOTs 8 - Convert IOTs to heap tables 9 - Show tables 10 - Show table partitions 11 - Show tablespaces 12 - Exit program 13 - Reset program status Hauptmenue fuer Reorganisation von Tabellen 1 - Tabellen reorganisieren 2 - Tabellen-Partitionen reorganisieren 3 - Tabellen ueberpruefen fuer Reorganisation 4 - Aufraeumen nach abgebrochener Reorganisation 5 - LONG-Felder zu LOBs konvertieren 6 - Alte LOBs zu neuen LOBs konvertieren 7 - Heap-Tabellen zu IOTs konvertieren 8 - IOTs zu Heap-Tabellen konvertieren 9 - Tabellen anzeigen 10 - Tabellen-Partitionen anzeigen 11 - Tablespaces anzeigen 12 - Programm beenden 13 - Programmstatus zuruecksetzen List of tables for reorganization Pos. Owner Table Pt. DgPk. Rows Used[KB] Data[KB:%] Liste der Tabellen fuer Reorganisation Pos. Besitzer Tabelle Pt. DgPk. Reihen Benu.[KB] Daten[KB:%] Options for reorganization of tables: %s 1 - Reorganization action (action) ............ [%s] 2 - Reorganization mode (mode) ................ [%s] 3 - Create DDL statements (ddl) ............... [%s] 4 - New destination tablespace (newts) ........ [%s] 5 - Separate index tablespace (indts) ......... [%s] 6 - Parallel threads (parallel) ............... [%s] 7 - Table/index parallel degree (degree) ...... [%s] 8 - Category of initial extent size (initial) . [%s] 9 - Sort by fields of index (sortind) ......... [%s] 10 - Index for IOT conversion (iotind) ......... [%s] 11 - Compression action (compress) ............. [%s] 12 - LOB compression degree (lobcompr) ......... [%s] 13 - Index compression method (indcompr) ....... [%s] Options for reorganization of table partitions: %s 1 - Reorganization action (action) ............ [%s] 2 - Reorganization mode (mode) ................ [%s] 3 - Create DDL statements (ddl) ............... [%s] 4 - New destination tablespace (newts) ........ [%s] 5 - Separate index tablespace (indts) ......... [%s] 6 - Parallel threads (parallel) ............... [%s] 7 - Table/index parallel degree (degree) ...... [%s] 8 - Category of initial extent size (initial) . [%s] 9 - Sort by fields of index (sortind) ......... [%s] 10 - Index for IOT conversion (iotind) ......... [%s] 11 - Compression action (compress) ............. [%s] 12 - LOB compression degree (lobcompr) ......... [%s] 13 - Index compression method (indcompr) ....... [%s] Optionen fuer Reorganisation von Tabellen: %s 1 - Reorganisationsaktion (action) ................. [%s] 2 - Reorganisationsmodus (mode) .................... [%s] 3 - DDL-Anweisungen erstellen (ddl) ................ [%s] 4 - Neuer Ziel-Tablespace (newts) .................. [%s] 5 - Getrennter Index-Tablespace (indts) ............ [%s] 6 - Parallele Threads (parallel) ................... [%s] 7 - Tabellen-/Index-Paralellitaetsgrad (degree) .... [%s] 8 - Kategorie der Initial-Extent-Groesse (initial) . [%s] 9 - Sortierien nach Feldern von Index (sortind) .... [%s] 10 - Index fuer IOT-Konversion (iotind) ............. [%s] 11 - Komprimierungsaktion (compress) ................ [%s] 12 - LOB-Komprimierungsgrad (lobcompr) .............. [%s] 13 - Index-Komprimierungsmethode (indcompr) ......... [%s] Optionen fuer Reorganisation von Tabellen-Partitionen: %s 1 - Reorganisationsaktion (action) ................. [%s] 2 - Reorganisationsmodus (mode) .................... [%s] 3 - DDL-Anweisungen erstellen (ddl) ................ [%s] 4 - Neuer Ziel-Tablespace (newts) .................. [%s] 5 - Getrennter Index-Tablespace (indts) ............ [%s] 6 - Parallele Threads (parallel) ................... [%s] 7 - Tabellen-/Index-Paralellitaetsgrad (degree) .... [%s] 8 - Kategorie der Initial-Extent-Groesse (initial) . [%s] 9 - Sortierien nach Feldern von Index (sortind) .... [%s] 10 - Index fuer IOT-Konversion (iotind) ............. [%s] 11 - Komprimierungsaktion (compress) ................ [%s] 12 - LOB-Komprimierungsgrad (lobcompr) .............. [%s] 13 - Index-Komprimierungsmethode (indcompr) ......... [%s] Rebuild indexes main menu 1 - Rebuild indexes 2 - Rebuild index partitions 3 - Check indexes for rebuild 4 - Show indexes 5 - Show index partitions 6 - Show tables 7 - Show tablespaces 8 - Exit program 9 - Reset program status Hauptmenue fuer Neuaufbau von Indizes 1 - Indizes neu aufbauen 2 - Index-Partitionen neu aufbauen 3 - Indizes ueberpruefen fuer Neuaufbau 4 - Indizes anzeigen 5 - Index-Partitionen anzeigen 6 - Tabellen anzeigen 7 - Tablespaces anzeigen 8 - Programm beenden 9 - Programmstatus zuruecksetzen List of indexes for rebuild Pos. Owner Table Index Pt. Dg. Tablespace Liste der Indizes fuer Neuaufbau Pos. Besitzer Tabelle Index Pt. Dg. Tablespace Options for rebuild of indexes: %s 1 - Rebuild action (action) ................... [%s] 2 - Rebuild mode (mode) ....................... [%s] 3 - New destination tablespace (newts) ........ [%s] 4 - Parallel threads (parallel) ............... [%s] 5 - Index parallel degree (degree) ............ [%s] 6 - Category of initial extent size (initial) . [%s] 7 - Compression action (compress) ............. [%s] 8 - Index compression method (indcompr) ....... [%s] Options for rebuild of index partitions: %s 1 - Rebuild action (action) ................... [%s] 2 - Rebuild mode (mode) ....................... [%s] 3 - New destination tablespace (newts) ........ [%s] 4 - Parallel threads (parallel) ............... [%s] 5 - Index parallel degree (degree) ............ [%s] 6 - Category of initial extent size (initial) . [%s] 7 - Compression action (compress) ............. [%s] 8 - Index compression method (indcompr) ....... [%s] Optionen fuer Neuaufbau von Indizes: %s 1 - Neuaufbauaktion (action) ....................... [%s] 2 - Neuaufbaumodus (mode) .......................... [%s] 3 - Neuer Ziel-Tablespace (newts) .................. [%s] 4 - Parallele Threads (parallel) ................... [%s] 5 - Index-Paralellitaetsgrad (degree) .............. [%s] 6 - Kategorie der Initial-Extent-Groesse (initial) . [%s] 7 - Komprimierungsaktion (compress) ................ [%s] 8 - Index-Komprimierungsmethode (indcompr) ......... [%s] Optionen fuer Neuaufbau von Index-Partitionen: %s 1 - Neuaufbauaktion (action) ....................... [%s] 2 - Neuaufbaumodus (mode) .......................... [%s] 3 - Neuer Ziel-Tablespace (newts) .................. [%s] 4 - Parallele Threads (parallel) ................... [%s] 5 - Index-Paralellitaetsgrad (degree) .............. [%s] 6 - Kategorie der Initial-Extent-Groesse (initial) . [%s] 7 - Komprimierungsaktion (compress) ................ [%s] 8 - Index-Komprimierungsmethode (indcompr) ......... [%s] Export tables main menu 1 - Export tables with EXP 2 - Export tables with EXPDP 3 - Show tables 4 - Show indexes 5 - Show tablespaces 6 - Exit program 7 - Reset program status Hauptmenue fuer Export von Tabellen 1 - Tabellen exportieren mit EXP 2 - Tabellen exportieren mit EXPDP 3 - Tabellen anzeigen 4 - Indizes anzeigen 5 - Tablespaces anzeigen 6 - Programm beenden 7 - Programmstatus zuruecksetzen List of tables for export Pos. Owner Table Part. Rows Used[KB] Data[KB:%] Liste der Tabellen fuer Export Pos. Besitzer Tabelle Part. Reihen Benu.[KB] Daten[KB:%] Main options for export of tables: %s 1 - Export utility (utility) ............... [%s] 2 - Tablespaces for export (tablespaces) ... [%s] 3 - Owner for export (owner) ............... [%s] 4 - Export table rows (rows) ............... [%s] 5 - Export table indexes (indexes) ......... [%s] 6 - Export table constraints (constraints) . [%s] 7 - Export table grants (grants) ........... [%s] 8 - Export table triggers (triggers) ....... [%s] Hauptoptionen fuer Export von Tabellen: %s 1 - Export-Utility (utility) ....................... [%s] 2 - Tablespaces fuer Export (tablespaces) .......... [%s] 3 - Besitzer fuer Export (owner) ................... [%s] 4 - Tabellen-Daten exportieren (rows) .............. [%s] 5 - Tabellen-Indizes exportieren (indexes) ......... [%s] 6 - Tabellen-Constraints exportieren (constraints) . [%s] 7 - Tabellen-Grants exportieren (grants) ........... [%s] 8 - Tabellen-Triggers exportieren (triggers) ....... [%s] Additional options for export of tables: %s 1 - Use direct path (direct) ................ [%s] 2 - Export buffer size in KB (buffer) ....... [%s] 3 - Compress table extents/data (compress) .. [%s] 4 - Consistent export (consistent) .......... [%s] 5 - Parallel degree (parallel) .............. [%s] 6 - Max. size of dump file in MB (filesize) . [%s] 7 - Force table export (force) .............. [%s] 8 - EXP/EXPDP command (command) ............. [%s] Weitere Optionen fuer Export von Tabellen: %s 1 - Direktpfad benutzen (direct) ................... [%s] 2 - Groesse des Exportpuffers in KB (buffer) ....... [%s] 3 - Tabellen-Extents/Daten komprimieren (compress) . [%s] 4 - Konsistenter Export (consistent) ............... [%s] 5 - Parallelitaetsgrad (parallel) .................. [%s] 6 - Max. Groesse der Dump-Datei in MB (filesize) ... [%s] 7 - Tabellen-Export erzwingen (force) .............. [%s] 8 - EXP/EXPDP-Kommando (command) ................... [%s] Import tables main menu 1 - Import tables 2 - Show BRSPACE export runs 3 - Exit program 4 - Reset program status Hauptmenue fuer Import von Tabellen 1 - Tabellen importieren 2 - BRSPACE-Export-Laeufe anzeigen 3 - Programm beenden 4 - Programmstatus zuruecksetzen List of BRSPACE exports for import Pos. Run Date Tables Dumps Size[KB] Util. Liste der BRSPACE-Exports fuer Import Pos. Lauf Datum Tabellen Dumps Groesse[KB] Util. Main options for import from dump file %s 1 - Import utility (utility) ............... [%s] 2 - Import type (type) ..................... [%s] 3 - Owner for import (owner) ............... [%s] 4 - Tables for import (tables) ............. [%s] 5 - Import table rows (rows) ............... [%s] 6 - Import table indexes (indexes) ......... [%s] 7 - Import table constraints (constraints) . [%s] 8 - Import table grants (grants) ........... [%s] 9 - Import table triggers (triggers) ....... [%s] Hauptoptionen fuer Import von Dump-Datei %s 1 - Import-Utility (utility) ....................... [%s] 2 - Importtyp (type) ............................... [%s] 3 - Besitzer fuer Import (owner) ................... [%s] 4 - Tabellen fuer Import (tables) .................. [%s] 5 - Tabellen-Daten Importieren (rows) .............. [%s] 6 - Tabellen-Indizes importieren (indexes) ......... [%s] 7 - Tabellen-Constraints importieren (constraints) . [%s] 8 - Tabellen-Grants importieren (grants) ........... [%s] 9 - Tabellen-Triggers importieren (triggers) ....... [%s] Additional options for import from dump file %s 1 - Import buffer size in KB (buffer) ....... [%s] 2 - Commit after each array insert (commit) . [%s] 3 - Ignore creation errors (ignore) ......... [%s] 4 - Table exists action (action) ............ [%s] 5 - Parallel degree (parallel) .............. [%s] 6 - Max. size of dump file in MB (filesize) . [%s] 7 - Force table import (force) .............. [%s] 8 - IMP/IMPDP command (command) ............. [%s] Weitere Optionen fuer Import von Dump-Datei %s 1 - Groesse des Importpuffers in KB (buffer) ..... [%s] 2 - Commit nach jedem Array-Insert (commit) ...... [%s] 3 - Fehler bei Anlegen ignorieren (ignore) ....... [%s] 4 - Aktion wenn Tabelle existiert (action) ....... [%s] 5 - Parallelitaetsgrad (parallel) ................ [%s] 6 - Max. Groesse der Dump-Datei in MB (filesize) . [%s] 7 - Tabellen-Import erzwingen (force) ............ [%s] 8 - IMP/IMPDP-Kommando (command) ................. [%s] List of BRSPACE export runs Pos. Run Date Tables Dumps Size[KB] Util. Liste der BRSPACE-Export-Laeufe Pos. Lauf Datum Tabellen Dumps Groesse[KB] Util. Alter tables main menu 1 - Switch on table monitoring 2 - Switch off table monitoring 3 - Set parallel degree 4 - Shrink tables 5 - Create segments 6 - Drop segments 7 - Show tables 8 - Show indexes 9 - Show tablespaces 10 - Exit program 11 - Reset program status Hauptmenue fuer Aenderung von Tabellen 1 - Tabellen-Monitoring einschalten 2 - Tabellen-Monitoring ausschalten 3 - Parallelitaetsgrad setzen 4 - Tabellen schrumpfen 5 - Segmente anlegen 6 - Segmente loeschen 7 - Tabellen anzeigen 8 - Indizes anzeigen 9 - Tablespaces anzeigen 10 - Programm beenden 11 - Programmstatus zuruecksetzen List of tables for alter Pos. Owner Table Part. Parts Monit. Paral. Liste der Tabellen fuer Aenderung Pos. Besitzer Tabelle Part. Parts Monit. Paral. Options for alter of tables: %s 1 - Current monitoring status (currmonit) . [%s] 2 - Current parallel degree (currdeg) ..... [%s] 3 - Alter table action (action) ........... [%s] 4 - New parallel degree (degree) .......... [%s] 5 - SQL command (command) ................. [%s] Optionen fuer Aenderung von Tabellen: %s 1 - Aktueller Monitoring-Status (currmonit) . [%s] 2 - Aktueller Paralletitaetsgrad (currdeg) .. [%s] 3 - Tabellen-Aenderungsaktion (action) ...... [%s] 4 - Neuer Parallelitaetsgrad (degree) ....... [%s] 5 - SQL-Kommando (command) .................. [%s] Alter indexes main menu 1 - Coalesce indexes 2 - Set parallel degree 3 - Shrink indexes 4 - Switch on index usage monitoring 5 - Switch off index usage monitoring 6 - Show indexes 7 - Show tables 8 - Show tablespaces 9 - Exit program 10 - Reset program status Hauptmenue fuer Aenderung von Indizes 1 - Indizes zusammenfuegen 2 - Parallelitaetsgrad setzen 3 - Indizes schrumpfen 4 - Monitoring von Index-Verwendung einschalten 5 - Monitoring von Index-Verwendung ausschalten 6 - Indizes anzeigen 7 - Tabellen anzeigen 8 - Tablespaces anzeigen 9 - Programm beenden 10 - Programmstatus zuruecksetzen List of indexes for alter Pos. Owner Table Index Prt. Prts Mon. Par. Liste der Indizes fuer Aenderung Pos. Besitzer Tabelle Index Prt. Prts Mon. Par. Options for alter of indexes: %s 1 - Current parallel degree (currdeg) . [%s] 2 - Alter index action (action) ....... [%s] 3 - New parallel degree (degree) ...... [%s] 4 - SQL command (command) ............. [%s] Optionen fuer Aenderung von Indizes: %s 1 - Aktueller Paralletitaetsgrad (currdeg) . [%s] 2 - Index-Aenderungsaktion (action) ........ [%s] 3 - Neuer Parallelitaetsgrad (degree) ...... [%s] 4 - SQL-Kommando (command) ................. [%s] List of table partitions for reorganization Pos. Owner Table Partition Rows Tablespace Liste der Tabellen-Partitionen fuer Reorganisation Pos. Besitzer Tabelle Partition Reihen Tablespace List of index partitions for rebuild Pos. Owner Table Index Partition Tablespace Liste der Index-Partitionen fuer Neuaufbau Pos. Besitzer Tabelle Index Partition Tablespace Manage database statistics main menu 1 - Export table statistics 2 - Import table statistics 3 - Delete table statistics 4 - Restore table statistics 5 - Lock table statistics 6 - Unlock table statistics 7 - Delete statistics exports 8 - Show statistics exports 9 - Show statistics versions 10 - Show tables 11 - Show tablespaces 12 - Exit program 13 - Reset program status Hauptmenue fuer Verwaltung von Datenbankstatistiken 1 - Tabellenstatistiken exportieren 2 - Tabellenstatistiken importieren 3 - Tabellenstatistiken loeschen 4 - Tabellenstatistiken zuruecksetzen 5 - Tabellenstatistiken sperren 6 - Tabellenstatistiken entsperren 7 - Tabellenstatistik-Exports loeschen 8 - Tabellenstatistik-Exports anzeigen 9 - Tabellenstatistik-Versionen anzeigen 10 - Tabellen anzeigen 11 - Tablespaces anzeigen 12 - Programm beenden 13 - Programmstatus zuruecksetzen List of tables for manage statistics action '%s' Pos. Owner Table Part. Vers. Lock Analyzed Rows Liste der Tabellen fuer Statistik-Verwaltungsaktion '%s' Pos. Besitzer Tabelle Part. Vers. Sper. Analysiert Reihen Options for manage statistics of tables: %s 1 - Last analyzed time stamp (analyzed) ......... [%s] 2 - Number of statistics versions (stats_vers) .. [%s] 3 - Current statistics lock status (stats_lock) . [%s] 4 - Manage statistics action (action) ........... [%s] 5 - Statistics export Id (expid) ................ [%s] 6 - Time for restore statistics (time) .......... [%s] Optionen fuer Statistikverwaltung von Tabellen: %s 1 - Zeitstempel der letzten Analyse (analyzed) ..... [%s] 2 - Anzahl der Statistikversionen (stats_vers) ..... [%s] 3 - Aktueller Statistik-Sperrstatus (stats_lock) ... [%s] 4 - Statistik-Verwaltungsaktion (action) ........... [%s] 5 - Statistikexport-Id (expid) ..................... [%s] 6 - Zeit fuer Zuruecksetzen von Statistiken (time) . [%s] List of statistics versions of table / for action: %s Pos. Analyzed Liste fuer Statistikversionen von Tabelle / fuer Aktion: %s Pos. Analysiert List of statistics exports for action '%s' Pos. Run Start time Export Id. Owner Tables Liste der Statistikexporte fuer Aktion '%s' Pos. Lauf Startzeit Export-Id. Besitzer Tabellen List of tables in statistics export / for action: %s Pos. Owner Table Analyzed Rows Liste der Tabellen in Statistikexport / fuer Aktion: %s Pos. Besitzer Tabelle Analysiert Reihen Manage flashback database main menu 1 - Switch on flashback database 2 - Switch off flashback database 3 - Create restore point 4 - Drop restore point 5 - Show flashback status 6 - Show restore points 7 - Exit program 8 - Reset program status Hauptmenue fuer Verwaltung von Datenbank-Flashback 1 - Datenbank-Flashback einschalten 2 - Datenbank-Flashback ausschalten 3 - Restore-Point anlegen 4 - Restore-Point loeschen 5 - Flashback-Status anzeigen 6 - Restore-Points anzeigen 7 - Programm beenden 8 - Programmstatus zuruecksetzen Options for switching on flashback for database %s 1 - Current retention time (currret) ...... [%s] 2 - New retention time in min (retention) . [%s] 3 - Force instance shutdown (force) ....... [%s] Optionen fuer Einschalten von Flashback fuer Datenbank %s 1 - Aktuelle Zeit der Aufbewahrung (currret) ...... [%s] 2 - Neue Zeit der Aufbewahrung in Min (retention) . [%s] 3 - Stoppen der Instanz erzwingen (force) ......... [%s] Status of flashback for database %s 1 - Flashback database status (status) ............ %s 2 - Oldest flashback time (oldest_time) ........... %s 3 - Oldest flashback SCN (oldest_scn) ............. %s 4 - Flashback retention time in min (retention) ... %s 5 - Current flashback size in KB (curr_size) ...... %s 6 - Estimated flashback size in KB (estim_size) ... %s 7 - Location of recovery area (ra_location) ....... %s 8 - Used space in recovery area in KB (ra_space) .. %s 9 - Space limit in recovery area in KB (ra_limit) . %s 10 - Reclaimable space in KB (ra_reclaim) .......... %s 11 - Number of files in recovery area (ra_files) ... %s Status von Flashback fuer Datenbank %s 1 - Status von Datenbank-Flashback (status) .............. %s 2 - Aelteste Flashback-Zeit (oldest_time) ................ %s 3 - Aelteste Flashback-SCN (oldest_scn) .................. %s 4 - Flashback-Aufbewahrungszeit in Min (retention) ....... %s 5 - Aktuelle Flashback-Groesse in KB (curr_size) ......... %s 6 - Geschaetzte Flashback-Groesse in KB (estim_size) ..... %s 7 - Lokation von Recovery-Bereich (ra_location) .......... %s 8 - Benutzter Platz in Recovery-Bereich in KB (ra_space) . %s 9 - Platz-Limit in Recovery-Bereich in KB (ra_limit) ..... %s 10 - Wieder verwendbarer Platz in KB (ra_reclaim) ......... %s 11 - Anzahl von Dateien in Recovery-Bereich (ra_files) .... %s Options for creating a restore point for database %s 1 - Restore point name (point) ........... [%s] 2 - Guaranteed restore point (guarantee) . [%s] 3 - Force instance shutdown (force) ...... [%s] Optionen fuer Anlegen von Restore-Point fuer Datenbank %s 1 - Restore-Point-Name (point) ............. [%s] 2 - Garantierter Restore-Point (guarantee) . [%s] 3 - Stoppen der Instanz erzwingen (force) .. [%s] List of restore points for action '%s' Pos. Restore point Grt. Time stamp SCN Stor.[KB] Liste von Restore-Points fuer Aktion '%s' Pos. Restore-Point Grt. Zeitstempel SCN Speic.[KB] Manage online redolog main menu 1 - Create redolog group 2 - Create redolog member 3 - Drop redolog group 4 - Drop redolog member 5 - Resize redolog files 6 - Rename to SAP standard name 7 - Move redolog files 8 - Switch redolog files 9 - Show redolog files 10 - Exit program 11 - Reset program status Hauptmenue fuer Verwaltung von Online-Redolog 1 - Redolog-Gruppe anlegen 2 - Redolog-Mitglied anlegen 3 - Redolog-Gruppe loeschen 4 - Redolog-Mitglied loeschen 5 - Redolog-Dateigroesse aendern 6 - Auf SAP-Standardnamen umbenennen 7 - Redolog-Dateien verschieben 8 - Redolog-Dateien umschalten 9 - Redolog-Dateien anzeigen 10 - Programm beenden 11 - Programmstatus zuruecksetzen List of online redolog files for action '%s' Pos. Status Thd Grp Mmb Sequence Size[KB] Type File Liste der Online-Redolog-Dateien fuer Aktion '%s' Pos. Status Thd Grp Mmb Sequenz Groe[KB] Typ Datei Options for managing online redolog for database instance %s 1 - Current number of redolog groups (curr_groups) ... [%s] 2 - Lowest/highest/current group number (lhc_group) .. [%s] 3 - Current number of redolog members (curr_members) . [%s] 4 - Lowest/highest member number (lh_member) ......... [%s] 5 - Current redolog file size / sequence (size_seq) .. [%s] 6 - Manage redolog action (action) ................... [%s] 7 - Redolog thread number (thread) ................... [%s] 8 - Redolog group number (group) ..................... [%s] 9 - Redolog member number (member) ................... [%s] 10 - New redolog file size in MB (size) ............... [%s] 11 - Redolog directory (directory) .................... [%s] 12 - SQL command (command) ............................ [%s] Options for managing online redolog for database instance %s 1 - Current number of redolog groups (curr_groups) ... [%s] 2 - Lowest/highest/current group number (lhc_group) .. [%s] 3 - Current number of redolog members (curr_members) . [%s] 4 - Lowest/highest member number (lh_member) ......... [%s] 5 - Current redolog file size / sequence (size_seq) .. [%s] 6 - Manage redolog action (action) ................... [%s] 7 - Redolog thread number (thread) ................... [%s] 8 - Redolog group number (group) ..................... [%s] 9 - Redolog member number (member) ................... [%s] 10 - New redolog file size in MB (size) ............... [%s] 11 - Redolog directory (dir_alias) .................... [%s] 12 - SQL command (command) ............................ [%s] Optionen fuer Verwalten von Online-Redolog fuer Datenbankinstanz %s 1 - Aktuelle Anzahl der Redolog-Gruppen (curr_groups) ..... [%s] 2 - Aktuelle Anzahl der Redolog-Mitglieder (curr_members) . [%s] 3 - Kleinste/groesste/aktuelle Gruppennummer (lhc_group) .. [%s] 4 - Kleinste/groesste Mitgliedsnummer (lh_member) ......... [%s] 5 - Aktuelle Redolog-Dateigroesse/-Sequenz (size_seq) ..... [%s] 6 - Redolog-Verwaltungsaktion (action) .................... [%s] 7 - Redolog-Thread-Nummer (thread) ........................ [%s] 8 - Redolog-Gruppennummer (group) ......................... [%s] 9 - Redolog-Mitgliedsnummer (member) ...................... [%s] 10 - Neue Redolog-Dateigroesse in MB (size) ................ [%s] 11 - Redolog-Verzeichnis (directory) ....................... [%s] 12 - SQL-Kommando (command) ................................ [%s] Optionen fuer Verwalten von Online-Redolog fuer Datenbankinstanz %s 1 - Aktuelle Anzahl der Redolog-Gruppen (curr_groups) ..... [%s] 2 - Aktuelle Anzahl der Redolog-Mitglieder (curr_members) . [%s] 3 - Kleinste/groesste/aktuelle Gruppennummer (lhc_group) .. [%s] 4 - Kleinste/groesste Mitgliedsnummer (lh_member) ......... [%s] 5 - Aktuelle Redolog-Dateigroesse/-Sequenz (size_seq) ..... [%s] 6 - Redolog-Verwaltungsaktion (action) .................... [%s] 7 - Redolog-Thread-Nummer (thread) ........................ [%s] 8 - Redolog-Gruppennummer (group) ......................... [%s] 9 - Redolog-Mitgliedsnummer (member) ...................... [%s] 10 - Neue Redolog-Dateigroesse in MB (size) ................ [%s] 11 - Redolog-Verzeichnis (dir_alias) ....................... [%s] 12 - SQL-Kommando (command) ................................ [%s] Manage data encryption main menu 1 - Open encryption wallet 2 - Close encryption wallet 3 - Create encryption wallet 4 - Delete encryption wallet 5 - Save encryption wallet 6 - Change wallet password 7 - Generate new master key 8 - Re-key encrypted tables 9 - Additional actions 10 - Exit program 11 - Reset program status Hauptmenue fuer Verwaltung von Datenverschluesselung 1 - Encryption-Wallet oeffnen 2 - Encryption-Wallet schliessen 3 - Encryption-Wallet anlegen 4 - Encryption-Wallet loeschen 5 - Encryption-Wallet speichern 6 - Wallet-Kennwort aendern 7 - Neuen Hauptschluessel generieren 8 - Verschluesselte Tabellen neu verschluesseln 9 - Weitere Aktionen 10 - Programm beenden 11 - Programmstatus zuruecksetzen Options for managing data encryption of database %s 1 - Database encryption wallet (wallet) ..... [%s] 2 - Database auto-open wallet (auto_wallet) . [%s] 3 - Database wallet status (status) ......... [%s] 4 - Manage encryption action (action) ....... [%s] 5 - Encrypted tables for re-key (table) ..... [%s] 6 - Wallet password (password) .............. [%s] 7 - New wallet password (newpass) ........... [%s] 8 - Encryption algorithm (algorithm) ........ [%s] 9 - Force re-key action (force) ............. [%s] 10 - Local auto-open wallet (local) .......... [%s] 11 - SQL command (command) ................... [%s] Optionen fuer Verwalten der Datenverschluesselung von Datenbank %s 1 - Datenbank-Encryption-Wallet (wallet) ......... [%s] 2 - Datenbank-Auto-Open-Wallet (auto_wallet) ..... [%s] 3 - Datenbank-Wallet-Status (status) ............. [%s] 4 - Verschluesselungs-Verwaltungsaktion (action) . [%s] 5 - Tabellen fuer Neuverschluesselung (table) .... [%s] 6 - Wallet-Kennwort (password) ................... [%s] 7 - Neues Wallet-Kennwort (newpass) .............. [%s] 8 - Verschluesselungsalgorithmus (algorithm) ..... [%s] 9 - Neuverschluesselungsaktion erzwingen (force) . [%s] 10 - Lokales Auto-Open-Wallet (local) ............. [%s] 11 - SQL-Kommando (command) ....................... [%s] List of encrypted tables for action '%s' Pos. Owner Table Columns Algorithm Liste der verschluesselen Tabellen fuer Aktion '%s' Pos. Besitzer Tabelle Spalten Algorithmus List of encrypted tables/columns for action '%s' Pos. Owner Table *Col./#Tsp. Algorithm Salt Liste der verschluesselen Tabellen/Spalten fuer Aktion '%s' Pos. Besitzer Tabelle *Splt./#Tbsp. Algorithmus Salz Additional data encryption actions 1 - Enable auto-open wallet 2 - Disable auto-open wallet 3 - Display database wallet info 4 - Show encryption status 5 - List encrypted tables/columns 6 - List encrypted tablespaces 7 - Main actions Weitere Datenverschluesselungsaktionen 1 - Auto-Open-Wallet aktivieren 2 - Auto-Open-Wallet deaktivieren 3 - Datenbank-Wallet-Info anzeigen 4 - Verschluesselungsstatus anzeigen 5 - Verschluesselte Tabellen/Spalten auflisten 6 - Verschluesselte Tablespaces auflisten 7 - Hauptaktionen Status of data encryption of database %s 1 - Database encryption wallet (wallet) .............. %s 2 - Database auto-open wallet (auto_wallet) .......... %s 3 - Database wallet status (status) .................. %s 4 - Number of encrypted tables/columns (tab_col) ..... %s 5 - Number of encrypted tablespaces/tables (tsp_tab) . %s Status der Datenverschluesselung von Datenbank %s 1 - Datenbank-Encryption-Wallet (wallet) ................... %s 2 - Datenbank-Auto-Open-Wallet (auto_wallet) ............... %s 3 - Datenbank-Wallet-Status (status) ....................... %s 4 - Anzahl verschluesselter Tabellen/Spalten (tab_col) ..... %s 5 - Anzahl verschluesselter Tablespaces/Tabellen (tsp_tab) . %s Last menuLetztes Menue1. Menu title ------------- BR*Tools main menu. 2. Menu type ------------ Choice menu. 3. Menu function ---------------- The functionality of BR*Tools is divided in several functional areas. Using this menu, you can select an area containing the required functions. 4. Menu description ------------------- The following main functional areas of BR*Tools can be selected using this menu: * Backup and database copy Comprises whole functionality of BRBACKUP and BRARCHIVE for backup of database, offline redolog (archivelog) and non-database files, for database copy and for backup verification with BRRESTORE. Some additional functions connected to backup, like determination of compression rates, preparation for RMAN backups or tape initialization, are also available in this area. * Restore and recovery Comprises whole functionality of BRRECOVER and BRRESTORE for database restore and recovery. * Check and verification Comprises functionality of BRCONNECT for database system check and validation of structure of tables and indexes. In addition, you can call here BRBACKUP for verification of database blocks with Oracle DBVERIFY utility. * Database statistics Comprises functionality of BRCONNECT for maitaining statistics of tables and indexes. * Profiles and logs In this area, you can view the database profile and the profiles and log files of BR*Tools. Some auxiliary functions of BR*Tools can be selected within the "Additional functions" menu. 1. Menuetitel ------------- BR*Tools-Hauptmenue. 2. Menuetyp ----------- Auswahlmenue. 3. Menuefunktion ---------------- Die Funktionalitaet der BR*Tools ist in einige funktionale Bereiche eingeteilt. Mit diesem Menue koennen Sie einen Bereich auswaehlen, der die geforderten Funktionen beinhaltet. 4. Menuebeschreibung -------------------- Die folgenden Hauptfuntionsbereiche der BR*Tools koennen mit diesem Menue gewaehlt werden: * Sicherung und Datenbankkopie Umfasst die ganze Funtionalitaet von BRABACKUP und BRARCHIVE fuer die Sicherung der Datenbankdateien, der Offline-Redo-Log-Dateien (Archive-Log) und Nicht-Datenbankdateien, und fuer die Verifikation der Sicherungen mit BRRESTORE. * Zurueckladen und Wiederherstellung Umfasst die ganze Funtionalitaet von BRRECOVER und BRRESTORE fuer Zurueckladen und Wiederherstellung der Datenbank. * Ueberpruefung und Verifikation Umfasst Funtionalitaet von BRCONNECT fuer Ueberpruefung des Datenbanksystems und Validierung der Struktur von Tabellen und Indizes. Zusaetzlich kann hier BRBACKUP fuer die Verifikation der Datenbankbloecke mit Oracle DBVERIFY-Utility aufgerufen werden. * Datenbankstatistiken Umfasst Funtionalitaet von BRCONNECT fuer Pflege der Statistiken von Tabellen und Indizes. * Profile und Protokolle In diesem Bereich koennen das Datenbankprofile und die Profile und die Protokolle der BR*Tools angezeigt werden. Einige zusaetzliche Funktionen der BR*Tools koennen innerhanb des Manues "Weitere Funktionen" augewaehlt werden. Additional BR*Tools functions Weitere BR*Tools-Funktionen Database instance management Verwaltung der Datenbankinstanz Database space management Verwaltung des Datenbankplatzes Additional database space functions Weitere Datenbankplatz-Funktionen Database segment management Verwaltung der Datenbanksegmente Additional database segment functions Weitere Datenbanksegment-Funktionen Backup and database copy Sicherung und Datenbankkopie Additional functions for backup and copy Weitere Funktionen fuer Sicherung und Kopie Restore and recovery Zurueckladen und Wiederherstellung Database check and verification Ueberpruefung und Verifikation der Datenbank Processing database statistics Bearbeitung der Datenbankstatistiken Show profiles and logs Anzeige der Profile und Protokolle BRBACKUP main options for backup and database copy BRBACKUP-Hauptoptionen fuer Sicherung und Datenbankkopie Additional BRBACKUP options for backup and database copy Weitere BRBACKUP-Optionen fuer Sicherung und Datenbankkopie BRARCHIVE main options for archivelog backup and verification BRARCHIVE-Hauptoptionen fuer Archivelog-Sicherung und -Verifikation Additional BRARCHIVE options for archivelog backup Weitere BRARCHIVE-Optionen fuer Archivelog-Sicherung BRBACKUP disk backups for backup BRBACKUP-Plattensicherungen zum Sichern BRBACKUP database backups for verification BRBACKUP-Datenbanksicherungen fuer Verifikation BRRESTORE main options for verification of database backup BRRESTORE-Hauptoptionen fuer Verifikation der Datenbanksicherung Additional BRRESTORE options for verification of database backup Weitere BRRESTORE-Optionen fuer Verifikation der Datenbanksicherung BRARCHIVE archivelog backups for verification BRARCHIVE-Archivelog-Sicherungen fuer Verifikation BRRESTORE main options for verification of archivelog backup of database instance BRRESTORE-Hauptoptionen fuer Verifikation der Archivelog-Sicherung von Datenbankinstanz Additional BRRESTORE options for verification of archivelog backup of database instance Weitere BRRESTORE-Optionen fuer Verifikation der Archivelog-Sicherung von Datenbankinstanz BRBACKUP options for determination of compression rates BRBACKUP-Optionen fuer Bestimmung der Komprimierungsraten BRBACKUP options for RMAN preparation BRBACKUP-Optionen fuer RMAN-Vorbereitung BRBACKUP disk backups for deletion BRBACKUP-Plattensicherungen zum Loeschen BRBACKUP options for deletion of disk backups BRBACKUP-Optionen fuer Loeschen der Plattensicherungen BRARCHIVE options for deletion of disk backups BRARCHIVE-Optionen fuer Loeschen der Plattensicherungen Options for controlling of BRARCHIVE run with option '-f' Optionen fuer Steuerung des BRARCHIVE-Laufs mit Option '-f' Options for initialization of BRBACKUP tape volumes Optionen fuer Initialisierung der BRBACKUP-Banddatentraeger Options for initialization of BRARCHIVE tape volumes Optionen fuer Initialisierung der BRARCHIVE-Banddatentraeger BRRECOVER options for restore and recovery BRRECOVER-Optionen fuer Zurueckladen und Wiederherstellung BRRECOVER options for disaster recovery BRRECOVER-Otionen fuer Katastrophen-Wiederherstellung BRCONNECT main options for database system check BRCONNECT-Hauptoptionen fuer Ueberpruefung des Datenbanksystems Additional BRCONNECT options for database system check Weitere BRCONNECT-Optionen fuer Ueberpruefung des Datenbanksystems BRCONNECT main options for validation of database structure BRCONNECT-Hauptoptionen fuer Validierung der Datenbankstruktur Additional BRCONNECT options for validation of database structure Weitere BRCONNECT-Optionen fuer Validierung der Datenbankstruktur BRBACKUP main options for verification of database blocks BRBACKUP-Hauptoptionen fuer Verifikation der Datenbankbloecke Additional BRBACKUP options for verification of database blocks Weitere BRBACKUP-Optionen fuer Verifikation der Datenbankbloecke BRCONNECT main options for update statistics BRCONNECT-Hauptoptionen fuer Aktualisierung der Statistiken Additional BRCONNECT options for update statistics Weitere BRCONNECT-Optionen fuer Aktualisierung der Statistiken BRCONNECT main options for collection of missing statistics BRCONNECT-Hauptoptionen fuer Sammlung der fehlenden Statistiken Additional BRCONNECT options for collection of missing statistics Weitere BRCONNECT-Optionen fuer Sammlung der fehlenden Statistiken BRCONNECT main options for deletion of harmful statistics BRCONNECT-Hauptoptionen fuer Loeschen der schaedlichen Statistiken Additional BRCONNECT options for deletion of harmful statistics Weitere BRCONNECT-Optionen fuer Loeschen der schaedlichen Statistiken Display of BRBACKUP logs Anzeige der BRBACKUP-Protokolle Display of BRARCHIVE logs Anzeige der BRARCHIVE-Protokolle Display of BRRESTORE logs Anzeige der BRRESTORE-Protokolle Display of BRRECOVER logs Anzeige der BRRECOVER-Protokolle Display of BRCONNECT logs Anzeige der BRCONNECT-Protokolle Display of BRSPACE logs Anzeige der BRSPACE-Protokolle BRCONNECT main options for cleanup of DBA logs (1) BRCONNECT-Hauptoptionen fuer Aufraeumen von DBA-Protokollen (1) BRCONNECT main options for cleanup of DBA logs (2) BRCONNECT-Hauptoptionen fuer Aufraeumen von DBA-Protokollen (2) Additional BRCONNECT options for cleanup of DBA logs Weitere BRCONNECT-Optionen fuer Aufraeumen von DBA-Protokollen BRCONNECT main options for adaption of NEXT extents BRCONNECT-Hauptoptionen fuer Anpassung von NEXT-Extents Additional BRCONNECT options for adaption of NEXT extents Weitere BRCONNECT-Optionen fuer Anpassung von NEXT-Extents BRCONNECT options for changing password of database owner BRCONNECT-Optionen fuer Aenderung des Kennworts von Datenbankbesitzer BRCONNECT options for creation of SAP/DBA synonyms BRCONNECT-Optionen fuer Anlegen von SAP/DBA-Synonymen BRSPACE main options for managing database statistics BRSPACE-Hauptoptionen fuer Verwaltung von Datenbankstatistiken Additional BRSPACE options for managing database statistics Weitere BRSPACE-Optionen fuer Verwaltung von Datenbankstatistiken BRSPACE main options for managing flashback database BRSPACE-Hauptoptionen fuer Verwaltung von Datenbank-Flashback BRCONNECT options for collection of dictionary statistics BRCONNECT-Optionen fuer Sammlung der Dictionary-Statistiken BRCONNECT options for collection of system statistics BRCONNECT-Optionen fuer Sammlung der System-Statistiken Changing password of database user Aenderung des Kennworts von Datenbankbenutzer BRSPACE options for database instance startup BRSPACE-Optionen fuer Starten der Datenbankinstanz BRSPACE options for database instance shutdown BRSPACE-Optionen fuer Stoppen der Datenbankinstanz BRSPACE options for alter database instance BRSPACE-Optionen fuer Aenderung von Datenbankinstanz BRSPACE options for alter database parameter BRSPACE-Optionen fuer Aenderung von Datenbankparameter BRSPACE main options for showing database information BRSPACE-Hauptoptionen fuer Anzeige der Datenbankinformationen Additional BRSPACE options for showing database information Weitere BRSPACE-Optionen fuer Anzeige der Datenbankinformationen BRSPACE options for recreate database BRSPACE-Optionen fuer Neuanlegen von Datenbank BRSPACE options for manage online redolog BRSPACE-Optionen fuer Verwalten von Online-Redolog BRSPACE options for manage data encryption BRSPACE-Optionen fuer Verwalten von Datenverschluesselung BRSPACE options for tablespace extension BRSPACE-Optionen fuer Tablespace-Erweiterung BRSPACE options for create tablespace BRSPACE-Optionen fuer Anlegen von Tablespace BRSPACE options for drop tablespace BRSPACE-Optionen fuer Loeschen von Tablespace BRSPACE options for alter tablespace BRSPACE-Optionen fuer Aenderung von Tablespace BRSPACE options for alter data file BRSPACE-Optionen fuer Aenderung von Datendatei BRSPACE options for move data file BRSPACE-Optionen fuer Verschiebung von Datendatei BRSPACE options for reorganization of tables BRSPACE-Optionen fuer Reorganisation von Tabellen BRSPACE options for rebuild of indexes BRSPACE-Optionen fuer Neuaufbau von Indizes BRSPACE options for export tables BRSPACE-Optionen fuer Export von Tabellen BRSPACE options for import tables BRSPACE-Optionen fuer Import von Tabellen BRSPACE options for alter tables BRSPACE-Optionen fuer Aenderung von Tabellen BRSPACE options for alter indexes BRSPACE-Optionen fuer Aenderung von Indizes Any menu Beliebiges Menue Complete database recovery main menu Hauptmenue fuer vollstaendige Wiederherstellung der Datenbank Database backups for complete database recovery Datenbanksicherungen fuer vollstaendige Wiederherstellung der Datenbank Database point-in-time recovery main menu Hauptmenue fuer Point-in-Time-Wiederherstellung der Datenbank Options for point-in-time recovery of database Optionen fuer Point-in-Time-Wiederherstellung der Datenbank Database backups / flashback for database point-in-time recovery Datenbanksicherungen / Flashback fuer Point-in-Time-Wiederherstellung der Datenbank Tablespace point-in-time recovery main menu Hauptmenue fuer Point-in-Time-Wiederherstellung der Tablespaces Options for tablespace point-in-time recovery of database Optionen fuer Point-in-Time-Wiederherstellung der Tablespaces von Datenbank Database backups for tablespace point-in-time recovery Datenbanksicherungen fuer Point-in-Time-Wiederherstellung der Tablespaces Whole database reset main menu Hauptmenue fuer Zuruecksetzen der ganzen Datenbank Consistent database backups / restore points for whole database reset Konsistente Datenbanksicherungen / Restore-Points fuer Zuruecksetzen der ganzen Datenbank BRRESTORE main options for restore of database files BRRESTORE-Hauptoptionen fuer Zurueckladen der Datenbankdateien Additional BRRESTORE options for restore of database files Weitere BRRESTORE-Otionen fuer Zurueckladen der Datenbankdateien Archivelog files to apply of database instance Archivelog-Dateien zum Einspielen von Datenbankinstanz Change the source for applying archivelog files of database instance Aenderung der Quelle fuer Einspielen der Archivelog-Dateien von Datenbankinstanz BRRESTORE main options for restore of archivelog files BRRESTORE-Hauptoptionen fuer Zurueckladen der Archivelog-Dateien Additional BRRESTORE options for restore of archivelog files Weitere BRRESTORE-Optionen fuer Zurueckladen der Archivelog-Dateien Applying archivelog files of database instance Einspielen der Archivelog-Dateien von Datenbankinstanz BRRESTORE command line for restore of archivelog group BRRESTORE-Kommandozeile fuer Zurueckladen einer Archivelog-Gruppe Applying archivelog group of database instance Einspielen der Archivelog-Gruppe von Datenbankinstanz Restore of individual backup files main menu Hauptmenue fuer Zurueckladen einzelner Sicherungsdateien BRBACKUP database backups for restore BRBACKUP-Datenbanksicherungen fuer Zurueckladen Backup files for restore Gesicherte Dateien fuer Zurueckladen BRRESTORE main options for restore from BRBACKUP backup BRRESTORE-Hauptoptionen fuer Zurueckladen von BRBACKUP-Sicherung Additional BRRESTORE options for restore from BRBACKUP backup Weitere BRRESTORE-Optionen fuer Zurueckladen von BRBACKUP-Sicherung BRRESTORE options for restore of individual files from BRBACKUP/BRARCHIVE tape BRRESTORE-Optionen fuer Zurueckladen einzelner Dateien von BRBACKUP/BRARCHIVE-Band BRRESTORE options for restore of individual files from BRBACKUP/BRARCHIVE disk backup BRRESTORE-Optionen fuer Zurueckladen einzelner Dateien von BRBACKUP/BRARCHIVE-Plattensicherung BRRESTORE options for restore of individual files from BACKINT backup BRRESTORE-Optionen fuer Zurueckladen einzelner Dateien von BACKINT-Sicherung Incremental database backups for restore and apply Inkrementelle Datenbanksicherungen fuer Zurueckladen und Einspielen BRRESTORE main options for restore and apply of incremental backup BRRESTORE-Haupoptionen fuer Zurueckladen und Einspielen inkrementeller Sicherung Additional BRRESTORE options for restore and apply of incremental backup Weitere BRRESTORE-Optionen fuer Zurueckladen und Einspielen inkrementeller Sicherung Restore and application of archivelog files main menu Hauptmenue fuer Zurueckladen und Einspielen der Archivelog-Dateien Applying archivelog files to database Einspielen der Archivelog-Dateien in Datenbank Options for opening database instance Optionen fuer Oeffnen der Datenbankinstanz Disaster recovery main menu Hauptmenue fuer Katastrophen-Wiederherstellung Device type for restoring profiles and log files from backup To start with disaster recovery, you have to know on which medium the last successful backup was done. In case of tape media, you have to know the correct tape volume, and in case of disk media - the backup directory. Select 'backup utility' for rman_util, 'local disk' - for rman_disk and 'remote disk' - for rman_stage. Device type for restoring control files from backup Geraetetyp fuers Zurueckladen der Profile und Protokolle aus Sicherung Um mit Katastrophen-Wiederherstellung zu beginnen, muessen Sie wissen, auf welches Medium die letzte erfolgreiche Sicherung durchgefuehrt wurde. Im Falle des Band-Mediums muessen Sie das richtige Band wissen, und im Falle des Platten-Mediums - das Sicherungsverzeichnis. Waehlen Sie 'Backup-Utility' fuer rman_util, 'lokale Platte' - fuer rman_disk und 'remote Platte' fuer rman_stage. Geraetetyp fuers Zurueckladen der Steuerdateien aus Sicherung Parameters for restoring profiles and log files from local tape Parameters for restoring control files from local tape Parameter fuers Zurueckladen der Profile und Protokolle von lokalem Band Parameter fuers Zurueckladen der Steuerdateien von lokalem Band Parameters for restoring profiles and log files from remote tape Parameters for restoring control files from remote tape Parameter fuers Zurueckladen der Profile und Protokolle von remote Band Parameter fuers Zurueckladen der Steuerdateien von remote Band Parameters for restoring profiles and log files from local BRBACKUP disk Parameter fuers Zurueckladen der Profile und Protokolle von lokaler BRBACKUP-Platte Parameters for restoring profiles and log files from local BRARCHIVE disk Parameters for restoring control files from local disk Parameter fuers Zurueckladen der Profile und Protokolle von lokaler BRARCHIVE-Platte Parameter fuers Zurueckladen der Steuerdateien von lokaler Platte Parameters for restoring profiles and log files from remote BRBACKUP disk Parameter fuers Zurueckladen der Profile und Protokolle von remote BRBACKUP-Platte Parameters for restoring profiles and log files from remote BRARCHIVE disk Parameters for restoring control files from remote disk Parameter fuers Zurueckladen der Profile und Protokolle von remote BRARCHIVE-Platte Parameter fuers Zurueckladen der Steuerdateien von remote Platte Parameters for restoring profiles and log files from backup utility Parameters for restoring control files from backup utility Parameter fuers Zurueckladen der Profile und Protokolle von Backup-Utility Parameter fuers Zurueckladen der Steuerdateien von Backup-Utility Restore of profiles and log files from backup Zurueckladen der Profile und Protokolle aus Sicherung Restore of BRBACKUP detail logs Zurueckladen der detaillierten Protokolle von BRBACKUP Restore of BRARCHIVE detail logs Zurueckladen der detaillierten Protokolle von BRARCHIVE BRSPACE options for rebuild of indexes of tablespace BRSPACE-Optionen fuer Neuaufbau der Indizes von Tablespace List of indexes with NOLOGGING for rebuild Liste der Indizes mit NOLOGGING fuer Neuaufbau BRSPACE options for rebuild of indexes with NOLOGGINGBRSPACE-Optionen fuer Neuaufbau von Indizes mit NOLOGGINGOptions for flashback of database Optionen fuer Flashback der Datenbank Database instance startup main menu Hauptmenue fuer Starten der Datenbankinstanz List of database instances for startup Liste der Datenbankinstanzen fuer Starten Options for starting up database instance Optionen fuer Starten der Datenbankinstanz Database instance shutdown main menu Hauptmenue fuer Stoppen der Datenbankinstanz List of database instances for shutdown Liste der Datenbankinstanzen fuer Stoppen Options for shutting down database instance Optionen fuer Stoppen der Datenbankinstanz Alter database instance main menu Hauptmenue fuer Aenderung von Datenbankinstanz List of database instances for alter Liste der Datenbankinstanzen fuer Aenderung Options for alter of database instance Optionen fuer Aenderung von Datenbankinstanz Alter database parameter main menu Hauptmenue fuer Aenderung von Datenbankparameter List of database parameters for alter Liste der Datenbankparameter fuer Aenderung Options for alter of database parameter Optionen fuer Aenderung von Datenbankparameter Recreate database main menu Hauptmenue fuer Neuanlegen von Datenbank Main options for recreate of database Hauptoptionen fuer Neuanlegen von Datenbank SYSTEM tablespace options for recreate of database SYSTEM-Tablespace-Optionen fuer Neuanlegen von Datenbank SYSAUX tablespace options for recreate of database SYSAUX-Tablespace-Optionen fuer Neuanlegen von Datenbank Temp and undo tablespace options for recreate of database Temp- und Undo-Tablespace-Optionen fuer Neuanlegen von Datenbank Online redo log options for log group Online-Redo-Log-Optionen fuer Log-Gruppe Show database information main menu Hauptmenue fuer Anzeige der Datenbankinformationen Show database instance information Anzeige der Datenbankinstanz-Informationen Show database space information Anzeige der Datenbankplatz-Informationen Show database segment information Anzeige der Datenbanksegment-Informationen List of database instances Liste der Datenbankinstanzen Information about the status of database instance Informationen ueber den Status der Datenbankinstanz List of database parameters Liste der Datenbankparameter Information about database parameter Informationen ueber den Datenbankparameter List of database tablespaces Liste der Datenbank-Tablespaces Information about tablespace Informationen ueber Tablespace List of database data files Liste der Datenbank-Datendateien Information about data file Informationen ueber Datendatei List of database online redolog files Liste der Datenbank-Online-Redolog-Dateien Information about online redolog file Informationen ueber Online-Redolog-Datei List of database control files Liste der Datenbank-Steuerdateien Information about control file Informationen ueber Steuerdatei List of database disk volumes Liste der Datenbank-Plattendatentraeger Information about disk volume of Informationen ueber Plattendatentraeger von List of database tables Liste der Datenbank-Tabellen Information about table Informationen ueber Tabelle List of database indexes Liste der Datenbank-Indizes Information about index Informationen ueber Index List of table partitions Liste der Tabellen-Partitionen Information about table partition Informationen ueber Tabellen-Partition List of index partitions Liste der Index-Partitionen Information about index partition Informationen ueber Index-Partition List of database segments Liste der Datenbank-Segmente Information about segment Informationen ueber Segment List of segment extents Liste der Segment-Extents Information about extent of segment Informationen ueber Extent von Segment List of free extents Liste der freien Extents Information about free extent in database Informationen ueber freies Extent in Datenbank Tablespace extension main menu Hauptmenue fuer Tablespace-Erweiterung List of tablespaces for extension Liste der Tablespaces fuer Erweiterung Options for extension of tablespace Optionen fuer Erweiterung von Tablespace Tablespace creation main menu Hauptmenue fuer Anlegen von Tablespace Main options for creation of tablespace in database Hauptoptionen fuer Anlegen von Tablespace in Datenbank Space options for creation of tablespace Platz-Optionen fuer Anlegen von Tablespace Space options for creation of index tablespace Platz-Optionen fuer Anlegen von Index-Tablespace Tablespace drop main menu Hauptmenue fuer Loeschen von Tablespace List of tablespaces for dropping Liste der Tablespaces fuer Loeschen Options for dropping of tablespace Optionen fuer Loeschen von Tablespace Alter tablespace main menu Hauptmenue fuer Aenderung von Tablespace List of tablespaces for alter Liste der Tablespaces fuer Aenderung Options for alter of tablespace Optionen fuer Aenderung von Tablespace Alter data file main menu Hauptmenue fuer Aenderung von Datendatei List of data files for alter Liste der Datendateien fuer Aenderung Options for alter of data file Optionen fuer Aenderung von Datendatei Move data file main menu Hauptmenue fuer Verschiebung von Datendatei List of data files for moving Liste der Datendateien fuer Verschiebung Options for moving data file Optionen fuer Verschiebung von Datendatei Table reorganization main menu Hauptmenue fuer Reorganisation von Tabellen List of tables for reorganization Liste der Tabellen fuer Reorganisation Options for reorganization of tables Optionen fuer Reorganisation von Tabellen Rebuild indexes main menu Hauptmenue fuer Neuaufbau von Indizes List of indexes for rebuild Liste der Indizes fuer Neuaufbau Options for rebuild of indexes Optionen fuer Neuaufbau von Indizes Export tables main menu Hauptmenue fuer Export von Tabellen List of tables for export Liste der Tabellen fuer Export Main options for export of tables Hauptoptionen fuer Export von Tabellen Additional options for export of tables Weitere Optionen fuer Export von Tabellen Import tables main menu Hauptmenue fuer Import von Tabellen List of BRSPACE exports for import Liste der BRSPACE-Exports fuer Import Main options for import from dump file Hauptoptionen fuer Import von Dump-Datei Additional options for import from dump file Weitere Optionen fuer Import von Dump-Datei List of BRSPACE export runs Liste der BRSPACE-Export-Laeufe Alter tables main menu Hauptmenue fuer Aenderung von Tabellen List of tables for alter Liste der Tabellen fuer Aenderung Options for alter of tables Optionen fuer Aenderung von Tabellen Alter index main menu Hauptmenue fuer Aenderung von Index List of indexes for alter Liste der Indizes fuer Aenderung Options for alter of indexes Optionen fuer Aenderung von Indizes List of table partitions for reorganization Liste der Tabellen-Partitionen fuer Reorganisation List of index partitions for rebuild Liste der Index-Partitionen fuer Neuaufbau Manage database statistics main menu Hauptmenue fuer Verwaltung von Datenbankstatistiken List of tables for manage statistics action Liste der Tabellen fuer Statistik-Verwaltungsaktion Options for manage statistics of tables Optionen fuer Statistikverwaltung von Tabellen List of statistics versions of table / for action Liste fuer Statistikversionen von Tabelle / fuer Aktion List of statistics exports for action Liste der Statistikexporte fuer Aktion List of tables in statistics export / for action Liste der Tabellen in Statistikexport / fuer Aktion Manage flashback database main menu Hauptmenue fuer Verwaltung von Datenbank-Flashback Options for switching on flashback for database Optionen fuer Einschalten von Flashback fuer Datenbank Status of flashback for database Status von Flashback fuer Datenbank Options for creating a restore point for database Optionen fuer Anlegen von Restore-Point fuer Datenbank List of restore points for action Liste von Restore-Points fuer Aktion Manage online redolog main menu Hauptmenue fuer Verwaltung von Online-Redolog List of online redolog files for action Liste der Online-Redolog-Dateien fuer Aktion Options for managing online redolog for database instance Optionen fuer Verwalten von Online-Redolog fuer Datenbankinstanz Manage data encryption main menu Hauptmenue fuer Verwaltung von Datenverschluesselung Options for managing data encryption of database Optionen fuer Verwalten der Datenverschluesselung von Datenbank List of encrypted tables for action Liste der verschluesselen Tabellen fuer Aktion List of encrypted tables/columns for action Liste der verschluesselen Tabellen/Spalten fuer Aktion Additional data encryption actions Weitere Datenverschluesselungsaktionen Status of data encryption of database Status der Datenverschluesselung von Datenbank Dummy helpDummy-HilfemainOPS$BrCleanupint_func_processfile_info -> disk_infosize_getonly_compressrman_preparefile_comparestdinraw_comparesize_comparesize_checkfile_copyfilecp_callfile_write-wafile_compressfile_uncompressdbv_callprog_detachpipe_executecmd_runasmcmd_execpwd_printcmd_printfile_printnrfile_printoutbra_logbrb_logbrr_logbrv_logbrc_logbrs_logdba_logcheck_logtrace_logback_traceuser_tracenull010203040506070809101112input_duplicatefile_truncatesparse_createfile_chopfile_unchopmanif_createlog_purifyNULLstdoutcut_blanksbrtlog_cleanuporatrc_cleanupbackint_execute.splitint_executeSPLITINT_DIRLOCALfile_convertconv_opt_read///conv_file_getconv_processoption_readglobal_setallofflinetapecpiocopyrcpsavenocompletebrt_main_menuinst_man_menubrs_dbstart_menubrs_dbshut_menubrs_dbalter_menubrs_dbparam_menubrs_dbcreate_menubrs_moredo_menubrs_mdencr_menubrs_dbshow_menuspac_man_menubrs_tsextend_menubrs_tscreate_menubrs_tsdrop_menubrs_tsalter_menubrs_dfalter_menubrs_dfmove_menuseg_man_menubrs_tbreorg_menubrs_idrebuild_menubrs_tbexport_menubrs_tbimport_menubrs_tbalter_menubrs_idalter_menuback_copy_menubrb_back_menubra_arch_menubrb_bdb_menubrr_dbv_menubrr_alv_menubrb_compr_menubrb_prep_menubrb_deld_menubra_deld_menubra_rctl_menubrb_itape_menubra_itape_menurest_recv_menupipediskstageutilbrv_recv_menubrv_disas_menubrs_fback_menucheck_ver_menubrc_check_menubrc_vals_menubrb_dbv_menudb_stats_menubrc_usta_menubrc_csta_menubrc_dsta_menubrs_msta_menubrc_cdst_menubrc_csst_menuprof_logs_menubrb_logs_menubra_logs_menubrr_logs_menubrv_logs_menubrc_logs_menubrs_logs_menubrc_clean_menubrc_next_menubrc_pass_menubrc_syn_menustat_mem_allocateyesNOEDfullincr-sap_dirora_dirsap_dir,ora_dirpartialoffline_forceoffline_standbyoffline_splitoffline_mirroroffline_stoponlineonline_consonline_splitonline_mirroroncons_splitoncons_mirroronline_standbyoffstby_splitoffstby_mirrortape_autotape_boxpipe_autopipe_boxutil_fileutil_file_onlineutil_volutil_vol_onlinerman_utilrman_diskrman_stagedisk_copydisk_standbystage_copystage_standbyincr_onlyincr_fullincr_allnone_dbarchive_logs1-999999999999999fbonfboffrpcreaterpdropfbshowrpshowsave_deletesecond_copysecond_copy_deletedouble_savedouble_save_deletecopy_savecopy_delete_savedelete_saveddelete_copiedstopsuspendresumelastscratchrenameforceshowchecknologsplithardwarebrtoolsonlyuse_dbvuse_rmvonly_conffirst_rmvonly_rmvonly_dbvdisttimedist,timeprocessdetailsummaryprocess,timedetail,timesummary,timeall_partnon_sap[.][.][.][]*[]cascadetableindexcascade_storeindex_storeinfo_cubesall_inddbstatc_taboradict_tabEHEIEXCCHCICXAAHAIAXE=C==E=C+H+IPP0.Rautoskewonlyrepeatdefaultlockeddbstatc_mondbstatc_monaoradict_statssystem_statsmissingharmfulachistallcolalldefallselautoallautocascautogranautoinvbucketschkunbcollectdchistdegreedeletedimcolglobgranhistoryichistindcolkeeplimitlockmethodmonitnocascnochecknocollnoinvalonlyindpchistprecisionredcolsamplespaceunlockexportimportrestoredelexpshowexpshowver[allsel:]K|M|G[/][.]
:K|M|G[/]>[.]:K|M|G[/]>[.][]*[]:K|M|G[/]>specialfreemaxbothfree,nocascmax,nocascboth,nocascswitchlogcheckpointarchlognoarchlogchangeresetcreatecrfmembegbackendbackcoalescecrgroupcrmemberdrgroupdrmemberresizemoveswitchopenclosechpassnewkeyrekeyenabledisabledisplaylistlisttsautoextfixsizedropreorgreopartcleanuplong2loblob2lobheap2iotiot2heaprebuildrebpartexpexpdptablesindexfilesqlfilenomonitparallelshrinkcrsegmdrsegmabapabapshdjavajavashdfailsafeftpnoneBrDbCorrCheckIBBR%04d%s %svoidIBM -c forceI -l IBM -f dbstart -i IBMprofileinstanceIBMconfirmlanguageIBMcommandBRSPACEbrs_dbstart_optuserIBMdbstatedbparamtsinfoIdfinfoItbinfoIidinfoItpinfoIipinfoIsginfoIseinfoIfeinfoIrfinfoIcfinfoIdbowner -o IBM -s IBM -f dbshowI -c IBM -n IBM -p IBM -f IBM -o "" -t "IB -i "IB -tp "I -ip "I -lparameterIBtablespaceIfileIBMownerIBtabpartindpartlogoutputIscrollIbrs_dbshow_optIbrs_dbshow_aoptbrs_dbshow_mopt -f mdencrI -a IBM -t IBMactionIbrs_mdencr_optI -f moredoI -g IBM -m IBMthreadIgroupIBmemberIbrs_moredo_optI -f dbcreateIBMbrs_dbcreate_optIBM -f dbparambrs_dbparam_opt -f dbalterbrs_dbalter_opt -f dbshutIbrs_dbshut_optIBRSPACEnonononoI%dnonononononononononononoIfbstatedestateinst_add_menuIB -f crsynIBBRCONNECTIBbrc_syn_opt -f chpassIsecstoreIBMbrc_pass_optIBM -q checkI nologI -f nextIK -s "IB -e "IBqueryIBbrc_next_aoptIBexcludebrc_next_moptIB -f cleanup -b IBM -r IBM -v IBM -k IBM -e IBM -d IBM -x IBMbrc_clean_aoptIdiskbackIBMdiskarchIBMexpdumptraceIBdblogIBxdblogIcheckmsgIBMbrc_clean_m2optbackupIarchiverecoverconnectbrc_clean_m1opt IB..........%s.%s %s %-10s %-10s %-10s %dIback%s.log I%s.%s %s %-10s %d %6dIstruc%s.log IBMparam%s.log IBMspace%s.log I%s.%s %s %-10s %d %sIBconn%s.log I%s.%s %s %-10s %dIBMrecov%s.log IBM restorersbdatabaseIBMrsaarchivelogIrsffilesIBuctuncatalogIBqur%s.%s %s %-10s %-10s %drest%s.log arch%s.log I -f statsIB -n -hretainIintervalIBMbrc_usta_aoptIBignoreIbrc_usta_moptIB -f stats -t system_stats0noworkloadIbrc_csst_optIBM -f stats -t oradict_statsIbrc_cdst_optIBM -f mstatsIbrs_msta_aoptIBexpidIBbrs_msta_moptIB -f stats -dIBMbrc_dsta_aoptIBbrc_dsta_moptIBbrc_csta_aoptIBbrc_csta_moptIB%c%cIBM%cI?%c%1.0f%c%4.3f,nononononoIBM ImissingnonononoIBM IcollectnoIBM Iharmfulnononononono10noI -f checkIB -d -ibrc_check_aoptIigndbsIbrc_check_moptI -w IBMexecuteBRBACKUPIBMbrb_dbv_aoptIBMtypeIBMverifyImodeIBMbrb_dbv_moptIBM -f limitIBbrc_vals_aoptIBvalidateIBMbrc_vals_moptnonononoIBM IcascadenonononononoIapplynoIparfileBRRECOVERIBbrv_recv_optIBM -f mfbackIpointIBbrs_fback_optIB-t disasterdeviceIbrv_disas_optnononoIdbpitIBtspitIB splitI -wcompressIBMfillupIbrb_back_aoptIBvolumeIbrb_back_moptIB showIBinitializeInumberIBRARCHIVEIBbra_itape_optIBbrb_itape_optIBbra_rctl_optIBM -a -dc -a -dssec_copyIBMbra_deld_optIBM%d/%dIB%d/%d+%dIBM IBMon-diskdeleted%s.%s %s %-10s %12s %-8s %dpartial -db IB -t offline -t onlineIbrb_deld_optIBM -d rman_prepIBbrb_prep_optIBM -k onlyIBMbrb_compr_optIB%s.%s %s %-10s %d 1. %8d %8d %s: %d-%d%s.%s %s %-10s %d 2. %8d %8dnoIBM IbrtoolsnoIbrr_alv_moptIBMlast_seqIBMëfirst_seqIB -a2 IBBRRESTOREIBbrr_alv_aopt%s.%s %s %-10s %12s %-10s %dnoIbrr_dbv_moptIBMbrr_dbv_aoptoffl_forceIoffl_stbyIBoffl_splitIoffl_mirrIBoffl_stopIBonl_consIBMonl_splitIBonl_mirrIBMon_con_splIon_con_mirIonl_stbyIBMof_sby_splIof_sby_mirnoI -bd IB -I -a -f -mfillIBMmodifyIbra_arch_aoptIBbra_arch_moptnononononononononononononononononononononononononononononononononononononoIBM Isap_dirback_copy_mmenuback_copy_amenu -f tbreorgbrs_tbreorg_opt -f idalterbrs_idalter_opt -f tbalterbrs_tbalter_opt -f tbimportIBM -y IBMbrs_tbimport_optIBM -f tbexport -l IBM -u IBMutilitydumpdirbrs_tbexport_optIBM -f idrebuildIBbrs_idrebuild_optnonononononononononononononononononoIseg_add_menuIBM -f tsextendIBMbrs_tsextend_optIBM -f dfmoveIbrs_dfmove_optI -f dfalterbrs_dfalter_opt -f tsalterbrs_tsalter_opt -f tsdropIbrs_tsdrop_optI -f tscreateIBMbrs_tscreate_optnonononononononononononoIdvinfoIspac_add_menu30303030303030303030nonononoI:nononoIbrt_add_menuIBMdummyrsystem/manager//Irman_prepIBdisasterIBM-cI-confirmIBM-fI-fileIB-iI-indirI-lI-logIBM-nI-newIBM-oI-oldIBM-pI-parallelIB-ACPIBM-FETIBM-KRGIBM-KRUIBM-KTFIBM-PMLIBM-PMTIBM-PTSIBM-PTTIBM-RRGIBM-RRUIBM-SRGIBM-SRUIBM-SSEIBM-SSOIBM-STRIBM-TRCIBM-UI-USERIB-f|-fileIBMconvert-o|-oldcommand output from________B?PbM?G%04d-%02d-%02dIfile_selecttransport_tablespace=IBtransport_tablespaces=Itransport_datafiles=IBM-functionIB-hI-helpIB-VI-VERSIONIBM-versionIBMversion %s IBM%s %s IBMALL Patch Date Info %3d %10s %s (note %d) IBM release note %d kernel release %c%c%c Ipatch date %s Ipatch level %d Ipatch level 0 IBmake platform %s Irs6000_64IBmake codeline %s I722_EXT_RELmake mode %s IOCI_112make date %s May 25 2015 General syntax: IB brtools [] [-f|-function []] IBM Main options: [-c|-confirm] I unattended mode - no confirmation required default: attended mode [-f|-function convert] 'convert' function no default [-h|-help [version]] IB help information [about brtools version] IB default: no help information IB [-i|-interval ] I recovery interval I default: 30 IBM [-l|-language E|D] language of messages: E - English,I D - German IBM default: E - English IB [-p|-profile ] IBM profile name IB default: init.sap [-s|-scroll ] IB list scroll line count default: 20 IBM [-u|-user [[/]]|/|//|//] user name/password for database connect IBM default: / [-w|-show ] I show logs period IB [-V|-VERSION [ALL]] IBM patch information [for all tools] I Options for 'convert' function: IB [-c|-continue] unattended run - no confirmation required I default: attended run I -f|-file IB name of file with list of files for conversion IBM [-i|-indir] IBM convert in own directories default: convert to sapreorg IB [-l|-log ] IB write messages to a log file IB default: no log file IB [-n|-new] IB new platform IB default: current platform I -o|-old old platform IB [-p|-parallel ] number of parallel convert processes IB default: 1 -intervalIB-languageedIB-profileIBM-sI-scroll-wI-showIB-uI-userIB-yI-sidIBM-GUIIBM-IRMIBMunkn.IBlinkIBMblockIBBRTOOLS: File status info for %s%s%s File type: %s File size: %12.0f (%9.0f KB / %6.0f MB / %3.0f GB) Allocated size: %12.0f (%9.0f KB / %6.0f MB / %3.0f GB) [%6.2f%%] Last mod. time: %04d-%02d-%02d %02d.%02d.%02d IBM%s %s %sIBM%04d%02d%02d%02d%02d%02dIBM-qITRACEORAIBMalertIBcdumpIBhmIincidentIBMincpkgIirIlckmetadataIBMsweepIB#ORATRC %d #ARCLOG %d -kIDISKBACKIBM#BCKDIR %d -eIEXPDUMP#EXPDIR %d -aI#BRALOG %d -bI#BRBLOG %d #BRCLOG %d -rI#BRRLOG %d -vI#BRVLOG %d #COPDIR %d I#BRSLOG %d #COPDIR %d I%s %sIBBR_TRACE:IBBR0280I' IA@iYbrtools.cIBBRTOOLS: ISIZE %1.0f OSIZE %1.0f RATIO %5.4f:1 CHUNKS %d SKIPPED %d ETIME %02d:%02d:%02d IBchop%dI#UNCHOP %s %1.0fIBMN#CHOP %s %1.0fI%s %s %s %sDE@@Dinit_oraIBMF@It$L Pinit_sapIBMinit_dbaIBMbra_slogIBMarch_slogIBbrb_slogIBMback_slogIBbrr_slogIBMrest_slogIBbrv_slogIBMrecov_slogIbrc_slogIBMconn_slogIBbrs_slogIBMspace_slogIstruc_logIBparam_logIBalert_log00000000000000Sun IBMMon IBMTue IBMWed IBMThu IBMFri IBMSat IBMJan IBMFeb IBMMar IBMApr IBMMay IBMJun IBMJul IBMAug IBMSep IBMOct IBMNov IBMDec IBM#LINE %d IB#CONT %s IB#CONT I %06d %sIBM%07d %s-NI-CIUSRPWDIspInlIexIatIhaIdoIpeIcaIamIstIpoIpcImiIulIeqIplIbsIpiIacItiIroIboIrcIbcIscIclIqoIdqIcmIltIprIgtIslIqeIcrInpIhtIvtIbpIbeI!@#$%^&*()_=+\|`~[{]};:'<>? IBpipeout%c%c%cIgensapmanifestI -d "-spatch number=IBM" -sdb=ora "-sBR*Tools version=" "-sBR*Tools patch level=I" "-sOracle version=10" IBM dbatoolsora DBATOOLSORAIBM-tIoption_namesIBMresyncIoption_value_of(-f)option_value_of(-t)BR_SPLITINT_DIRSAPDATA_HOMEIBMORACLE_HOMEBR_SPLITINT_HOSTIBMSPLITINT_HOSTIBHOSTBR_SPLITINT_USERIBMSPLITINT_USERIBUSERBR_PDBI#ERRORIsapdataSAPDATAsaptempSAPTEMPsaprawISAPRAWIoriglogORIGLOGmirrlogMIRRLOG%12.0f%cIBM#BEGIN SPLIT %sF?񙙙Percentage done: %1.2f%%IBMFiles done: %1.0f/%1.0f#END SPLIT %sIB#SUCCESSIBMinquiremountIBdismountIBMfile_onlinevolume_onlineIBBR_BACKINT_DIRIBACKINT_DIRSAPBACKUPIB#ERROR %sIB#BACKUP %s %sIB#NOTFOUND %sIBM#MOUNTED %s %s %sIB#DISMOUNTED %s %s %sIBM#BEGIN %s I#SUCCESS IB#ERROR #SAVED %s %sIBM#RESTORED %s %s#DONE %1.2f#END %s IBM#NULLIBback_idcrtfileargfileraw_offsetIBRTOOLS: SIZE %1.0f IBMrawraw_stdinIBDzBRTOOLS: Disk status info for %s Total space: %12.0f (%9.0f KB / %6.0f MB / %3.0f GB) Used space: %12.0f (%9.0f KB / %6.0f MB / %3.0f GB) [%6.2f%%] Free space: %12.0f (%9.0f KB / %6.0f MB / %3.0f GB) [%6.2f%%] Usable space: %12.0f (%9.0f KB / %6.0f MB / %3.0f GB) [%6.2f%%] All free space: %12.0f (%9.0f KB / %6.0f MB / %3.0f GB) [%6.2f%%] Block size: %12d IBMcomparecomprawcompfileIBMcompsizeIBMcopyfileIBMcopydirbackintsplitintIBMextfileduplinIchecksizeIBntfilterIBMexitIBMcalldbvdetachIdetachwpipeinIruncmdIdirdirbinIdirsIBMdirsbinfileinfoIBMfilestatIBMfileowndiskinfoIBMdiskstatIBMdiskspaceIBtouchIBtruncateIBMsparseIprintargIBMwriteargIBMprintpwdIBMprintcmdIBMsendsigsleepIBtsloopIgetsizegetcomprIBMrmanprepIBMcompronlyIBprintoraIBMprintoutIBMchopIBMunchopImkdirIBrmdirIBdectsIBenctsIBliccsIBprintmenuIBprintmsgIBMmtrewIBmtoffIBmteofIBmtfsfIBmtbsbIBmtgtpIBmtstpIBmtctpIBmtertIBmteodIBmtcfoIBmtcfiIBmtcfsIBmtcloIBmtcliIBmtclsIBmtcsoIBmtcsiIBcomprIBuncomprcrmanifpurelogpurifyIcutblanksIBcleanbrtIBMcleanoraIBMprintnrasmcmdImtbsfIB-f backintI-f splitintsetsecIERRORIB%04d-%02d-%02d %02d.%02d.%02dIBIBMx%s.xxx%02dIBMMENU %dUnixIBM/dev/mt/dev/st/dev/nmtIBM/dev/nstIBM\\.\tapeIBM\\.\TapeIBM\\.\TAPEIBM-USOIBMBRTOOLS-FI-FUNCTIONIB-trcIBM-TrcIBMt%sfunc_callORA-PKI-BrSigHandleBrConfEnterBrContBackEnterBrYesNoEnterBrExitConfirmBrMenuProcessBrListProcessBrStrValEnterBrIntValEnterBrToolCallBrFileDisplayBrDistPrintBrDurPrintBrSetPrintBrDbfPrintNULLFILERAWQIOASMNOLINKBrDbfDumpFALSETRUEBrDiskInsertBrRawOffsGetBrWallPassChangeBrWallEnableBrWallDisplayBrbRunGetBrbLogReadBR%04d%s#0online_consoncons_splitoncons_mirrortapeyesbrtoolsuse_dbvuse_rmvcompress/-k yescompress/-k brtoolscpiocpio_gnudddd_gnurmanrman_ddnoutil_vol_accessBrbSlogCleanupBraRunGetBraSlogReadstart_timeBraSlogCleanupBrrRunGetBrvRunGetBrcRunGetBrsRunGetBrLinkSizeGetBrOldNameGetoldfile=BrBackDirGetBrExpDirGetBrAsmAliasCheckBrArchCleanupBrInitSapReadBrInstProcessOPS$BrInitOraReadBrSpfileGetBrParamGettoken_getIB%04d-%02d-%02d %02d.%02d.%02d (%02d:%02d:%02d)I%04d-%02d-%02d %02d.%02d.%02d.%06d (%02d:%02d:%02d:%06d)IBM#ERRO %s %s#ERRO %sIBM#WARN %s %s#WARN %sIBM#INFO %s %s#INFO %sIBM%s %sIB(00:00:00.000000)IB(00:00:00)IBM I(00:00:0BR%04d%s %s%04d-%02d-%02d %02d.%02d.%02dIB%d:%02dc[ont]Is[top]IcIBcontIsstopIynIB-fIrIBPID=IBM#SIGNAL CAUGHTI^CI#INBACKUP I#SIGNAL SENTIBM#SIGNAL CAUGHT: %dIvoidIBMnameI=(ifile) IB ...IBMremote_userspfileIlog_archive_dest_%dlog_archive_dest_1Ilog_archive_dest_2Idb_namedb_unique_nameIdb_block_sizeIBinstance_numberthreadIcontrol_filesIBlog_archive_destIBMlog_archive_duplex_destcheckIBlog_archive_formatIdiagnostic_destbackground_dump_destIBMuser_dump_destIcore_dump_destIaudit_file_destcontrol_file_record_keep_timeIBos_authent_prefixIBundo_managementundo_tablespaceremote_login_passwordfileIBcompatibleIdb_recovery_file_destIBdb_recovery_file_dest_sizeIDdb_flashback_retention_targetIBaudit_sys_operationsIBMstandby_file_managementAUTOIBMo7_dictionary_accessibilitylocation=IBM IBlog_archive_destinstIBMIBMdisasterIBM_file_distIbackup_moderestore_modeIBMbackup_typebackup_dev_typebackup_root_dirstage_root_dirIcompressIBMcompress_cmdIBMuncompress_cmdIcompress_dirIBMverify_dirIarchive_copy_dirIBMarchive_stage_dirIBnew_db_homenew_database_homeIBnew_sapdata_homeIBMstage_db_homeIBstage_database_homestage_sapdata_homeIorig_db_homeIBMorig_database_homeIorig_data_homeIorig_sapdata_homeIBarchive_functionIBMarchive_dupl_delIBMarchive_duplex_delItape_copy_cmdIBdisk_copy_cmdIBstage_copy_cmdIpipe_copy_cmdIBremote_hostcpio_flagsIcpio_out_flagsIcpio_in_flagsIBcpio_disk_flagsdd_flagsIBMdd_out_flagsIBMdd_in_flagssaveset_membersrman_block_sizerman_channelsIBrman_filespersetIBMrman_maxopenfilesIBrman_maxsetsizerman_setsizeIkKmMgGIBrman_maxpiecesizeIBrman_kbytesrman_sectionsizeIBMrman_maxsectionsizerman_rateIBrman_readrateIBrman_diskratioIrman_durationIBrman_keepIBrman_poolIBrman_copiesrman_duplexrman_proxyIrman_parmsIrman_sendIBrman_compressIBrman_maxcorruptrman_cross_checkIBMrman_rac_distIBread_fifo_cmdIBcopy_out_cmdIBMcopy_in_cmdrewindIrewind_cmdIrewind_offlineIrewind_offline_cmdItape_pos_cmdIBMvolume_pos_cmdImount_cmdIBdismount_cmdIBMsplit_cmdIBresync_cmdIsplit_optionsIBsplit_resyncIBMpre_split_cmdIBpost_split_cmdIpre_shut_cmdIBMpost_shut_cmdIBpre_arch_cmdIBMpre_archive_cmdpost_arch_cmdIBpost_archive_cmdIBMpre_back_cmdIBMpre_backup_cmdIpost_back_cmdIBpost_backup_cmdinit_arch_cmdIBinit_archive_cmdIBMcont_arch_cmdIBcont_archive_cmdIBMterm_arch_cmdIBterm_archive_cmdIBMinit_back_cmdIBinit_backup_cmdcont_back_cmdIBcont_backup_cmdterm_back_cmdIBterm_backup_cmdtape_block_sizetape_set_offlineIBMtape_sizeIBvolume_sizetape_size_archIvolume_size_archIBMexec_parallelIBtape_addressIBMdevice_addressItape_address_rewIBMdevice_address_rewItape_address_ctlIBMdevice_address_ctlItape_address_archIBdevice_address_archtape_address_rew_archIBdevice_address_rew_archtape_address_ctl_archIBdevice_address_ctl_archvolume_archiveIvolume_backupIBexpir_periodIBMexpiration_periodIBretention_periodIBMlock_periodtape_use_countItape_use_cntIBMvolume_use_countIBMvolume_use_cntIutil_par_fileIButil_parfileIBMutil_vol_par_fileIButil_vol_parfileIBMutil_optionsIBMutil_vol_optionsIBMutil_pathIButil_vol_pathIButil_vol_unitIButil_vol_nlistImount_par_fileImount_parfileIBparallel_instancesIparallel_instanceIBloc_ora_homesIBlocal_oracle_homesIdb_servicesdatabase_servicesIBprimary_dbIprimary_databaseIBMstandby_dbIstandby_databaseIBMjournal_dbIjournal_databaseIBMcheck_condIcheck_conditionsIBMcheck_ownercheck_excludeIBcleanup_ownerIBcleanup_brarchive_logIBcleanup_brbackup_logIBMcleanup_brconnect_logIBcleanup_brrestore_logIBcleanup_brrecover_logIBcleanup_brspace_logcleanup_sapdba_logIcleanup_disk_archiveIBMcleanup_disk_backupcleanup_exp_dumpIBMcleanup_ora_traceIBcleanup_db_logIcleanup_xdb_logcleanup_check_msgIBcleanup_ora_dircleanup_ora_sdirIBMnext_ownerInext_tableInext_tablesnext_excludeIBMnext_specialIBMnext_specIBnext_max_sizeIBnext_limit_countIBMnext_limit_cntInext_limitIstats_ownerstats_tablestats_tablesIBMstats_specialIBstats_specIstats_excludeIBstats_methodIBMstats_sample_sizeIBstats_sampleIBMstats_bucket_countIstats_bucket_cntIBMstats_bucketIBMstats_change_thresholdIstats_changeIBMstats_parallel_degreeIBstats_parallelIstats_limit_timeIBMstats_limitstats_dbms_statsIBMstats_info_cubesIBMstats_dict_cycleIBMstats_dictionary_cycleIstats_dict_methodIBstats_dictionary_methodstats_dict_sampleIBstats_dictionary_sampleBstats_dict_degreeIBstats_dictionary_degreeautoIBMdefaultnullIBMstats_system_cycleIstats_system_intervalIBstats_intervalIvalid_excludeIBrecov_typeIrecovery_typeIBcompleteIBMresetIBdbpitIBtspitIBrestoreapplyIBrecov_copy_dirIrecovery_copy_dirIBrecov_intervalIrecovery_intervalIBrecov_degreeIBMrecovery_degreescroll_linesIBMshow_periodspace_copy_dirIexp_dump_dirIBMreorg_tablereorg_tablesIBMreorg_tabpartIBreorg_tabpartsIreorg_table_partitionIBreorg_table_partitionsIrebuild_indexIBrebuild_indexesrebuild_indpartrebuild_indpartsIBMrebuild_index_partitionrebuild_index_partitionsIBMexp_tableIBexp_tablesIimp_tableIBimp_tablesIasm_sidasm_ora_sidasm_oracle_sidIasm_homeIBMasm_ora_homeIBMasm_oracle_homeasm_root_dirIBMasm_root_nameIBasm_db_nameasm_nameIBM_alert_msg_cntI_alert_message_countIBM_allow_long_namesIB_allow_long_nameIBM_allow_recov_statIB_allow_recover_statusIB_amr_ownerI_amr_db_ownerIB_mgd_ownerI_mgd_db_ownerIB_arb_ownerI_arb_db_ownerIB_ariba_ownerIBM_ariba_db_owner_arch_ahead_cnt_archive_ahead_countIBM_arch_apply_cnt_archive_apply_countIBM_arch_apply_dir_archive_apply_dirI_arch_grp_cntIB_arch_group_cnt_archive_group_countIBM_arch_miss_warn_archive_missing_warningIBM_arch_run_intvI_archive_run_intervalIB_arch_sec_copyI_archive_second_copyIBM_arch_stat_wait_archive_status_waitIBM_archive_status_wait_timeIB_auto_ind_stats_auto_index_statsIB_back_ctlf_cycleIBM_backup_ctlf_cycleI_backup_controlfile_cycleIB_backint_userIB_backint_user_nameI_check_act_curs_check_active_cursorsIB_check_col_statsIBM_check_column_stats_check_file_statIBM_check_file_statusI_check_file_sizeIBM_ckmsg_retn_timeIBM_check_msg_retention_timeIB_clean_bra_slog_cleanup_bra_slogIB_cleanup_brarchive_sumlogIB_clean_brb_slog_cleanup_brb_slogIB_cleanup_brbackup_sumlogIBM_col_stats_thld_column_stats_threshold_compr_buffer_sizeI_compress_buffer_sizeIB_compr_chunk_sizeIB_compress_chunk_sizeIBM_compr_rate_expirIB_compress_rate_expirationIB_compr_levelIBM_compress_level_conn_as_dbaIBM_conn_as_sysdba_connect_as_sysdbaI_conn_sleep_intvIBM_conn_sleep_intervalIBM_copy_sum_logIB_copy_summary_logIB_cpio_max_sizeI_cpio_maximum_sizeI_crctl_repl_str_crctl_replace_stringsI_crddl_sess_stmtIBM_crddl_session_stmt_crt_ctlf_waitI_create_controlfile_waitIBM_create_old_lobsIBM_crt_old_lobsIB_create_sparse_filesIBM_crt_spa_filesI_ctl_auto_backupIBM_ctl_auto_backI_control_file_auto_backupIB_ctl_keep_timeI_control_keep_timeI_curr_run_warnI_currently_running_warningI_curs_chk_rowsI_cursor_check_rowsI_db_hostIBM_database_hostI_db_userIBM_database_userI_db_wait_timeIB_del_wait_timeI_dba_sess_stmtI_dba_session_stmtIB_ddl_buf_lenIBM_ddl_buffer_sizeIBM_deall_unused_space_deallocate_unused_spaceIBM_diff_grid_user_different_grid_userIBM_disable_consIB_disable_contraints_dont_check_cursIBM_dont_check_cursors_dont_check_passIBM_dont_check_db_pwdI_dont_check_database_passwordIB_dont_exp_stats_dont_export_statsI_dont_export_statistics_dont_imp_stats_dont_import_statsI_dont_import_statistics_dont_purge_tab_dont_purge_tableIB_dont_retn_time_dont_retain_timeIB_dont_sort_segm_dont_sort_segments_dont_save_walletIB_dont_backup_wallet_dont_start_dbI_dont_startup_databaseI_dont_val_consI_dont_validate_constraintsI_delay_ora_thrI_delay_oracle_threadsIB_delay_prog_execIBM_delay_program_executionIBM_drop_unused_colIBM_drop_unused_columnsIBM_dum_loc_splitI_dummmy_local_split_exp_excl_tabIB_exp_excl_tabsI_exp_exclude_tableI_exp_exclude_tables_exp_query_stmt_export_query_stmtI_ext_tsp_checkI_extended_tsp_check_fields_in_quotesIB_fields_in_double_quotesIBM_file_buffer_sizeIB_file_buf_sizeI_file_distributionI*IB_file_maskI_file_create_maskIB_file_creation_mask%iI_first_arch_destIBM_first_archive_destinationI_force_check_pointI_force_log_switchIB_force_redolog_switchIB_force_par_dmlI_force_parallel_dml_force_tape_dismountIBM_force_tape_dismIBM_format_time_stampI_rman_format_timeIB_format_timeIBM_ftp_msg_listIB_ftp_message_listIB_full_end_timeI_full_end_timestamp_fzy_ownerI_fuzzy_ownerIBM_fzy_db_ownerIB_fuzzy_db_owner_get_space_info_get_space_informationI_gks_ownerI_gks_db_ownerIB_glob_ind_stats_global_index_statisticsIBM_gnu_toolsI_gnu_tape_tools_hist_all_colIB_hist_all_columnsIB_hist_col_cntIB_hist_column_countI_hist_ind_colIB_hist_index_columns_hist_prt_colIB_hist_partition_columns_ind_crt_timeIB_index_create_timeI_index_creation_timeIBM_idm_ownerI_idc_ownerI_idm_db_ownerIB_identity_db_ownerI_ing_ownerI_ingeneo_ownerI_ingeneo_db_ownerIB_ign_ddl_actIBM_ignore_ddl_actionI_ignore_ddl_actions_ign_inst_errIB_ignore_instance_errorI_ignore_instance_errors_ign_temp_tspIB_ignore_temp_tspIBM_ign_spfile_paramIB_ignore_spfile_parameterIBM_ind_compr_proc_own_index_compr_proc_owner_index_compression_procedure_ownerI_init_ora_waitI_int_inf_servIB_internet_information_servicesI_int_wait_timeI_interrupt_wait_timeIBM_ipc_ownerI_ipc_db_ownerIB_ixs_ownerI_ixos_owner_ixos_db_ownerI_keep_data_filesIBM_keep_sap_oraIB_keep_sparse_filesI_keep_stat_tabI_keep_stats_tableIB_keep_temp_filesIBM_keep_temporary_filesIB_keep_unuse_ind_keep_unusable_indI_leaf_blocks_thldIB_leaf_blocks_thresholdI_lic_expir_periodIB_lic_expiration_periodI_lob_cache_offI_lob_caching_offIBM_lob_cache_onIB_lob_caching_on_loc_redef_pack_local_redefinition_package_loc_stat_tabIB_local_stattab_tableIBM_loc_trace_dest_loc_ora_trace_dest_local_trace_destinationIBM_local_oracle_trace_destination_log_switch_sleepIB_redolog_switch_sleepIB_log_switch_waitIBM_redolog_switch_waitIBM_long_dur_thldI_long_dur_threshold_long_lob_stats_long_lob_statisticsIBM_max_arch_instI_max_archive_instanceIB_max_arch_procI_max_archive_processIBM_max_col_cntIBM_max_column_countIB_max_err_cntIBM_max_error_countIBM_max_sql_lenIBM_max_sql_sizeIB_max_thr_cntIBM_max_thread_countIB_max_wait_timeI_maximum_wait_timeI_mdm_ownerI_mdm_db_ownerIB_min_arch_cntIB_min_archive_countI_min_cleanup_retnIB_min_cleanup_retentionI_min_ver_spaceI_min_verify_spaceIB_move_sess_stmt_move_session_stmtI_nks_ownerI_nakisa_ownerIB_nakisa_db_ownerIBM_next_loc_tspIB_next_loc_man_tspIB_new_dict_tspIB_new_dict_man_tspIB_no_auto_backup_no_auto_backIB_no_check_logicalIB_no_check_logIB_no_check_sumIB_no_dur_opt_no_duration_optimazationIB_no_ext_ver_no_extended_verify_no_file_delIBM_no_file_delete_no_inst_checkI_no_instance_checkI_no_lab_checkIB_no_label_check_no_new_pfileIB_no_new_profile_no_obj_infoIBM_no_object_info_no_read_onlyIB_no_read_only_transactionIB_no_reset_bufIB_no_reset_bufferIBM_no_space_check_no_disk_space_checkIBM_no_start_onlIB_no_startup_onlineI_no_stats_tempI_no_stats_temp_tablesIB_no_tab_lockIBM_no_table_lockI_no_temp_tspIBM_no_temp_tablespace_no_tsp_coalIBM_no_tsp_coalesceIBM_no_tablespace_coalesce_no_work_infoIB_no_work_info_msgIB_no_work_info_messageIB_non_sap_userIB_non_sap_db_userIBM_non_sap_database_userI_not_exists_infoIBM_not_exist_info_not_exi_infoIB_obc_ownerI_oblicore_owner_oblicore_db_ownerI_old_exp_impIBM_old_export_importI_aux_root_dirIB_aux_root_nameI_aux_db_nameIBM_aux_nameIB_new_root_dirIB_new_root_nameI_new_db_nameIBM_new_nameIB_old_root_dirIB_old_root_nameI_old_db_nameIBM_old_nameIB_omit_ctl_split_omit_control_file_splitIBM_omit_redo_splitIBM_omit_redolog_file_splitIBM_omit_tab_upgrI_omit_table_upgrade_omit_temp_splitIBM_omit_temp_file_splitIB_one_save_cycle_one_archive_cycleI_only_expired_undoI_only_expir_undoIBM_only_uncompr_indIB_only_uncom_ind_only_uncompressed_indI_online_bctf_splitI_onl_bctf_split_outside_sapdataIBM_outside_of_sapdata_outside_sapraw_outside_of_saprawI_pass_raw_offsetIBM_pass_raw_offsI_sbx_ownerI_sbx_db_ownerIB_sabrix_ownerIB_sabrix_db_ownerIBM_plus_sess_stmt_plus_session_stmtI_sqlplus_session_stmtIB_pmm_ownerI_pmm_db_ownerIB_vdv_ownerI_vdv_db_ownerIB_proc_last_arch_process_last_archivelogIBM_proc_pool_clus_process_pool_clusterIB_purge_recycle_binI_purge_rec_binI_purge_reorg_tabIBM_purge_reorg_tableI_quick_tab_cntI_quick_table_countI_rcp_msg_listIB_rcp_message_listIB_read_only_standbyI_read_only_standby_dbIB_read_only_standby_database_real_undo_usageIBM_real_undo_usage_in_9iI_rebuild_excl_indIB_rebuild_excl_indsI_rebuild_exclude_indexI_rebuild_exclude_indexesIBM_rebuild_excl_partI_rebuild_excl_parts_rebuild_exclude_partitionI_rebuild_exclude_partitions_red_col_statsI_reduce_column_statsIBM_red_par_execIB_reduce_parallel_execIB_reduce_parallel_executionI_remap_disk_grpsIBM_remap_disk_groupsI_remap_asm_disk_groupsI_remote_copyIBM_remote_copy_cmdIBM_remote_copy_commandIBMrcpscpwcpftp_remote_execIBM_remote_exec_cmdIBM_remote_exec_commandIBM_remote_cmd_remote_commandrshssh_remote_dbI_remote_databaseIBM_rem_sql_callIB_remote_sqlplus_callIBM_rem_rman_callI_remote_rman_callIB_rem_dba_callIB_remote_dbacmd_call_reorg_col_mapI_reorg_column_mappingIB_reorg_excl_tab_reorg_excl_tabsIBM_reorg_exclude_tableIBM_reorg_exclude_tablesIB_reorg_excl_partIBM_reorg_excl_partsIB_reorg_exclude_partitionIBM_reorg_exclude_partitionsIB_reorg_mview_logsIB_reorg_new_colI_reorg_new_columnsI_reorg_sort_col_reorg_sort_columns_reorg_sess_stmtIBM_reorg_session_stmt_resm_wait_time_resume_wait_timeIB_rman_chan_failoIBM_rman_channel_failoverI_rman_check_del_rman_check_deleteI_rman_cross_checkIB_rman_disk_sleepIBM_rman_disk_sleep_timeIB_rman_encr_algI_rman_encryption_algorithmI_rman_grp_cntIB_rman_group_cnt_rman_group_countIB_rman_init_cmdI_rman_init_commandI_rman_run_cmdIB_rman_run_commandIB_rman_sess_stmt_rman_session_stmtI_rman_sleep_timeIBM_rman_sleep_rman_tns_alias_rqs_ownerI_rqs_db_ownerIB_requisite_ownerIBM_rqs_owner1_rqs_db_owner1I_requisite_owner1IB_rqs_owner2_rqs_db_owner2I_requisite_owner2IB_rsh_msg_listIB_rsh_message_listIB_rwc_ownerI_rwc_db_ownerIB_redwood_ownerI_cronacle_owner_rebld_sess_stmtIBM_rebuild_session_stmtIB_save_sys_files_save_system_filesI_sap_ora_trials_sb_hostIBM_standby_hostIB_sbg_ownerI_sbg_db_ownerIB_sbo_ownerI_sbo_db_ownerIB_bobj_owner_bobj_db_ownerI_scc_ownerI_scc_db_ownerIB_scp_msg_listIB_scp_message_listIB_sdba_retn_time_sdba_retention_timeIBM_seg_crt_clause_segment_creation_clauseIBM_sel_err_backIB_select_error_backupIBM_sel_only_indIB_select_only_indexesIBM_serial_dba_cmd_ser_dba_cmdIBM_serial_dba_commandsIBM_ses_ownerI_ses_db_ownerIB_eso_ownerI_eso_db_ownerIB_set_init_value_set_initial_valueI_set_par_degree_set_parallel_degreeIBM_set_rem_envIBM_set_remote_env_set_remote_environment_skip_arch_applyIBM_skip_archive_apply_skip_col_stats_skip_column_statsI_skip_db_logIBM_skip_database_logI_skip_drop_tableIBM_skip_delete_tableI_skip_last_arch_skip_last_archiveI_skip_log_copyI_skip_mview_logsIBM_skip_tabart_handIB_skip_tabart_handlingIB_skip_tmax_checkIBM_skip_total_max_checkIB_skip_util_conf_skip_utility_confirmationI_sleep_aft_rsta_sleep_after_restartIBM_sleep_bef_shut_sleep_before_shutdownI_sort_area_size_sort_area_lengthIB_space_save_thldIBM_space_save_thresholdIB_split_ctlf_waitIBM_split_controlfile_wait_split_orig_filesIB_split_original_filesIB_spp_ownerI_spp_db_ownerIB_sqc_ownerI_sqc_db_ownerIB_sql_sess_stmtI_sql_session_stmtIB_ssh_msg_listIB_ssh_message_listIB_stat_tab_nameI_stat_tab_ownIB_stat_tab_owner_stat_tab_tspIB_stats_all_colI_stats_all_columnsI_stats_by_rbldI_stats_by_rebld_stats_by_rebuildIB_stats_ind_colI_stats_index_columnsIBM_stats_retn_timeIBM_stats_retention_timeIB_stats_sess_stmtIBM_stats_session_stmt_stby_rman_back_standby_rman_backupIBM_stop_wait_time_supp_par_ddlIB_supr_par_ddlIB_suppr_par_ddlI_suppress_parallel_ddlI_supp_par_dmlIB_supr_par_dmlIB_suppr_par_dmlI_suppress_parallel_dmlI_supp_par_query_supr_par_query_suppr_par_queryIBM_suppress_parallel_queryIBM_switch_all_dbI_switch_all_databaseIBM_switch_all_tsp_switch_all_tablespaces_switch_check_intvI_switch_check_intervalI_sync_bef_finIB_sync_before_finish_sync_int_tabIB_sync_interim_table_tab_art_checkI_table_class_checkI_temp_free_spaceIBM_temporary_free_spaceIB_term_on_errorI_terminate_on_error_term_wait_time_tfi_ownerI_taxfact_ownerI_taxfact_db_ownerIB_tsp_files_thld_tablepace_files_thresholdI_uc4_ownerI_uc4_db_ownerIB_upd_all_indIBM_update_all_indexes_uscore_lock_symIBM_underscore_lock_symbol_use_archive_destIB_use_archive_destinationIBM_use_archive_destination_number_use_archive_duplIB_use_archive_duplex_use_archive_duplex_numberI_use_back_names_use_backup_namesIB_use_offs_utilI_use_offset_utility_use_pfileI_use_pfile_optI_use_pfile_optionIB_use_rman_catalogIB_use_rman_catIB_use_user_permI_use_user_permissionsIB_use_thr_procIB_use_thread_processingI_user_expir_alarmIB_user_expiration_alarmI_usr_sap_transI_usr_sap_trans_dirI_util_call_delayIBM_util_grp_cntIB_util_group_cnt_util_group_countIB_util_ver_delay_util_verify_delayI_valid_sess_stmtIBM_validate_session_stmtI_vsp_ownerI_visiprise_ownerIBM_visiprise_db_owner_vsp_owner1_visiprise_owner1IB_visiprise_db_owner1IBM_vsp_owner2_visiprise_owner2IB_visiprise_db_owner2IBM_vtx_ownerI_vertex_ownerIB_vertex_db_ownerIBM_wallet_loc_infoIBM_wall_loc_infoI_wallet_location_infoIB_wso_ownerI_wso_db_ownerIB_xip_ownerI_xipay_ownerIBM_xipay_db_ownerexec_parallel_archIrman_channels_archIrman_filesperset_archIBrman_maxopenfiles_archIrman_maxsetsize_archIBMrman_maxpiecesize_archIrman_sectionsize_archIBrman_rate_archIrman_diskratio_archrman_duration_archIrman_keep_archIrman_pool_archIrman_copies_archIBMrman_proxy_archrman_parms_archrman_send_archIrman_compress_archIutil_par_file_archIutil_options_archIButil_path_archIarchive_typeIBMrecov_manageIBMarchive_copy_dir2IBarchive_stage_dir2IECAIBNOISKEWONLYIBMREPEATIEHIEIIEXICHICIICXIAHIAIIAXIE=IC=I=HI=II=XI+HI+IIINPRUIBB_INDBADBOPROFIBMORAARCHIVER_STUCKICRITICAL_SEGMENTIBMCONTROL_FILE_MIRRORCONTROL_FILE_MISSINGIBMCRITICAL_FILEIBCRITICAL_TABLESPACEDATA_FILE_MISMATCHIDATA_FILE_MISSINGIBFILE_OFFLINEIBMFILE_SYSTEM_FULLIBMHARMFUL_STATISTICSIINVALID_FILE_TYPEIBIN_WRONG_TABLESPACEMISSING_INDEXIBMISSING_STATISTICSINOARCHIVELOG_MODEIBPCTINCREASE_NOT_ZEROIBMREDOLOG_FILE_MIRRORREDOLOG_FILE_MISSINGIBMTABLESPACE_FULLTABLESPACE_IN_BACKUPIBMTABLESPACE_OFFLINEITOO_MANY_EXTENTSIBMARCHIVE_TOO_OLDLAST_OPERATION_FAILEDIBBACKUP_TOO_OLDILAST_ARCHIVE_FAILEDLAST_BACKUP_FAILEDILAST_STATS_FAILEDIBOPERATION_TOO_OLDIBSTATS_TOO_OLDYWIB==I<>I><I>IB>=I<IB<=ISHDIBnoneIBMcopyIBMmountIBbothIBMdisk_volIBMsap_dataIBMall_dataIBMall_dbf-1I?archivearch_forceIonlyIBMtspalldbIvIBcpIcopy_gnuIBMcp_gnuIrman_gnuIBMrman_setIBMrman_set_gnuIBMocopyIBrman_dd_gnurman_brtIBMsaveIBMsecond_copydouble_savesave_deletesecond_copy_deleteIdouble_save_deleteIcopy_saveIBcopy_delete_saveIBMdelete_savedIBMdelete_copiedIBuncompressImkszipI-cIhardwareIBMtape_autoIBtape_boxIBMpipeIBMpipe_autoIBpipe_boxIBMdiskIBMdisk_copyIBdisk_standbyIBMstageIBstage_copyIstage_standbyIButil_fileIButil_file_onlineIBMutil_volIBMutil_vol_onlinerman_utilIBrman_diskIBrman_stageIrman_prepIBofflineoffline_forceIBoffline_standbyoffline_splitIBoffline_mirrorIoffline_stopIBMonlineIonline_splitIBMonline_mirrorIBonline_standbyIoffstby_splitIBoffstby_mirrorIa%sretention_timeI%014.0f%c%c%c%c-%c%c-%c%c %c%c.%c%c.%c%c %s %s %s %s %s DISK.....IBDISKSAV..IBBRARCHIVEIB%s #TSP......I#FILEREN..I#FILEMOVE.Inewname=IBM#BRSRUN...I#TSPCRT...I#TSPEXT...I#FILEADD..I#FILESIZE.Irawlink=IBMsize=IBspacIBM%04d-%02d-%02d 00.00.002000-01-01 00.00.00%s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s tbe/dev/nullIB\nulIBMexpdpIBexp_cIBBRSPACE2000-01-01 00.00conn%s %s %s %s %s %s %s %s %s %s %s IBBRCONNECTIBrecv%s %s %s %s %s %s %s %s %s %s IBRRECOVERIBrestIBM %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s IBMrsbALLALL_RWIall_rwIALL_DATAIBMALL_DATA_RWIBM alld_rwFULLIBMfullIBMFULL_RWfull_rwINCRIBMincrIBMPARTIALpartialONLY_ROonly_ropartialNON_DBInon_dbI+IBBRRESTOREIB#ARCHIVE..I#DISK.....I#STAGE....IwIBdbfIBM IBMtape/backint/rmanIB# I##I#APPLIED..ISAVED....IBCOPIED...IBDELETED..IBDISKCOP..IBDISKDEL..IBDELDISK..IBDELCOPY..IBSTAGESAV.IBSTAGECOP.IBSTAGEDEL.IBL PIt$F@.........IBM IB?zG{........IBMbackup_dev_type/-dI#%dDISK->STAGEDISK->TAPE/BACKINT/RMANDISKIBMSTAGEIBTAPE/BACKINT/RMANIB%dI%s: %dI%s:, I,IBarchIBM IBM #* ** %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s IBMsvecpyssvsvdcpdssdcpscdsutil_diskIButil_stageIdsaveIBsave_delIBMcopy_delIBMdsave_delIBcp_del_svIBdsvdel_savedIBdcpdel_copiedItiatape_initIBcmacompr_onlyIquaqueryIBfstfill_stopIB%s %s %s %s IBMoffset output from pipe#FILE.....Idb_name/db_unique_nameIsapdata_homeIBMoracle_homeoracle_sidI< 6.40IBR051IIName IBMParameter IBMTablespace IBMFile IBMDirectory IBMBR_TRACE:IB' I%s - %s Parameter Value %s %lf %d %d %s %s %s %d IBINVALIDSTALEIBDELETEDUNKNOWN%s %s %s %s %lf %d %d %s %s %lf %lf %lf %lf %lf IBMONLINEIOFFLINESYSTEMISYSOFFIRECOVERPSAPSOURCEDPSAPLOADDIBPSAPCLUDIBMPSAPDOCUDIBPSAPPOOLDIBPSAPESIPSAPELI@@READ_ONLYIBCurrent log sequenceIBMSCN:IBMDatabase block sizeThread:ResetId:IBMArchivedestination/IBARCHIVELOGIformatI%s %s %s IBALL,IBMALL_RW,ALL_DATA,IBALL_DATA_RW,IBMFULL,IBFULL_RW,IBMINCR,IBcompress/-kcompress/tapeIBcompress/pipeIBrman/tapeIBrman/pipeIBrman_set/diskIBoracle_infobackup_type/-tI%s %lf %d %d %d %s #NDBF.....I#DIR......I#FULL.....I#INCR.....IBM I'#PFLOG....I#SAVED....I%s %d %s %lf %s IBMfileIBM%s %d %lf I%d %lf %s I%s %lf %d %d %s %s backIBM %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s %s I0IB@cmbdbvrmpddbtibqubofflineoffl_forceIoffl_stbyIBoffl_splitIoffl_mirrIBoffl_stopIBonl_consIBMonl_splitIBonl_mirrIBMon_con_splIon_con_mirIonl_stbyIBMof_sby_splIof_sby_mirIdisk_stbyIBstage_stbyIutl_fil_onIutl_vol_onIonly_dbvIBMdel_backIBMBRBACKUPIBMutil_filutil_volrman_utitape_auttape_boxpipe_autpipe_boxrman_disrman_stadummyIB%s %s wallet display -wallet %sIBMorapki output from pipeEnter wallet password:I%s wallet create -wallet %s IBM-auto_login_localIB-auto_login%s %s I%s wallet change_pwd -wallet %s %s IBMtype: %d, id: %d, ido: %d, rnr: %d, id_set: %d, id_set1: %d, id_set2: %d, id_set3: %d, id_set4: %d, id_set5: %d, id_set6: %d, Istatus: %d, db_inst: %s, db_tsp: %s, thread: %d, disk_vol: %p, disk_id: %d, IBMos_type: %d, size: %1.0f, size_file: %1.0f, size_curr: %1.0f, size_old: %1.0f, size_set: %1.0f, size_set1: %1.0f, size_set2: %1.0f, size_set3: %1.0f, size_set4: %1.0f, size_set5: %1.0f, size_set6: %1.0f, IBMsize_max: %1.0f, size_incr: %1.0f, create_size: %1.0f, create_time: %1.0f, create_scn: %1.0f, redo_scn: %1.0f, redo_time: %1.0f, redo_nscn: %1.0f, recv_scn: %1.0f, recv_time: %1.0f, raw_offs: %1.0f, dest_offs: %1.0f, year: %d; month: %d, day: %d, hour: %d, minute: %d, second: %d, Itemp_file: %s, undo_file: %s, auto_ext: %s, new_dbf: %s, backup: %s, restore: %s, force_rest: %s, rest_poss: %s, recover: %s, verify: %s, create: %s, drop: %s, move: %s, process: %s, file_sel: %s, log_info: %s, sub_dir: %s, no_size: %s, pre_reset: %s, in_back: %s, skip_dbf: %s, dir_entry: %p IBorig_name: %s, sparse_name: %s, new_name: %s, arch_dupl: %s, link_dest: %s, IBMback_dir: %s, back_dest: %s, rest_dir: %s, rest_dir1: %s, rest_dest: %s, rest_dest1: %s, rman_dest: %s, dest_type: %d, set_name: %s, set_tag: %s, set_key: %d, set_key1: %d, set_cnt: %d, set_cnt1: %d, copy_key: %d, piece_key: %d, piece_key2: %d, bra_slog: %s, slog_pos: %ld, slog_del: %d, slog_len: %d, saved: %s, copied: %s, moved %s, verified: %s, restored: %s, recovered: %s, mounted: %s, created: %s, dropped: %s, extended: %s, applied: %s, reported: %s, jreported: %s, processed: %s, redo_seq: %d, redo_beg: %d, redo_end: %d, IBMvol_nr: %d, volume: %s, volume2: %s, file_pos: %d, util_bid: %s, arch_dev: '%c', arch_flags: %x, rman_copy: %s, rman_set: %s, Icompr_real: %s, compr_fs: %s, compr_size: %1.0f, compr_rate: %5.4f, compr_size1: %1.0f, compr_rate1: %1.0f, compr_file: %1.0f, compr_old: %1.0f, compr_set: %1.0f, compr_set1: %1.0f, compr_set2: %1.0f, compr_set3: %1.0f, compr_set4: %1.0f, compr_set5: %1.0f, compr_set6: %1.0f, IBdur_nreal: %s, dur_back: %d, dur_file: %d, dur_set: %d, dur_set1: %d, dur_set2: %d, dur_set3: %d, Idur_set4: %d, dur_set5: %d, dur_set6: %d, time_beg: %ld; time_end: %ld, time_end2: %ld, time_back: %ld asm_file: %s, asm_alias: %s, asm_oname: %s, asm_cname: %s; asm_fnr: %u, asm_incar: %u, asm_redun: '%c', asm_strip: '%c', next_p: %p IBM Tablespace Status File Status Id. Size CreationTime CreationScn Device Type Link IUNKNOWNOFFLINEINVALID#-AVAIL.IBM IRECOVERRECOFFI%-14s %-10s %-50s %-8s %4d %12.0f%c %c%c%c%c-%c%c-%c%c %c%c.%c%c.%c%c %16.0f %11d %-4s %s IB File Status Group Thread Sequence Size FirstTime FirstScn Device Type Link Thread INUSEIBM IBDELETED%-45s %-8s %3d %3d %8d %10.0f %c%c%c%c-%c%c-%c%c %c%c.%c%c.%c%c %16.0f %11d %-4s %-6s %2d File Size ResetTime ResetScn Device Type Link %-45s %10.0f %c%c%c%c-%c%c-%c%c %c%c.%c%c.%c%c %16.0f %11d %-4s %s IBM READ_ONL1IB'all'IB'tsp'IBSaveset Size Rate Compressed Name%5d %12.0f %11.4f:1 %12.0f %sI %sIBPosition Duration Size Speed Compressed Rate NameI [m:s] [MB/h]Ea:%5d %6d:%02d %12.0f %8.0f%s %12.0f %11.4f:1%s %s%5d %6d:%02d %12.0f %8.0f%s %sIB %sIBMTotal: %6d:%02d %12.0f %8.0f%s %12.0f %11.4f:1Total: %6d:%02d %12.0f %8.0f%sIPosition Size Rate Compressed Duration Speed NameI [m:s] [MB/h]IBM%5d %12.0f %sIBM%5d %12.0f%s %11.4f:1%s %12.0f %6d:%02d%s %8.0f%s %sIB%5d %12.0f%s %6d:%02d%s %8.0f%s %s%5d %12.0f%s %11.4f:1%s %12.0f %s%5d %12.0f%s %sIBTotal: %12.0f%s %11.4f:1 %12.0f%s %6d:%02d%s %8.0f%sTotal: %12.0f%s %6d:%02d%s %8.0f%sIBTotal: %12.0f %11.4f:1 %12.0fIBMTotal: %12.0fIecolIBMetabIBMrpntIBMstabIBMsexpIBMmsgchkparcorrIBMfexextseglptlobipttptindtab IBMowncolartservIBMasmfIBMmsg_nrIb[ack]IbIBfile_nameIB%10d:IB//I-U -U-u -u IBM%s %s I#DELFILEIBMsizeIBMuniformA%1.0fIB#NUMVAL %s:%s-%sI|userIBM1-999999999999999IBIBpasswordIBMpassword1IBpassword2IBpass_sysIBMpass_systIB#NUMVAL %s:#STRVAL %s: Pos. Pos.I Pos.IB - hIBheadIBM I%6d - %sIBM%6d = %sIBM%5d - %sIBM%5d = %sIBM%4d - %sIBM%3d - %sIBMlist_menuIBrefrIBMhelpIBM%4d = %sIBM%3d = %sIBM#STRVAL dummy:Iy[es]/c[ont]IBMn[o]IBMy[es]IBn[o]/c[ont]/bin/shcdcpiocpddrmrshsshrcpscpsapftpfscmd.Z.S.BrSigEnableBrSigIgnoreBrThrRegisterBrEnvProcessXXXbrtools -f void+ASM/oracle/GRID/112ASMEXTSHXBrSapDataGetBrBiEnvSetBrNameSet/dev/nullBraParChecknosaveonlytapeutil_filediskstage-sc-scd-cs-cds-dc-ds-acompress/-k only-w only_rmv-ss-ssdcopybrtools-ovB-iuvB-pdu-pdcuobs=16kibs=16kyesftpnoneBrbParCheckALLofflineonlineonly_dbvonly_rmvuse_dbvuse_rmvrmanrman_gnuutil_volsap_dataBraNameSet/BrbNameSetBrcNameSetBrvNameSetBrrNameSetBrsNameSetBrTmpFileSetBrRunIdBuildBrBackDirBuildBrLabDirBuildBrOraDeftGetBrOraReplaceNULLBrArchFormGetBrArchNameGetBrArchExistBrRedoNameGetBrDbfSelectBrHomeReplaceBrOwnDbfCheckBrUsrGrpCheckBrProgExecuteBrProgStartBrProgDetachBrPipeOpenBrPipeCloseBrTapeSetupBrTapeControlBrTapeCopystdinstdoutBrFileOpenBrFileReadBrFileWriteBrFileCloseBrProgWaitBrWaitBrSleepBrPidGetBrPidCheckBrKillBrFileStatGetBrFileOwnGetBrFilePermSetBrDiskStatGetBrDirCreateBrDirDeleteBrDirCopyBrDirListspecfilelinkpipedir BrDirScanBrSapDirGetBrOraDirGetBrProgCheckBrLinkCreateBrLinkGetBrPassEnterBrTimeEncodeBrTimeDecodeBrNameBuildBrNameCompareBrCaseCompareBrCopyBuildBrCopyCheckBrRcCheckBrRewindBuildBrRewindCheckBrDbaCmdBuildBrSsAbPrepareBrSsJvPrepareBrSsBrPrepareBrSparseCreateBrFileDeleteBrFileRenameBrFileTruncateBrOraSigPatchBrZombieKillBrOraSrvCheckBrOraSrvControlBrNtFilterBrBinOpenBrExitBrLogCleanupora_home_getIBMBR%04d%s %sdummyIBM IB  FILE_NULLIB:cdev:vxfs:..I?rbI%1.0f %1.0f%d IBsapreorgI\cntrlIBolddbfnewdata./IsapdatasaptempsaprawIsaplogIoriglogmirrlogsaparchsapbackupIBsapcheckIBMsaptraceIBM%s%s%s%s%s%sIBMinitIBMoraarchIBMlog_IBINCRIBMFULLIBM_ftpIBM::cdev:vxfs:IBMalert_IdbsPSAPIBMSYSTEMISYSAUXI_1Idata1IB%dI%s%s%s%s%s%s%s%s%sIeddexpdatIdmp%UItmplog_g1Im1Im2ISAPDATASAPTEMP%03dIBM_%d%s_%dIB%s%sdata%dIdiagIBMrdbmsIBtraceIBcdumpIBincidentIBMlcksweepIBhmIauditIBadminIBadumpIBbackIBM_BRTIBM%s %sIBretention_timeI%c%sIBMBRRECOVERIBDISKBACKIBMEXPDUMP%s%s%sIBRARCHIVEIBsvecpyssvsvdcpdssdcpscdsdsvdcpcmavraquatiafstaab%04d-%02d-%02d %02d.%02d.%02dIBBRBACKUPIBMafdaffafpafrafsaftafvandanfanpanransantanvffdfffffpffrffsfftffvfndfnffnpfnrfnsfntfnvifdiffifpifrifsiftifvindinfinpinrinsintinvpfdpffpfppfrpfspftpfvpndpnfpnppnrpnspntpnvcmbdbvddbqubrmptibbabBRCONNECTIBchkclnnxtstadstvstoptalyqucrabcrvdpttptdrsrifalfdrvDIRDELIBRRESTOREIBrsarsbrsfuctqurBRSPACEdbrdbadbpdbcdbwtsetsctsdtsadfadfmtbridrtbetbitbaidamstmfbmormdequsspaTRACEORAIBMtrctrmaudstgswpxmllog.xmlcore_IBcdmp_IBincdir_EXPDBAIvoidIBMTRUEIBMFALSEIB%s %1.0fIBM%s -> %sIBM@wbISAPSYSTEMNAME=%sIBM%s%s%s%s%s%s%sIsecurityIBMrsecssfsIBMkeyRSEC_SSFS_DATAPATH=%sIBRSEC_SSFS_DATAPATH=%s%s%s%s%s%s%sIBRSEC_SSFS_KEYPATH=%sIBMRSEC_SSFS_KEYPATH=%s%s%s%s%s%s%sIBMSSFS_IBDAT%s%s%s%s%s%s%s%s%s%s%s%sIBMSAPSYSTEMNAMEIBBR_SLTOOLS_DIRIusrsapSYSglobalIsltoolssharedlibIBlauncher.jarIBM%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sIBMlibtoolsIB%s%s%s%s%s%s%s%s%s%s%s%s%s%sIBMBR_JAVA_HOMEIBM%s%s%s%s%sIbinjavaIBMJAVA_HOMEIBjdkSecStoreIBMpropertiesIJUpgradeIBMpwf-fIprintpwdIBM-UI | -DSAPSYSTEMNAME=IBM-classpathIsap.com~tc~bl~offline_launcher~impl.jarcom.sap.engine.offline.OfflineToolStartcom.sap.inst.secstore.AdjustSecureStoreFS:-sidSourceI-sidTargetI-secIBM-keyIBM-dbUser-useStdinIB-nomaskcheckKeyPhraseIshIrIB -classpass IBM -cp IBRSEC_SSFS_DATAPATHIRSEC_SSFS_KEYPATHIBssfxIBMvlf%s%s%s %s=%s %dIBprintcmdI'startup mountI nomountIBM pfile=;IBalter database mount standby database;Ishutdown immediate;archive log list;IBexit;IBdb_hostsb_host-lI-cI"IBLANG=CIORACLE_SID=ORACLE_HOME=IBM/nologI || IBMechoIBMERR_RC:\$?-CISHELL=InocatalogIB < parfile=IBMofflineresourceonlineresourceI.worldIcluster=IBMoffline=immediateIBdomain=user=IBpwd=IBMconfigIstatusIservice-dIstartIBstopIBM-sI-iI-qISAPDATA_HOME=IBSAPEXE=//IBR_TRACE:IB' I#SUCCIB#INFOIB#WARNIB#ERROIBRewinding tape...IBUnloading tape...IBWriting filemark...Forward spacingfilemark...filemarks...IBMNot a terminalIBR_TAPE_DIRTAPE_DIRIBMBR_NSBT_DIRNSBT_DIRIBMSAPBACKUPIBSAPDATA_HOMEIBMORACLE_HOMETAPE_SUBDIR=IBMmtrewIB && IBMmtstpIBmtoffIBmtfsfIB-AI-BIpipeout 1>&2IBM IBTAPE_SUB%d %d %1.0f IBM: IConnected toIBM220 IBM220-IBMFTP serverIFTP ServerIFTP ServiceFTP-ServerIPure-FTPdIBPureFTPdIBMProFTPDServerI(vsFTPd)IBHYPERtape Backup NodeIB331 IBM331-IBMPassword requiredIBneed passwordIBrequires a PasswordPlease specify the passwordAnonymous access allowedIBM230 IBM230-IBMLast loginILast unsuccessful loginlogged inIBLogin successfulIBM230 Anonymous user logged inIBM125 Data connection already openIBM200 IBM200-IBMType set toTYPE set toTYPE is nowSwitching toIBM227 IBM227-IBMEntering Passive ModeIBPassive mode: Connected to PortPort command successfulPORT command successfulPORT Command successful250 IBM250-IBMCWD command successfulICWD Command successfulINew default directory isIBM150 IBM150-IBMdata connection forConnecting to portIOk to send dataOk to receive dataIkbytes to downloadIOpening data channel for fileIBOpening ASCII mode data connectionIOpening BINARY mode data connectionAccepted data connectionIBMlocal:Iremote:221 IBM221-IBMGoodbyeGood-byeIBMLogoutI220 IBM221 IBM226 IBM226-IBM226 IBM230 IBMImpromptu CCC initialization bySee SAP note 1266393IBMinifilename =IBopen SuccessIBMopen FailedInputLine =Argument =IVariant =IBPassive = bytes received inIBbytes sent inIBTransfer completeIBFile receive OKFile send OKIBMFile successfully transferredIBdet_logread file :error :init_oraIBMspace_logIBsum_logcopying IBM -> IBMcpio: File size ofIhas increased byIBM1 error(s)Ican't truncate /dev/null: Invalid argumentIcpio: FileIwas modified while being copiedbytesIBcopiedIsecondsB/s0+0 records blocks IBM Blocks IBM blocks IB block Block block IBMcpio: I" ? IBM error(s) I records in IBM records in. IB records out IB records out. I?BRTOOLS: FILEIBBRTOOLS: DIRIBMBYTESIBBLOCKSIDEVICEI?񙙙Using tape drive with immediate report mode enabledWarning: just archiving fileIBMUser opened fileIBMto continueReached end of medium on outputcpio: Ready for volumeIcpio: Type "go" when ready to proceed (or "quit" to abort)Icpio: End of tape. Load next tapeIEnd of medium on outputEnd of medium on "output"IBIf you want to go on, type device/file name when readyITo continue, type device/file name when readyIBReached end of medium on inputICan't read inputIBMEnd of medium on inputIEnd of medium on "input"IBMwrite failed: Permission deniedBRTOOLS: SIZE IDBV-00200IBDBV-00201IBFound block already marked corruptedIBMDBV-IBMTotal Pages ExaminedIBMis marked corruptIBmost likely media corruptIBCorrupt block relative dba:ERROR:ITotal Pages FailingTotal Pages Marked CorruptITotal Pages InfluxI#TRACE #LOCK I#TAPE I#FTP IB#CMD IB#CMDIBMBRSBTLIB: STARTBRSBTLIB: SIZEI SAVESET IB257 IBM257-IBMMKD command successfulIMKD Command successfulIdirectory createdIBDirectory created successfullyIDirectory successfully createdIThe directory was successfully createdI" createdIBRMD command successfulIRMD Command successfulIRemove directory operation successfulIBDirectoryIBdirectoryIBdeletedremovedThe directory was successfully removedI"deletedIBM"removedIBMDELE command successfulDELE Command successfulDEL command successfulIDEL Command successfulIDeleted IBM deletedIBMdirsIBMdetachI@IB-vI-nI-uIputasmcmdI--privilegesysdbaI-pIdeleteI-rI%1.0fIB-bIif=bs=count=Iskip=%1.0fIseek=%1.0fIof=sleep0( I1IB > 2>&1IB )IcompsizeIBMchecksize-comprawcomparecompfileIBMbs=0IBMibs=IBMmtcfoIBprintargIBMmtcloIBobs=IBMmtcfiIBmtcsiIBmtcfsIB++Iset; IpipeinIcompronlyIBrawgetcomprIBMget./Icalldbvfile=IBblocksize=Istart=1end=IBMrmanprepIBM%sIibs=8kIobs=%dkibs=%dkobs=8kImkdirIBrmdirIBdelownerIBwalletIwallnewpumpIBMpasswordIBMoraarch%s%s%s%s%s%s%s%s%s%sIBMprofile%s%s%s%sIBMsapmntItransIB%-50s %11d %-4s %12.0f %s IBMCAy7iYD:?D%1.0f %1.0f %1.0f %1.0fـ%d %dIB%d:%dIBBR_TAPE_SUBDIRITAPE_SUBDIRmtcsoIBBRTOOLS: FILE %s BYTES %1.0f BLOCKS %u DEVICE %sIBMBRTOOLS: DIR %s BYTES %1.0f BLOCKS %u DEVICE %smtcliIBmtclsIBtape_writeItape_readIB%d %sIBBrTapeClosetape_closeI%d %d %dIBMBrTapeReadIBrTapeWriteBrTapeOpenItape_openIBBrPipeDeleteIBMpipe_deleteBrPipeReadIpipe_readIBBrPipeWritepipe_writeITRUE %dFALSE %dIBMBrPipeCreateIBMpipe_createcommand lineIw( I 2> ( ( I-m [all|full,]=,... 00IOMFCFP%s=%sIB0%d%s %d %dIBM%s%slog_g%dm%d.dbfI%s%slog_g%d%dm%d.dbfIBM%s%sredo%02dm%d.dbfUSE_DB_RECOVERY_FILE_DESTIBARCHIVELOGI987656789IB%04dIBM%010dIB%010.0f%d%dI%s%s%s%s%s%s%s%sIBM%%d_%%d_%%1.0f%sdbf%t_%s_%r.dbfIBM%t_%s_%r%s%s%s%dIBMbrlabIB%s%s%s%s%s%03dIoracleIsapproflock_IBbrsstop_IBsusp_IBresm_IBterm_IBddlsqlparfileexpimp/devIBMindfiledbcrtIBddbldIBtspexpIpartspimpIglbexpIglbimpIglbobjItempIBMundoIBMpostdbcrIBMewalletmem$ORACLE_SID$ORACLE_HOMEIBM$SAPDATA_HOMEIB$SAPPROFIBM$SAPARCHIBM$SAPBACKUPI$SAPREORGIB$SAPCHECKIB$SAPTRACEIB$SAPEXE2IBindrbldlstspfileIutl/dev/rmt/0mnIBM/dev/rmt/0mmt -f $ rewindImt -f $ fsf $IBdd ibs=64k obs=8k if=$I/dev/rmt0.1/dev/rmt0IBtctl -f $ rewindIBMtctl -f $ fsf $-iuvC128IBMredoIBMcontroliptrbldbrcBR_PDB=%sIBbradir1bradir2compressIBMUnixIBMonline_consoncons_splitIBMoncons_mirrorIBbackup_type/-tI-f|-fillupIrman_prepIBoffline_standbyonline_splitIBMoffline_splitIBoffline_mirrorIoffline_stopIBMonline_mirrorIBonline_standbyIoffstby_splitIBoffstby_mirrorIbackup_typebrrestoreIBhardwareIBMtape_autoIBtape_boxIBMpipe_autoIBpipe_boxIBMdisk_copyIBdisk_standbyIBMstage_copyIstage_standbyIBcompress/-kbackup_dev_type/-dI-wI-dbcompress/%sutil_file_onlineIBMonly_confIBLOCALIBcheckIBone-runrman_diskIBbackup_root_dircompress_cmdIBMuncompress_cmdIcompress_dirIBMnew_db_homestage_db_homeIBrman_brtIBMtape_copy_cmdIBocopyIBdisk_copy_cmdIBwcpstage_copy_cmdIrman_setIBMrman_set_gnuIBMrman_ddrman_dd_gnu%s/%sIBsaveset_membersrman_utilIBrman_stageIcpio_gnuIBMdd_gnuIEblock-size=copy_gnuIBMcp_gnuIremote_hostcompress/-k yesremote_usercopy_in_cmdcopy_out_cmdIBMrewindIrewind_offlineItape_pos_cmdIBMmount_cmdIBdismount_cmdIBMtape_addressIBMtape_address_rewIBMtape_address*IBtape_address_ctlIBMSCRATCHvolume_backupIButil_vol_onlinesplitIBprimary_dbIstandby_dbIsplit_cmdIBbackup_mode/-mIarchive_logsIBM-m/restore_modeincrIBMdisk_copy_cmd = rmanIBMdisk_copy_cmd = rman_gnuIBMbrarchiveIB-a/-a1/-a2Iarchive_copy_dirIBM-w first_rmvIBMvolume_archiveI-m|-modifyI-mIparallel_instancesIPRIMARYSTANDBYSPLITIBsqlplussqlplussrvctlIexpdpIBimpdpIBorawalletIBsapwalletIBlockIBMbrabrbhdr0IBMuserIBMpasbrbackupbrconnectbrrecoverbrspacebrspacebrtoolsbackintbackint -f backintsplitint -f splitintIBM%s%s%s%d%s%sIBMbrt%s%d%s%sIBMrestIBMlockaIBbrrlockbIBrecovIBbrvlockdIB%s%s%s%s%s%s%s%s%s%s%sIbackgroundIusertraceIBbdumpIBswitchIsemlisrsecssfxspaceIBstrucIBparamIBconnIBMoffsetIhelpIBMOPatchIopatchIp12cwalletssoorapkiIstopaIBstopbIBtermIBMtermaIBtermbIBabortIBcmdnlspipspuspisposvupki000001brarchivbrbackupbrconnecbrrecovebrrestorsplitintrsecssfxBI_REQUEST=OLDBI_CALL=NEXTBI_CALL=LASTBRA_SEC_COPY=YESBRA_SEC_COPY=NOBI_CALLER=%sBI_BACKUP=FULLBI_BACKUP=PARTIALBI_BACKUP=ARCHIVEBI_REQUEST=NEWBI_CALL=FIRSTIBBI_RUN=%s%s%sBI_TYPE=ONLINEBI_TYPE=OFFLINEBI_MODE=ALLBI_MODE=FULLBI_MODE=INCRBI_MODE=NONDBBI_MODE=PARTIALSAPARCH=%sISAPBACKUP=%sIBMSAPCHECK=%sSAPREORG=%sSAPTRACE=%sSAPSWITCH=%sIBMBI_REQUEBI_CALL=BI_BACKUP=PARTIAP=ARCHIVBI_TYPE=OFFLINEBI_MODE=PARTIALBRA_SEC_COPY=YESCOPY=NOSAPDATA%dIBSAPTEMP%d( I &I/etc/oratabBR_TRACEIBMBR_TRCIBR_FORKYESBR_FORK=NOIEnvironment of %sIBBR_OFS_PWD=BR_OFS_PASSWORD=IBMSEC$STOREIBDBSID=IDB_SID=ORACLE_BASE=IBMORAWALLET=ISAPARCH=IBMSAPBACKUP=ISAPCHECK=IBSAPPROF=IBMSAPREORG=IBSAPTRACE=IBSAPWALLET=ISAPSWITCH=ISAPSID=SAPSYSTEMNAME=IDIR_LIBRARY=IBMSAP_DBLOG_OWNER=IBMORA_SOFT_OWNER=BACKINT_DIR=IBMRMAN_DIR=IBTAPE_DIR=IBNSBT_DIR=IBTWO_TASK=IBNLS_LANG=IBORA_NLSTNS_ADMIN=IFSCMD_CMD=IJAVA_HOME=IBR_ORA_IBMASM_IBM%s_ORACLE_SIDIBORACLE_SID=%sIB%s_ORACLE_HOMEIORACLE_HOME=%sI%s_ORACLE_BASEIORACLE_BASE=%sI%s_DB_SIDIBDB_SID=%sIB%s_ORAWALLETIBMORAWALLET=%sIBM%s_SAPDATA_HOMESAPDATA_HOME=%s%s_SAPARCHI%s_SAPBACKUPIBM%s_SAPCHECK%s_SAPREORG%s_SAPTRACE%s_SAPWALLETIBMSAPWALLET=%sIBM%s_SAPSYSTEMNAMEIBM%s_SAPSIDIBSAPSID=%sIB%s_SAPEXEIBSAPEXE=%sIBPATHIBMPATH=%s%s%s%s%sBR_GUI=1BR_LANG=EBR_LANG=DIBdbs_ora_tnsnameBR_ORACLE_SIDIBSAP_ORACLE_SIDIORACLE_SIDIBR_ORACLE_SID=%sIBMBR_ORACLE_HOMEISAP_ORACLE_HOME,BR_ORACLE_HOME=%sIBR_ORACLE_BASEISAP_ORACLE_BASEORACLE_BASE,BR_ORACLE_BASE=%sIBR_DB_SIDIBSAP_DB_SIDIDB_SIDIDBSIDIBORAWALLETIB,SAPDATA_HOME=%sIBMSAPPROF,SAPPROF=%sSAPARCH,SAPARCH=%s,SAPBACKUP=%sIBSAPREORGIBM,SAPREORG=%sIBMSAPREORG_OLDIBMOLD_SAPREORGIBMSAPCHECKIBMSAPTRACEIBMSAPWALLETIBBR_LASVER_DIRIBBR_LANGBR_LNGIED,BR_LANG=%sSAPSIDISAPEXEI,SAPEXE=%sIexerunSAPSWITCHIBSAP_NEW_DBLOG_OWNERSAP_DBLOG_OWNERBR_CNTRL_DIRIBMBR_CNTRL_ADIRIBBR_SPARSE_DIRIBBR_COMPR_OPTIBM,BR_COMPR_OPT=%sIBMBR_RMAN_DDIBR_FTP_CDIBBR_OFSIBR_OFS_RESOURCEBR_OFS_CLUSTERIBR_OFS_DOMAINIBBR_OFS_USERBR_OFS_PWDIBR_OFS_PASSWORDBR_ORA_NLS33IBMBR_ORA_NLS10IBMBR_DAYSBR_DYSIBR_LINESIBMBR_LNSIBR_FFCIBR_SHELL_CMDIBMBR_CD_CMDIBBR_CPIO_CMDBR_CP_CMDIBBR_DD_CMDIBBR_RM_CMDIBBR_RSH_CMDIBR_SSH_CMDIBR_RCP_CMDIBR_SCP_CMDIBR_FTP_CMDIBR_FSCMD_CMDIBMFSCMD_CMDIBBR_COMPR_EXTIBMBR_RMSET_EXTIBMBR_ARCH_LOCK_SYMIBM,BR_TRACE=%sIBMBR_AACIBR_ACEIBR_ACPIBR_AGCIBR_AHCIBR_AISIBR_ALNIBR_AMCIBR_AMDIBR_AMWIBR_ANCIBR_ARIIBR_ARSIBR_ASCIBR_ASWIBR_BCCIBR_BIUIBR_CABIBR_CACIBR_CADIBR_CBBIBR_CBDIBR_CBMIBR_CBRIBR_CCCIBR_CCFIBR_CCSIBR_CCWIBR_CFSIBR_CFZIBR_CGSIBR_COLIBR_CRWIBR_CSDIBR_CSFIBR_CSIIBR_CSLIBR_CSTIBR_DACIBR_DARIBR_DBBIBR_DBDIBR_DBHIBR_DBLIBR_DBMIBR_DBRIBR_DBSIBR_DBUIBR_DCCIBR_DCPIBR_DDCIBR_DEIIBR_DESIBR_DGUIBR_DISIBR_DLSIBR_DNSIBR_DODIBR_DOTIBR_DPEIBR_DPTIBR_DRBIBR_DRTIBR_DSBIBR_DSDIBR_DSMIBR_DSRIBR_DSSIBR_DSWIBR_DTBIBR_DUCIBR_DUSIBR_DVCIBR_DWTIBR_D2RIBR_EDSIBR_ETCIBR_FADIBR_FASIBR_FCPIBR_FDCIBR_FETIBR_FIDIBR_FIEIBR_FIQIBR_FLSIBR_FOCIBR_FPMIBR_FRCIBR_FRRIBR_FSEIBR_FSSIBR_FTDIBR_FTSIBR_F2RIBR_GBSIBR_GDSIBR_GISIBR_GNUIBR_GSIIBR_GUIIBR_HACIBR_HCCIBR_HICIBR_HPCIBR_HTRIBR_IBIIBR_ICTIBR_IDAIBR_IIEIBR_IOWIBR_IRMIBR_ISPIBR_ITMIBR_ITTIBR_IUIIBR_IWTIBR_KDFIBR_KRGIBR_KRUIBR_KSFIBR_KSOIBR_KSTIBR_KTFIBR_KUIIBR_L2LIBR_LBBIBR_LBRIBR_LBDIBR_LBMIBR_LBTIBR_LCFIBR_LCNIBR_LDOIBR_LDTIBR_LEPIBR_LLSIBR_LRPIBR_LSTIBR_LSSIBR_LSWIBR_LTDIBR_MACIBR_MAIIBR_MAPIBR_MCCIBR_MECIBR_MSLIBR_MTCIBR_MWTIBR_NAAIBR_NABIBR_NACIBR_NADIBR_NALIBR_NBBIBR_NBCIBR_NBDIBR_NBIIBR_NBMIBR_NBSIBR_NCCIBR_NCLIBR_NCRIBR_NCSIBR_NDCIBR_NDDIBR_NDIIBR_NDLIBR_NDOIBR_NDTIBR_NECIBR_NEIIBR_NEVIBR_NFBIBR_NFDIBR_NFRIBR_NICIBR_NIRIBR_NBRIBR_NKSIBR_NLCIBR_NLSIBR_NLTIBR_NNAIBR_NNCIBR_NNPIBR_NOIIBR_NRBIBR_NRCIBR_NRDIBR_NRFIBR_NROIBR_NRSIBR_NRTIBR_NSCIBR_NSIIBR_NSLIBR_NSOIBR_NSTIBR_NSUIBR_NTCIBR_NTLIBR_NTRIBR_NTSIBR_NTTIBR_NWEIBR_NWIIBR_OBSIBR_OCSIBR_ODHIBR_OEIIBR_OETIBR_OEUIBR_OINIBR_OJSIBR_ONLIBR_ORSIBR_ORTIBR_OSCIBR_OSDIBR_OSRIBR_OTNIBR_OTSIBR_OTUIBR_OUIIBR_PDBIBR_PDCIBR_PLAIBR_PMLIBR_PMTIBR_PPCIBR_PRBIBR_PRDIBR_PROIBR_PRTIBR_PTSIBR_PTTIBR_QTCIBR_RCCIBR_RCDIBR_RCFIBR_RCSIBR_RDBIBR_RDCIBR_RDGIBR_RDSIBR_RFBIBR_RGCIBR_RMBIBR_RMDIBR_RMLIBR_RMRIBR_RMTIBR_ROSIBR_RPEIBR_RRGIBR_RRUIBR_RSCIBR_RSNIBR_RSTIBR_RTLIBR_RUUIBR_RWTIBR_RXBIBR_RXRIBR_R2DIBR_R2FIBR_SAAIBR_SACIBR_SADIBR_SARIBR_SASIBR_SATIBR_SBFIBR_SBHIBR_SBQIBR_SBRIBR_SBSIBR_SCCIBR_SCIIBR_SCLIBR_SCSIBR_SCTIBR_SCWIBR_SDBIBR_SDCIBR_SDLIBR_SDRIBR_SDSIBR_SDTIBR_SEBIBR_SETIBR_SFPIBR_SFRIBR_SGAIBR_SICIBR_SIFIBR_SIGIBR_SIIIBR_SILIBR_SIPIBR_SIRIBR_SITIBR_SIVIBR_SLAIBR_SLCIBR_SMLIBR_SOFIBR_SOIIBR_SOTIBR_SPDIBR_SPGIBR_SPMIBR_SPQIBR_SRBIBR_SREIBR_SRGIBR_SRRIBR_SRUIBR_SSCIBR_SSEIBR_SSFIBR_SSOIBR_SSTIBR_STCIBR_STFIBR_STGIBR_STHIBR_STIIBR_STLIBR_STPIBR_STRIBR_STSIBR_STUIBR_SUCIBR_SWTIBR_TACIBR_TFSIBR_TMCIBR_TMIBBR_TOEIBR_TVBIBR_TWAIBR_TWTIBR_UAIIBR_UBNIBR_UCCIBR_UCDIBR_UCLIBR_UCMIBR_UDFIBR_UDLIBR_UDSIBR_UEIIBR_UFBIBR_UGCIBR_UICIBR_ULSIBR_UNBIBR_UOUIBR_UPOIBR_URCIBR_URIIBR_USCIBR_USDIBR_USOIBR_USSIBR_USTIBR_UTPIBR_UULIBR_UUPIBR_UVDIBR_VSOIBR_WLIIBRV_OPT_CRCTLFILEIBORA_DB_NAMEASM_ORA_SIDASM_ORA_HOMEIBMASM_ROOT_DIRIBMBR_SSFS_DATAPATHIBMBR_SSFS_KEYPATHrsdb_ssfs_connectIBBR_DIR_LIBRARYIDIR_LIBRARY=%sILIBPATHDIR_LIBRARYBR_NNGIBR_NNG=1IBMEXTSHM=BR%04d%sIBMapexIBMaddnodeORA_NLS33=%sIBMORA_NLS10=%sIBMBR_IBM_JAVA_OPTIONSIBM_JAVA_OPTIONS=%s%s/%s %s %s %s %s %sIBMORA_SOFT_OWNERIBRV_OPT_CRCTLFILE=%sIBMBR_UPO=1IBMBR_SRE=1IBMBR_RSC=1IBMBR_NTS=1IBMBR_NSI=1IBMBR_NBI=1IBMBR_DTB=1IBMBR_FORK=BR_GUI=1BR_LANG=C0Acstrace.trcwbI Error:trace file could not be opened IrbI%10d | %*s IB%02xIBM%cI%*s | %s IB ERROR: CsRDecompress: invalid handleIB ERROR: CsRDecompress(init): inlen = %d IBM >>CsRDecompress: handle = %4d options = %x I user: inlen = %d outlen = %d IBM stream length = %d ERROR: CsRDecompress: Could not allocate memoryIBM ERROR: CsRDecompress: internal buffer is not initialisedIB new block: length = %5d crc = %8x IBM >>ERROR: CsRDecompress: CRC check failed: segment CRC = %8x IB input data: pos %5d: CRC = %8x IBMERROR: CsRDecompress: return value = %d IBM ERROR: CsRDecompress: Expect input but not provided.IB ERROR: CsRDecompress: Expect out buffer but not provided.I compress data: pos = %5d CRC = %8x IBM original data: pos = %5d CRC = %8x IBM decompr: compress data: len = %d I decompr: original data: len = %d I decompress: read = %5d written = %5d IB >>ERROR: CsRDecompress: CRC check for original data failed: data CRC = %8x IBM<>CsRCompress: handle = %3d options = %x IBM ERROR: CsRCompress: Could not allocate internal buffer ERROR: CsRCompress: internal buffer is not initialised using temporary buffer... >>ERROR: CsRCompress: Unknow Algorithmus. >>ERROR: CsRCompress: return value = %d IB ERROR: CsRCompress: Expect input but not provided. ERROR: CsRCompress: Expect out buffer but not provided.IBM original data: pos = %6d CRC = %8x IB compress data: pos = %6d CRC = %8x IB ERROR: CsRCompress: early decompress: Could not allocate internal bufferIB ERROR: CsRCompress: early decompress: Invalid handle I early decompress: rc = %d I compr: original data: len = %d IBM compr: compress data: len = %d IBM compress: read = %6d written = %6d < 0 then IBM raise corruption_found; IBM end if; end;'; IBMcrosscheck archivelog all device type disk; IBMcrosscheck backup of archivelog all device type disk; Icrosscheck copy of archivelog all device type disk; IBMcrosscheck backup of archivelog all completed before 'to_date(to_char(sysdate+1))' device type disk; IBcrosscheck copy of archivelog all completed before 'to_date(to_char(sysdate+1))' device type disk; crosscheck backup of archivelog all completed before 'to_date(to_char(sysdate))' device type disk; crosscheck copy of archivelog all completed before 'to_date(to_char(sysdate))' device type disk; IBcrosscheck backup of archivelog all completed before 'to_date(to_char(sysdate-%d))' device type disk; Icrosscheck copy of archivelog all completed before 'to_date(to_char(sysdate-%d))' device type disk; IBMdelete noprompt expired archivelog all device type disk; IBdelete noprompt expired backup of archivelog all device type disk; delete noprompt expired copy of archivelog all device type disk; IBcrosscheck backup of database device type disk; IBMcrosscheck backup of controlfile device type disk; crosscheck copy of database device type disk; Icrosscheck copy of controlfile device type disk; IBcrosscheck backup of database completed before 'to_date(to_char(sysdate+1))' device type disk; crosscheck backup of controlfile completed before 'to_date(to_char(sysdate+1))' device type disk; Icrosscheck copy of database completed before 'to_date(to_char(sysdate+1))' device type disk; IBcrosscheck copy of controlfile completed before 'to_date(to_char(sysdate+1))' device type disk; IBMcrosscheck backup of database completed before 'to_date(to_char(sysdate))' device type disk; IBcrosscheck backup of controlfile completed before 'to_date(to_char(sysdate))' device type disk; IBMcrosscheck copy of database completed before 'to_date(to_char(sysdate))' device type disk; crosscheck copy of controlfile completed before 'to_date(to_char(sysdate))' device type disk; Icrosscheck backup of database completed before 'to_date(to_char(sysdate-%d))' device type disk; IBMcrosscheck backup of controlfile completed before 'to_date(to_char(sysdate-%d))' device type disk; crosscheck copy of database completed before 'to_date(to_char(sysdate-%d))' device type disk; Icrosscheck copy of controlfile completed before 'to_date(to_char(sysdate-%d))' device type disk; IBdelete noprompt expired backup of database device type disk; IBdelete noprompt expired backup of controlfile device type disk; IBMdelete noprompt expired copy of database device type disk; delete noprompt expired copy of controlfile device type disk; Icrosscheck backup of archivelog all completed before 'to_date(to_char(sysdate+1))' device type 'SBT_TAPE'; crosscheck backup of archivelog all completed before 'to_date(to_char(sysdate))' device type 'SBT_TAPE'; IBcrosscheck backup of archivelog all completed before 'to_date(to_char(sysdate-%d))' device type 'SBT_TAPE'; IBMdelete noprompt expired backup of archivelog all device type 'SBT_TAPE'; IBcrosscheck backup of database completed before 'to_date(to_char(sysdate+1))' device type 'SBT_TAPE'; IBcrosscheck backup of controlfile completed before 'to_date(to_char(sysdate+1))' device type 'SBT_TAPE'; IBMcrosscheck backup of database completed before 'to_date(to_char(sysdate))' device type 'SBT_TAPE'; crosscheck backup of controlfile completed before 'to_date(to_char(sysdate))' device type 'SBT_TAPE'; Icrosscheck backup of database completed before 'to_date(to_char(sysdate-%d))' device type 'SBT_TAPE'; Icrosscheck backup of controlfile completed before 'to_date(to_char(sysdate-%d))' device type 'SBT_TAPE'; IBdelete noprompt expired backup of database device type 'SBT_TAPE'; delete noprompt expired backup of controlfile device type 'SBT_TAPE'; Irelease channel dsk; } release channel sbt; } connect target %s@%s; Iconnect target %s; connect catalog %s; IBMconnect catalog %s@%s; set encryption identified by "I"IB on for all tablespacesIBMset decryption identified by "I"; identified by "connect command for RMAN inuser %suser command for ftp inBR_TRACEIBM#TRACE #LOCK I#FTP IBM IB?񙙙#TAPE I#CMD IB%s_1IBM%s_2IBMcommands for BRSBTLIB inIrRMAN output from pipeIBRMAN output fromIBMRMAN-DEFAULTIBMbackup commandIrestore commandrecover commandsql commandunhandled user-defined exceptionIBMbackup cancelled because all files were skippedarchivelog failover was doneIBMdisabled, job failed on it will be run on another channelIBvalidate found one or more corrupt blocksIBproxy file handle=Ipiece handle=IBtag=IBMList of Backup SetsList of Proxy CopiesIBMList of Datafiles IncludedIList of Datafiles in backup setList of Archived Logs IncludedIList of Archived Logs in backup setList of Backup Pieces for backup setIBMfor backup setIBS KeyIRMAN> IIncr 1 Incr 0 Handle:DINinput datafile fno=input datafile file number=input archive log thread=IBinput archived log thread=Ifno=IBMnumber=thread=sequence=IBoutput filename=IBM recid= RECID=output file name=IBbackup set completeproxy copy completeFinished copy atIBMFinished backup atIrestoring datafileIdestination for restore of datafilerestore of datafilecopied datafile copy of datafileIBMcopied datafile copyIBMoutput file nameIBMswitched to datafile copyIBinput datafile copy RECID=Iswitched to datafileIBMdatafileIBMfile name=Iarchive log thread=archived log thread=IBMbackup piece handle=IBMhandle=restore completeIBMFinished recoverIBMFinished restore atstarting incremental datafile backupset restorestarting incremental datafile backup set restoreIBMStarting recoverIBMstarting validation of datafile backupsetIBrestored backup piece 1 IBMstarting validation of datafile backup setIstarting validation of archive log backupsetIBMstarting validation of archived log backup setIstarting datafile backupsetstarting datafile backup setIBMstarting full datafile backupsetIBMstarting full datafile backup setIBstarting archive log backupsetIstarting archived log backup setIBMvalidation completecataloged datafile copydeleted backup pieceIBMuncataloged backuppieceuncataloged backup pieceIBMold RMAN configuration parametersIBCONFIGURE CONTROLFILE AUTOBACKUP ONnew RMAN configuration parameters are successfully storedIBdatafile conversion completeIBMsql statement:Ideleted archive logdeleted archived logIBMdeleted datafile backupdeleted data file backupIBMdeleted datafile copyIBdeleted data file copyIdeleted controlfile backupIdeleted control file backupdeleted controlfile copyIBMdeleted control file copyIBreleased channel:a%s_%dIBBRSBTLIB output fromIBMBRSBTLIBIBMBRSBTLIB: SIZEISAVESET %s %s %s %s #%d/%d-%d %1.0f %d/%d #SAVED....I%s %s #%d/%d-%d %1.0f %d-%d/%d I%s %s #%d/%d-%d IB#RESTORED.IBRTOOLS: SIZEIB File Name: IBSee trace fileIList of Archived LogsIB%s %s #%d/%d-%d %1.0f %d/%d %5.4f:1 %1.0f %s %s #%d/%d-%d %1.0f %d-%d/%d %5.4f:1 %1.0f I %s %s %s %s %s %s/%d %1.0f %d/%d %s %s #%d/%d %1.0f %d/%d %5.4f:1 %1.0f IBM%s %s #%d/%d %1.0f %d/%d IBM%s %s #%d/%d %5.4f:1 %1.0f I%s %s #%d/%d I%s %s %s/%d IB%s %s %s/%d %s IB%s %s %s I%s %s #%d/%d %s I%s %s %s %s I %s %s %1.0f %5.4f:1 %1.0f I:%s %s %d/%d %1.2fM IB%s %s %d-%d/%d-%d %1.2fM %s %s %d/%d IB%s %s %d-%d/%d-%d %d/%dIB to IBM%s ...Iconfigure controlfile autobackup on; IBSBT_TAPEIBM%s*database%d %s %d %1.0f %sIBspace_logIBcontrol_fileIBMinit_oraIBMinit_ora+ora_walletcommand output from pipeIBMcommand output fromx IBRTOOLS: FILE I%s %d %1.0f %sI%s %s %s/%d %5.4f:1 %1.0f IB%s %s %s/%d %1.0f %d-%d/%d I %s %s %5.4f:1 %1.0f voidIBMrsec5libIBMNULLIBMBR_TOOLS/%s_DB_USERBR_TOOLS/%s_DB_PASSWORD/IBBRT$IBMRSEC_DEBUGIERRORIB%s password for Java user in password fileJava output from pipeIBERROR:IFATAL:I[EXCEPTION]Exception in threadINFO:IBRecord:SecStore properties:IBMSecStore key:IBSID source:SID target:DB user target:DB user password:IBjdbc/pool/IUrl=IBMUser=IBTarget DB URL has not been specifiedIBMDB user already set toIUpdate record jdbc/pool/IBMUpdate SecureStoreISuccessfully updated SecureStoreIBM%s put DB_CONNECT/DEFAULT_DB_USER %s -plain%s put DB_CONNECT/SHADOW_DB_USER %s -plainIrsecssfx output from pipeIB*** ERROR =>IBM%sIpassword for rsecssfx in value file%s put DB_CONNECT/DEFAULT_DB_PASSWORD -valuefile %s -valuefile7bitI%s put DB_CONNECT/SHADOW_DB_PASSWORD -valuefile %s -valuefile7bitIB%s %1.0fIBMvxmkcdevIBMqiomkfile -s %1.0f %sIBvxmkcdev -s %1.0f %sIBMqiomkfile -r %1.0f %sIBvxmkcdev -r %1.0f %sIBMdummyIBSQLPLUS output from pipeIBM10.2.0.4.0I11.2.0.2.0Istop_fileIBSTOPIBMbackup utility input fileIB%s %1.0f I%s %1.0f %1.0f IBM%s %s no_checkIBMbackup utility negative fileIBMBR%04d%sIBMnullIBM -u IBM -f backupIbackupI -f mountIBmountIB -f dismountIBMdismountIBM -f restoreIBM restore -f inquireIBM inquire -i IBM -t file_online -t fileIBM -t volume_onlineIB -t volumeI -p IBM -n IBM -n no_checkIBM -c #SAVEDI#RESTOREDIB#BACKUP#MOUNTEDIBM#DISMOUNTED#NOTFOUNDIB#ERRORI#ERRFILEIBM#DONEIB%s %s I%s %sIB%s %s #%sI %1.0f %d/%dI %1.0f %d-%d/%dIBcheckIB %s IB%s %s %s %s #%s B?PbM________?G%04d-%02d-%02dI#NULLIB%s %s %sIB%s %s %s #%sIPID=IBM%s %s %sIBM %1.0fIdismount________-f sleep 0Ifile_select%s -> %sIBM%s at %04d-%02d-%02d %02d.%02d.%02d from Oracle######################################################################## # This init.ora profile is a transparent copy of Oracle spfile. # # It was created by %-50s # # spfile: %-60s # IBM# The location of Oracle spfile is defined in the standard Oracle # # pfile: %-60s # # spfile=%-60s # IB# Please do not change this file! Maintain only the spfile. # # You can use BRSPACE for the altering of database parameters: # # brspace -f dbparam # ######################################################################## IBMmount/dismount command output from pipe#INFOIBVOLUME = %s DATE = %s DBID = %s ACTID = %s FUNCID = %s USED = %dIBMVOLUME = %s IBMVOLUME = %*s DATE = %*s DBID = %s IVOLUME = %*s DATE = %*s DBID = %*s ACTID = %s IVOLUME = %*s DATE = %*s DBID = %*s ACTID = %*s FUNCID = %s SCRATCHVOLUME = %*s DATE = %s DBID = %*s ACTID = %s 00I%04d%02d%02d%02d%02d%02dIBM%.4s-%.2s-%.2s %.2s.%.2s.%.2sIB| I|IB000000I%s (%04d-%02d-%02d %02d.%02d.%02d)I%04d-%02d-%02d %02d.%02d.%02dIB (I)IB | | 20000101000000I%s %s #%d/%d %1.0f %d-%d/%d $0_unknownISAPSYSTEM0123456789ABCDEF@(#) $Id: //bas/722_REL/src/krn/rsec/rsecssfs.c#1 $ SAP................................ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~.@(#) $Id: //bas/722_REL/src/krn/rsec/rsecssfs.c#1 $ SAPA low-memory situation has occurred, therefore no call-specific error text is available; information about the incident are recorded in the developer traceIn Non-Unicode environment, only 7-bit ASCII is supportedURrsecssfs.cTRUEFALSEreadupdateINew request for memory not executed because low-memory situation occurred previously; this will be reset with the next API call to RSecSSFs IBMDynamic allocation of %d characters failed Dynamic allocation of %d bytes failed IMemory management structure cannot be allocated IBMAttempt to free NULL pointer IBFree for unallocated memory from %s %d Memory allocated by %s %d has been corrupted IBRSecSSFs is currently in low-memory state, therefore the trace message that was supposed to be created now cannot be rendered completely IB%s%sIBM##SSFS_ENDMARK##IBMRSecSSFs: %s [%s %d]IBMRSecSSFs: %s [%s %d] IB%s <-- %s%sUsing configuration data passed explicitly via API for testing purposesUsing explicitly set configuration dataSAPSYSTEMNAMEIBrsec/ssfs_datapathIrsec/ssfs_keypathIBProfile parameter "SAPSYSTEMNAME" = "%s"IBProfile parameter "rsec/ssfs_datapath" = "%s"IBProfile parameter "rsec/ssfs_keypath" = "%s"IBRSEC_SSFS_DATAPATHIRSEC_SSFS_KEYPATHIBEnvironment variable "SAPSYSTEMNAME" = "%s"IBMEnvironment variable "RSEC_SSFS_DATAPATH" = "%s"IBMEnvironment variable "RSEC_SSFS_KEYPATH" = "%s"IBMEvaluation of the environment is explicitly disabledIBMSAP-Profile is not used; in this case, all three environment parameters SAPSYSTEMNAME, RSEC_SSFS_DATAPATH and RSEC_SSFS_KEYPATH must exist and have non-initial valuesIConfiguration data read from environment parametersConfiguration data read from profileIBMConfiguration value "SAPSYSTEMNAME" from profile explicitly overwritten by different value in environment variable SAPSYSTEMNAMEIBMConfiguration value "rsec/ssfs_datapath" from profile explicitly overwritten by different value in environment variable RSEC_SSFS_DATAPATHIConfiguration value "rsec/ssfs_keypath" from profile explicitly overwritten by different value in environment variable RSEC_SSFS_KEYPATHIBMNot all configuration data (systemname, datapath, keypath) could be determined from profile or environmentI%sI%s%sSSFS_%s.DAT/IB%s%sSSFS_%s.DA_%s%sSSFS_%s.LCK%s%sSSFS_%s.KEY%s%sSSFS_%s.KE_Configuration:: Data file : %s Key file : %s Lock file : %s Data file backup : %s Key file backup : %s IEntering function "%s"IExiting function "%s" with return code %d (message: %s)RSecSSFsGenerateKeyRandom number generator return code %dIHex-Encoding failed with return code %d%Y%m%d_%H%M%S_I%s_%sIBResulting KeyID has length %d, which is longer than the permitted %d charactersKey type %d not supportedIBUnable to remove lock file "%s"; error code %dIICannot DetermineIBMFile "%s" closedIBMNULL-Pointer closing for file "%s"IUTF8 conversion failed with returncode %dIBFile "%s" cannot be opened in mode "%s": %s (errno = %d). Waiting cycle number %d for %d ms, then retrying.File "%s" cannot be opened in mode "%s": %s (errno = %d)IBMFile "%s" cannot be opened in mode "%s": %s (errno = %d); at this location, this is not considered an errorFile "%s" opened in mode "%s"IBCould not open lockfile "%s"; open() == %d (%s). Waiting cycle number %d for %d ms, then retrying.ICould not open lockfile "%s"; open() == %d (%s)rbILockfile at "%s" either does not exist although it should (%s), or has unexpected length (%d instead of %d). Try again. When status remains, use "rsecssfx removelock" to force lock removalIBMLockfile at "%s" has unexpected content%Y-%m-%d %H:%M:%S UTCUpdate of the secure storage is locked for %s by user "%s" from host "%s" since "%s"IBMRSecSSFsRemoveLockIThe secure storage is currently not locked, therefore the operation for forced removal of the lock has no effectIBMRSecSSFsRemoveFilesAn attempt was made to delete the productive SecStoreFS. This method can only handle a test environment that differs from the productive data.IRSecSSFsRemoveFilesLockPremature end of file when reading data headerIRecord type indicator %d read from header at file position %lu not supportedIBMRecord length read at file position %lu (%lu) exceeds the maximum expected record length (%lu)IRecord at file position %lu does not start with preamble; maybe file is no RSecSSFs fileIBMRSecSSFsListRecordsData file "%s" not existing; returning empty listIBM IBBinary dump: Incoming data are NULL %08XIBM%02XIBM%cI**I*IB %s %s %sIBM Payload value::Payload value converted from UTF-8::IBMPayload length of encrypted record is no multiple of 128IBMDecryption attempt with key from key file failed; trying default keyIBMDecryption attempt failed, but explicit migration key given; trying thisIBMDecryption attempt failed, trying with new keyIRecord "%s" was inserted with an encryption key that was different from the current one; when you still know the old one, you can try the "migrate" operation of the "rsecssfx" utilityRead data length %lu is bigger than the expected maximum valueIDecrypted payload::Key type %d is not supportedIBMPremature end of file when reading %d bytes of payload dataRead data header::IRead payload::IChecksum over data header and payload incorrectChecksum check OKIBKey file "%s" not found, using default keyIKey file "%s" empty; using default keyIKey file "%s" has content that is shorter than the expected lengthIKey file "%s" has wrong type codeIBKey file content::IKey read from key file "%s"The data file backup at location "%s" exists. This indicates that a previous conversion process terminated incompletely and the current data file might be corrupt. Review the current status of the secure storage with the "list" command. If necessary, restore the backup by renaming it to "%s" and check again. When you have the correct file restored as data file, delete the backup file manually.IBMThe key file backup at location "%s" exists. This indicates that a previous conversion process terminated incompletely and the current data file might be corrupt. Review the current status of the secure storage with the "list" command. If necessary, restore the backup by renaming it to "%s" and check again. When you have the correct file restored as key file, delete the backup file manually.IRSecSSFsConvertParsing of key compound for old key failed: %sIParsing of key compound for new key failed: %sIData file is "%s"IBOpen for read failedIBMwbIData file "%s" does not exist and cannot be createdOpen for write to create successful; will remove again to restore previous stateIBMRSecSSFs: remove error: IBMremoveU(%s) == %d; perror() called to stderrIBMFile exists alreadyr+bData file "%s" cannot be opened for writeIBFile can be opened for update; closing againIBMKey file is "%s"IBMKey file "%s" does not exist and cannot be createdIKey file "%s" cannot be opened for writeIBMData file backup "%s" cannot be createdBackup data file is "%s"IBMKey file backup "%s" cannot be createdIBackup key file is "%s"Key format %d is not supportedINo encrypted record in the secure storage could be successfully converted to the new key because none was readable with the current key, the default key or an externally provided key; no update was executedICannot write new key into key file "%s"Written key file::IPayload value after UTF-8 encoding::IBMPayload before encryption::Payload after encryption::IDuring conversion an error has occurred when reading the source recordIEOF at writing record data to temporary fileIBMIBMIBMRSecSSFsPutRecordIBInput data:: Key : %s RSecSSFsPutRecord(%s) has been called with an API structure that was already used previouslyIBMRecord key "%s" is longer than the permitted length of %d charactersIBMABCDEFGHIJKLMNOPQRSTUVWXYZ_/0123456789IRecord key "%s" contains illegal character at index %d. Allowed are only "%s"IBRecord key "%s" either does not contain a "/" character at all or it contains it at the very first position. Valid record keys start with a non-initial namespace prefix, followed by the slash character, followed by other characters.IBMRecord data for key "%s" is longer than the permitted length of %d bytes for plaintext binary dataIData file "%s" does not exist; creating neww+bData file "%s" cannot be opened for update/writeIBMData file "%s" opened for updateIBMRecord with key "%s" not found in secure storageIBMRecord data for key "%s" is longer than the permitted length of %d bytes for encrypted PSE fileRecord data for key "%s" is longer than the permitted length of %d bytes for encrypted binary dataIRecord data for key "%s" is longer than the permitted length of %d characters for plaintext character dataIRecord data for key "%s" is longer than the permitted length of %d characters for encrypted character dataIData file "%s" does not exist (this is not an error per se: a non-existing data file is a valid situation and treated equally as one without entries)IBData file "%s" opened for readIRSecSSFsGetRecordIBRSecSSFsGetRecord(%s) has been called with an API structure that was already used previouslyIBMTrying to readIRead attempt gave RC = %dIBWaiting cycle number %d for 600ms, then retryingIBMWaited long enough; exiting without successEOF when updating the deletion indicatorIBMEOF at writing record dataIData written to file::IMemory still allocated at checkpoint; allocated as %s(%d) from %s %d *** ERROR => *** WARNING => 1.2,3;4:5-DpTrcLockwaillegal parameterIBMCTrcIGetThrAdm: malloc failed IERROR => CTRC_IS_HANDLE2 != CTRC_IS_HANDLE hdl =%p ctrcadm =%p next_free_comp =%d ctrcadm + next_free_comp =%p IBM ěS%a %b %e %H:%M:%SIB%.24s:%03ld %4.4d I%.24s I%sI%c IBM I***LOG %3.3s=> [%-12.12s %.5s] IB IBM ***LOG %3.3s=> %s, %s (%s) [%-12.12s %.5s] ***LOG %3.3s=> %s [%-12.12s %.5s] I*** ERROR => Illegal encoding(%d) for Trace [%s %d] IBMdptrace.cIB*** ERROR => vsnprintfU err, errno=%d [%s %d] I*** ERROR => vsnprintf err, errno=%d [%s %d] IBillegal errnoIBerror text too long (%d: %s) [%-12.12s %.5s] I %sdata was truncated I %s contextinfo_hook_func failed %d IBM*** ERROR => Dptrc fmt string truncated I DpTrc: found match for pattern >%s< in output DpTrc: maximum file size reached: %d I (%d) - illegal errnoIB (%d) - error text too long (%d: %s)IB, IOFFONIGLOBAL=ONIB%ssysno %s IBM%ssid %s IBM%ssystemid %d (%s) IBIBM RS/6000 with AIXIBM%srelno %d IBM%spatchlevel %d IBM%spatchno %d IBM%sintno %d IBM%smake %s, %s%s, %s%s IBMsingle threadedASCIIIB, 64 bitIBMoptimizedIB%sprofile %s IBM%spid %d IBM%s allAll* * ACTIVE TRACE LEVEL %d IB* ACTIVE TRACE COMPONENTS %s * IBCalling hook function for component '%c' IB%-12.12s%dI* I* SWITCH TRC-LEVEL to %d IBCTrcSetParam: Wrong handle CTrcSetParam: cannot set the filepointer. ICTrcGetParam: Wrong handle for CTP_HOOKFUNC IBMCTrcThrClose: wrong handle CTrcThrClose: illegal handle IB*** ERROR => CTrcOpen: fopen %s IBM --------------------------------------------------- IBtrc file: "%s", trc level: %d, release: "%s" IB722--------------------------------------------------- IBM*** ERROR => CTrcNewComp: too many comps IBCTrcNewComp called after CTrcLastCompIB*** ERROR => CTrcNewComp: not initialized ICTrcSetInfoOutputFunc: option %d not supported. @(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_str.c#1 $ SAPIBM I~@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_put.c#1 $ SAPI @(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_OutStr.c#1 $ SAP@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_FldWd.c#1 $ SAPIBM@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_OutCS.c#1 $ SAP(null)(nil)vvfprintfU16IBMu16_OutCS.cB:QnٺzfpH=c)\Buffer overflow (floating point output)@(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_aux.c#1 $ SAPnonelowmediumhighIBM --- Unicode interface ------ End of message --------- Unicode interface [%.60s line %d] pid = %d time = %ld:ICmdline : %s IBM IB --- Unicode interface ------ End of message ---dbgAlignCheckStringU16(): ERROR: The following string is unaligned: IBMIBM IBError in format string at or near 'Y': Error in format string at or near 'Y': Function %.64s : Array %.32s length %.32s is too small. : malloc : Out of memory.I--- Unicode interface ------ End of message ------I %02xIB %04xIBCharacters previously read: encountered invalid UTF-8I (but where?)IBAll bytes to processIBMNLSUI_FILE_TRACEI0%.10s "%s%s" (fileno 0x%x)IInternal errorIU16 trace level set to u16_aux.cIBM IBU16 trace level set to @(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_OutCon.c#1 $ SAP0u16_OutCon.cCommand Line ConversionEnvironment ConversionIBMnlsui1.cIBMmkdirU16IBMcpathIBMAX_PATH_LNchmodU16IBMgetcwdU16IBchdirU16IBMaccessU16IBstrfctimeU16IBMcformatMAX_FORMATSTR_LNIBMstrftimeU16MAX_TIMESTR_LNIwteststrIBMsystemU16IBcstringMAX_COMMAND_LNIEntering cleanup_putenv_table(). Allocated table lines = %i IBEntries after shrinking: %i IBMEnlarging table to %i IputenvU16IBcptrIBMlengetenvU16IBcnameIBMAX_ENV_LNIremoveU16IBrenameU16IBcfromIBctofopenU16IBMcmodeIBMAX_MODE_LNopenU16dlerrorU16Ierr_msgUIBMMAX_DB_ERROR_LNdlsymU16IBMMAX_SYM_LNIdlopenU16IBSAPCASTRAW2UCCHKI0nlsui_cast_raw2ucIBfileCIBMAX_FILENAME_LNERROR: Casting an odd adress to SAP_UTF16* in file %s, line %d @(#) $Id: //bas/722_REL/src/i18n/sapu16/u16_cty.c#1 $ SAPv,?@@??/`?#m^##=@/ % 3_??======?????_>/P>`w<???_? ?@@??/`?#m^##=@/ % 0_??======?????_>/P`>`w???_? UUԪN$1)Q-*UR@) ?/*ꪪ???@?D0???????9m^9;9=ÿ=`=@`==/_%;3?_?======???????G?~???]?_0UUUUUUUUUT+UUUJUUUUUUUUT@TUUUUUUUUPUUUUUUUU?UUUUUUUUUUUUUUUUUUUUUUUUUUUUU??>'8 =Pdstnon dstactiveinactiveIBMonIoffoldzdate/DSTswitch_contloctimeNULLIBM%02d.%02d.%4d %02d:%02d:%02d %sIBMContLoctGetDstOffset: gmtime : %lu - %s IContLoctGetDstOffset: localtime: %lu - %s IContLoctGetDstOffset: localtime : %lu - %s ContLoctGetDstOffset: DST offset: %d IBContLoctGetNextSwitch: did not find next DST switch IBMContLoctGetNextSwitch: next switch: %s, isDst=%d IBContLoctGetNextSwitch: did not find previous DST switch IBMContLoctGetNextSwitch: previous switch: %s, isDst=%d IBContLoctGetInterval: is DST active: %d ContLoctGetInterval: cannot find next daylight saving time switch (init) IBContLoctGetInterval: cannot find next daylight saving time switch (current) IBMContLoctGetInterval: %s outside current time interval IContLoctGetInterval: cannot find next daylight saving time switch (outer) Ilocaltime_cont: timezone is %ld IBMlocaltime_cont: init with dstOffset=%d, timeZoneOffset=%d Ilocaltime_cont: DST switch is %s IBlocaltime_cont: time %ld, gmtime %s localtime_cont: time %ld, calculated local time %s localtime_cont: time %ld, real local time %s Recursive call of localtime_cont at %lu IBMmktime_cont: got NULL from localtime(&t) NiInit2NiInit3NiThrInitNiExitNiServerHandleNiBufServerHandleNiServerHandleForPortNiBufServerHandleForPortNiServerHandleForAddrNiBufServerHandleForAddrNiServerHandleExNiHandleNiRawHandleNiBufHandleNiBufRawHandleNiHandleForAddrNiRawHandleForAddrNiBufHandleForAddrNiBufRawHandleForAddrNiHandleForProtoNiRawHandleForProtoNiBufHandleForProtoNiBufRawHandleForProtoNiHandleExNiHandleForAddrExNiGetHdlProtoNiAcceptEx2NiWriteNiRawWriteNiReadNiRawReadNiPeekExNiCheckExNiCheck2NiCheck2CancelNiHdlToSockNiGetSiSocketNiSockToHdlNiCloseHandleNiCloseHandleKPNiShutdownHandleNiRouteToTableNiModifyRouteNiMyHostNameNiGetOwnFQDNNiGetNodeAddrListNiGetMacAddrListNiHostToAddrNiHostToAddr2NiHostToAddr3NiGetLoopbackAddrNiAddrToHost2NiAddrToHostCanon2NiServToNoNiNoToServ2NiMyAddrVerifyNiMyAddrCheckNiGetParamNiSetParamNiReadPendingNiWritePendingNiErrSetNiWaitNiHdlGetPeerNiHdlGetSavedPeerNiHdlGetNameNiHdlSetBlockmodeNiHdlGetBlockmodeNiHdlGetStatusNiHdlSetTraceNiHdlGetTraceNiHdlDumpNiHdlDump2NiGetHdlParamNiGetHdlParamExNiSetHdlParamNiSecStr2NiAddrToStrNiAddrToStr2NiAddrMaskToStrNiStrToAddrNiStrToAddrMaskNiStrToAddrAndPortNiAddrMatchNiAddrStrMatchNiServToStrNiServToStr2NiGuessDistanceNiSetSingleReadNiGetSingleReadNiGetMaxSocketsNiHdlGetConStatNiHdlGetOutOctetsNiHdlGetInOctetsNiHdlGetOutMsgsNiHdlGetInMsgsNiHdlGetStartTimeNiDgHdlCreateNiDgHdlBind3NiDgHdlBindNameNiDgHdlConnectNiDgHdlSendNiDgHdlSendToNiDgHdlRecvFromNiDgHdlCloseNiDgHdlJoinGroupNiDgHdlLeaveGroupNiGetSO_ReuseAddrNiGetSO_KeepAliveNiGetSO_LingerNiGetSO_SndBufNiGetSO_RcvBufNiGetIP_MulticastIFNiGetIP_MulticastTTLNiGetTCP_NoDelayNiSetSO_ReuseAddrNiSetSO_KeepAliveNiSetSO_LingerNiSetSO_SndBufNiSetSO_RcvBufNiSetIP_MulticastIFNiSetIP_MulticastTTLNiSetTCP_NoDelayNiGetPeerVersionNiGetHdlTblIdxNiConvSiAddrNiTestPfParamNiSetPfParamNiTcInitParamNiTcAddHdlNiTcDelHdlunspec.UDSIPv4UDS,IPv4IPv6UDS,IPv6IPv4,IPv6UDS,IPv4,IPv6unknown***onoffTRUEFALSEONOFFUDI4I6??STDGInixx.cI%s: invalid hdl %dI%s: invalid hdl %d %s: parameter invalid (pParam == NULL)I%s: parameter invalid (pParam == NULL) %s: parameter invalid (name == NULL)IBM%s: parameter invalid (name == NULL) IB%s: parameter invalid (value == NULL)IB%s: parameter invalid (value == NULL) I%s: bad value (length %d >= 256)IBM%s : %s=%s is/hostbuffer_timeout_valid_entryIBPRF %s value: %s is out of range:[%d, %d] is/hostbuffer_timeout_invalid_entryis/socket_buffer_sizeIBPRF %s value: %s is invalid IBPRF %s value: %s is out of range:[0; %d - %d] %s : unknown parameter %s I%s: parameter invalid (pSocket == NULL)%s: parameter invalid (pSocket == NULL) IBM%s: parameter invalid (pSockAddr == NULL)IB%s: parameter invalid (pSockAddr == NULL) I%s: parameter invalid (pUDSPath != NULL && udsPathLen < NI_UDS_PATH_LEN)IBM%s: parameter invalid (pUDSPath != NULL && udsPathLen < NI_UDS_PATH_LEN) IB%s: SiConvSockAddr failedIB%s: SiConvSockAddr failed (sirc=%d; %s; %s; errno=%d: %s) I%s: parameter invalid (pAddr == NULL)IB%s: parameter invalid (pAddr == NULL) I%s: parameter invalid (addrLen < SI_INADDR_LEN)%s: parameter invalid (addrLen < SI_INADDR_LEN) IBM%s: parameter invalid (addrLen < SI_IN6ADDR_LEN)IBM%s: parameter invalid (addrLen < SI_IN6ADDR_LEN) IB%s: parameter invalid (addrLen < SI_UDS_PATH_LEN)IB%s: parameter invalid (addrLen < SI_UDS_PATH_LEN) I%s: invalid family %dIBI$I$I%%s: parameter invalid (pBuffer == NULL && bufferLen != 0)IB%s: parameter invalid (pBuffer == NULL && bufferLen != 0) I%s: parameter invalid (bufferLen < 0)IB%s: parameter invalid (bufferLen < 0) I%s: parameter invalid (pRead == NULL)IB%s: parameter invalid (pRead == NULL) I%s: parameter invalid (pHdl->mType == NI_LISTEN)IBM%s: parameter invalid (pHdl->mType == NI_LISTEN) IB%s: parameter invalid (pHdl->mType == NI_RI_LISTEN)%s: parameter invalid (pHdl->mType == NI_RI_LISTEN) IBM%s: parameter invalid (pPeerVersion == NULL)IBM%s: parameter invalid (pPeerVersion == NULL) IB%s: NiBufISendMsg failed for hdl %d (rc=%d; %d) IBM%s: send timed out for hdl %d (%dms)IBM%s: hdl %d read timed out (%dms) IB%s: NiRead failed for hdl %d (rc=%d) IB%s: wrong data length received (%d; hdl %d)%s: wrong data length received (%d; hdl %d) IBM%s: hdl %d peer version %d %s: parameter invalid (pValue == NULL)I%s: parameter invalid (pValue == NULL) %s: parameter invalid (pHops == NULL)IB%s: parameter invalid (pHops == NULL) I%s: parameter invalid (pOnOff == NULL)I%s: parameter invalid (pOnOff == NULL) %s: parameter invalid (pTimeout == NULL)IBM%s: parameter invalid (pTimeout == NULL) IB%s: parameter invalid (pHdl->con.mSocket.family != SI_AF_INET_X)IBM%s: parameter invalid (pHdl->con.mSocket.family != SI_AF_INET_X) IB%s: parameter invalid (pHdl->con.mSocket.type != SI_SOCK_DGRAM)%s: parameter invalid (pHdl->con.mSocket.type != SI_SOCK_DGRAM) IBM%s: parameter invalid (pMcNodeAddr == NULL)%s: parameter invalid (pMcNodeAddr == NULL) IBM%s: parameter invalid (NI_IS_ADDR_MULTICAST( *pMcNodeAddr ) == FALSE)IB%s: parameter invalid (NI_IS_ADDR_MULTICAST( *pMcNodeAddr ) == FALSE) I%s: parameter invalid (pHdl->mType != NI_DG_UNCONNECTED && pHdl->mType != NI_DG_CONNECTED)I%s: parameter invalid (pHdl->mType != NI_DG_UNCONNECTED && pHdl->mType != NI_DG_CONNECTED) %s: parameter invalid (pBuffer == NULL)%s: parameter invalid (pBuffer == NULL) IBM%s: receive for hdl %d timed out IB%s: hdl %d received %d bytes from %%s I%s: parameter invalid (pNodeAddr == NULL)IB%s: parameter invalid (pNodeAddr == NULL) I%s: parameter invalid (pData == NULL)IB%s: parameter invalid (pData == NULL) I%s: NiIMakeSockAddr failed (rc=%d) %s: hdl %d sent %d of %d bytes to %%s I%s: parameter invalid (pHdl->mType != NI_DG_CONNECTED)I%s: parameter invalid (pHdl->mType != NI_DG_CONNECTED) %s: parameter invalid (pServName == NULL)IB%s: parameter invalid (pServName == NULL) I%s: parameter invalid (strlenU(pServName) >= NI_MAX_SERVNAME_LEN)IB%s: parameter invalid (strlenU(pServName) >= NI_MAX_SERVNAME_LEN) I%s: parameter invalid (strlenU(pHostName) >= NI_MAX_HOSTNAME_LEN)IB%s: parameter invalid (strlenU(pHostName) >= NI_MAX_HOSTNAME_LEN) I%s: invalid hostname '%s' (rc=%d;hdl %d) IB%s: invalid service '%s' (rc=%d;hdl %d) IBM%s: parameter invalid (pServNo == NULL)%s: parameter invalid (pServNo == NULL) IBM%s: parameter invalid (pHandle == NULL)%s: parameter invalid (pHandle == NULL) IBM%s: malloc failed for %d bytesI%s: malloc failed for %d bytes (%d) IBM%s: parameter invalid (pHostName != NULL && strlenU(pHostName) >= NI_MAX_HOSTNAME_LEN)I%s: parameter invalid (pHostName != NULL && strlenU(pHostName) >= NI_MAX_HOSTNAME_LEN) /H/%s: hostname '%s' unknown %s: parameter invalid (pNodeAddrStr == NULL)IBM%s: parameter invalid (pNodeAddrStr == NULL) IB%s: parameter invalid (bufferLen < NI_IPv4ADDR_STR_LEN)%s: parameter invalid (bufferLen < NI_IPv4ADDR_STR_LEN) IBM%s: parameter invalid (bufferLen < NI_NODEADDR_STR_LEN)%s: parameter invalid (bufferLen < NI_NODEADDR_STR_LEN) IBM%d.%d.%d.%d%x:%x:%x:%x:%x:%x:%x:%x%s: NiHostToAddr failed (rc=%d) IBM%s: distance of %s and %s is %d IBM%s: parameter invalid (pServNoStr == NULL)I%s: parameter invalid (pServNoStr == NULL) %s: parameter invalid (bufferLen < NI_SERVNO_STR_LEN)IB%s: parameter invalid (bufferLen < NI_SERVNO_STR_LEN) I%dI%s: parameter invalid (pNodeAddrMask == NULL)IB%s: parameter invalid (pNodeAddrMask == NULL) I%s: parameter invalid (bufferLen < NI_ADDRMASK_STR_LEN)%s: parameter invalid (bufferLen < NI_ADDRMASK_STR_LEN) I/%s: invalid string length of '%s' (%d)I%s: invalid string length of '%s' (%d) %s: invalid prefix in '%s'I%s: invalid prefix in '%s' %s: invalid prefix in '%s' (%d)%s: invalid prefix in '%s' (%d) IBM%s: invalid length of '%s' (%d)%s: invalid length of '%s' (%d) IBM%s: '%s' -> %s (%d/%d) %s: invalid character in '%s' (%d)I%s: invalid character in '%s' (%d) %s: invalid value in '%s' (%d;%d)IB%s: invalid value in '%s' (%d;%d) I%s: invalid wildcards in '%s'IB%s: invalid wildcards in '%s' I%s: invalid character in '%s' (%d;%d)IB%s: invalid character in '%s' (%d;%d) I%s: invalid multiple group in '%s'I%s: invalid multiple group in '%s' IBM %s: address '%s' with subnet prefix%s: address '%s' with subnet prefix IBM%s: parameter invalid (pNodeAddrStrA == NULL)IB%s: parameter invalid (pNodeAddrStrA == NULL) I%s: parameter invalid (pNodeAddrStrB == NULL)IB%s: parameter invalid (pNodeAddrStrB == NULL) I%s: parameter invalid (pNodeAddrA == NULL)I%s: parameter invalid (pNodeAddrA == NULL) %s: parameter invalid (pNodeAddrB == NULL)I%s: parameter invalid (pNodeAddrB == NULL) %s: parameter invalid (pStr == NULL)IBM%s: parameter invalid (pStr == NULL) IB%s: invalid square brackets in '%s'%s: invalid square brackets in '%s' IBM%s: invalid service in '%s'%s: invalid service in '%s' IBM%s: '%s' -> host='%s'; serv='%s' IB%s: service invalid or unknown '%s' (%s; rc=%d) IBM%s: '%s' -> host='%s'; serv=NULL IB%s: wildcard host '%s'I%s: wildcard host '%s' (%p) IBM%s: host invalid or unknown '%s' (%s; rc=%d; %p) IB%s: parameter invalid (rc != SAP_O_K)IB%s: parameter invalid (rc != SAP_O_K) I%s: switch %s SINGLE READ MODE for hdl %d/sock %d I%s: parameter invalid (pParamData == NULL)I%s: parameter invalid (pParamData == NULL) %s: invalid param %d for hdl %d%s: invalid param %d for hdl %d IBM%s: parameter invalid (pParamData->datatype != NI_DT_BOOL)I%s: parameter invalid (pParamData->datatype != NI_DT_BOOL) %s: parameter invalid (pParamData->datatype != NI_DT_RAW)IB%s: parameter invalid (pParamData->datatype != NI_DT_RAW) I%s: parameter invalid (pParamData->value.raw_val != NI_BUFSTAT_ON)I%s: parameter invalid (pParamData->value.raw_val != NI_BUFSTAT_ON) %s: call may cause problems with select sets (hdl %d) I%s: hdl %d, bufstat %d %s: parameter invalid (milliSec < 0)IBM%s: parameter invalid (milliSec < 0) IB%s: sleep (%dms) ... IB%s: NiISelect failed (rc=%d;to=%dms)I?%s: param %d unknownIBM%s: NiGetParamEx failed (rc=%d;param=%d) IB%s: param %d unknown IB%s: parameter invalid (pMyHostName != NULL && strlenU(pMyHostName) >= NI_MAX_HOSTNAME_LEN)I%s: parameter invalid (pMyHostName != NULL && strlenU(pMyHostName) >= NI_MAX_HOSTNAME_LEN) %s: parameter invalid (pHostName == NULL)IB%s: parameter invalid (pHostName == NULL) I%s: NiIGetNodeAddr failed (rc=%d) I%s: return %%s %s: parameter invalid ((protocol & ~(NI_PROTO_FAM_UNSPEC | NI_PROTO_FAM_IPv4 | NI_PROTO_FAM_IPv6)) != 0)IBM%s: parameter invalid ((protocol & ~(NI_PROTO_FAM_UNSPEC | NI_PROTO_FAM_IPv4 | NI_PROTO_FAM_IPv6)) != 0) IB%s: parameter invalid (ppNodeAddrList == NULL)I%s: parameter invalid (ppNodeAddrList == NULL) %s: parameter invalid (*ppNodeAddrList != NULL)%s: parameter invalid (*ppNodeAddrList != NULL) IBM%s: parameter invalid (pListSize == NULL)IB%s: parameter invalid (pListSize == NULL) I%s: list for '%s' incomplete (%d<%d) IB%s: no IPv4 address availableIB%s: parameter invalid (pMacAddrList == NULL)IBM%s: parameter invalid (pMacAddrList == NULL) IB%s: parameter invalid (pFound == NULL)I%s: parameter invalid (pFound == NULL) %s: parameter invalid (pNodeAddrList == NULL)IB%s: parameter invalid (pNodeAddrList == NULL) I%s: parameter invalid (maxHandles > NI_MAX_HDLS)IBM%s: parameter invalid (maxHandles > NI_MAX_HDLS) IB%s: NI already initialized; param 'maxHandles' ignored (init=%d;par=%d;cur=%d) %s: NI already initializes (init=%d;cur=%d) IBM%s: NI initialization negative (%d) IBM%s: NiPGetHostByName returned 0 IBM%s: %d<=%dI%s: buffer too small (%d<=%d) I%s: own FQDN = '%s' IBM%s: own FQDN = '%s'; domain = '%s' %s: own FQDN = '%s'; domain part missing IB%s: hostname = '%s' IBM%s: parameter invalid (pRouteString == NULL)IBM%s: parameter invalid (pRouteString == NULL) IB%s: parameter invalid (bufferLen < 32)I%s: parameter invalid (bufferLen < 32) IBM/S/%s: buffer length %d too small for route IB/P/%s: parameter invalid (pInStr == NULL)I%s: parameter invalid (pInStr == NULL) %s: parameter invalid (pSecStr == NULL)%s: parameter invalid (pSecStr == NULL) IBM%s: parameter invalid (strlenU(pInStr) >= bufferLen)IBM%s: parameter invalid (strlenU(pInStr) >= bufferLen) IB/W/%s: parameter invalid (pCount == NULL)I%s: parameter invalid (pCount == NULL) %s: parameter invalid (pRouteTable == NULL && tableSize != 0)IB%s: parameter invalid (pRouteTable == NULL && tableSize != 0) I%s: parameter invalid (tableSize < 0)IB%s: parameter invalid (tableSize < 0) I%s: malloc failed for %d bytes %s: got '%s' IB%s: parameter invalid (howto != NI_SHUT_RD && howto != NI_SHUT_WR && howto != NI_SHUT_RDWR)%s: parameter invalid (howto != NI_SHUT_RD && howto != NI_SHUT_WR && howto != NI_SHUT_RDWR) IBM%s: parameter invalid (pHdl->mType == NI_DG_UNCONNECTED)IBM%s: parameter invalid (pHdl->mType == NI_DG_UNCONNECTED) IB%s: parameter invalid (pHdl->mType == NI_DG_CONNECTED)I%s: parameter invalid (pHdl->mType == NI_DG_CONNECTED) %s: parameter invalid (socketNo < 0)IBM%s: parameter invalid (socketNo < 0) IB%s: sock %d not foundIB%s: sock %d not found I%s: parameter invalid (pHdl->mType == NI_CONN_WAIT)%s: parameter invalid (pHdl->mType == NI_CONN_WAIT) IBM%s: parameter invalid (pHdl->con.mSocket.socketNo == NI_INVALID_SOCK)IB%s: parameter invalid (pHdl->con.mSocket.socketNo == NI_INVALID_SOCK) I%s: parameter invalid (pSocketNo == NULL)IB%s: parameter invalid (pSocketNo == NULL) I%s: parameter invalid (pHdl->lis.mIPSocket.socketNo == NI_INVALID_SOCK && pHdl->lis.mUDSocket.socketNo == NI_INVALID_SOCK)I%s: parameter invalid (pHdl->lis.mIPSocket.socketNo == NI_INVALID_SOCK && pHdl->lis.mUDSocket.socketNo == NI_INVALID_SOCK) %s: parameter invalid (pFailCount == NULL)I%s: parameter invalid (pFailCount == NULL) %s: parameter invalid (mode != NI_READ && mode != NI_WRITE)%s: parameter invalid (mode != NI_READ && mode != NI_WRITE) IBM%s: invalid call for listen hdl %d %s: invalid call for pseudo listen hdl %d I%s: parameter invalid (dataLen < 0)%s: parameter invalid (dataLen < 0) IBM%s: parameter invalid (pWritten == NULL)IBM%s: parameter invalid (pWritten == NULL) IB%s: parameter invalid (pData == NULL && dataLen != 0)IB%s: parameter invalid (pData == NULL && dataLen != 0) I%s: parameter invalid (pOutHandle == NULL)I%s: parameter invalid (pOutHandle == NULL) %s: parameter invalid (pListenHdl->mType != NI_LISTEN && pListenHdl->mType != NI_RI_LISTEN)%s: parameter invalid (pListenHdl->mType != NI_LISTEN && pListenHdl->mType != NI_RI_LISTEN) IBM%s: NiIRiCliAccept failed (rc=%d) I%s: NiIGetSockName for hdl %d failed (rc=%d) IB%s: parameter invalid ((protocol & ~(NI_PROTO_FAM_UNSPEC | NI_PROTO_FAM_LOCAL | NI_PROTO_FAM_IPv4 | NI_PROTO_FAM_IPv6)) != 0)IB%s: parameter invalid ((protocol & ~(NI_PROTO_FAM_UNSPEC | NI_PROTO_FAM_LOCAL | NI_PROTO_FAM_IPv4 | NI_PROTO_FAM_IPv6)) != 0) I%s: parameter invalid (protocol == NI_PROTO_FAM_LOCAL)I%s: parameter invalid (protocol == NI_PROTO_FAM_LOCAL) %s: parameter invalid ((protocol & NI_PROTO_FAM_LOCAL) != 0 && *pServNo == NI_FINDSERV_OS)I%s: parameter invalid ((protocol & NI_PROTO_FAM_LOCAL) != 0 && *pServNo == NI_FINDSERV_OS) %s: NI library still in use (%d) IB%s: NI library already released (%d) IB%s enter IB%s: NI library not initialized (%d)%s: NI library not initialized (%d) IBM%s: parameter invalid (maxHandles <= 0)%s: parameter invalid (maxHandles <= 0)   MESG_IORAW_IOROUT_IO*** ERROR ***localhostNI (network interface)0.0.0.0127.0.0.1::::1internal errorhostname '%s' unknownservice '%s' unknownservice '%s' in usetimeout occuredconnection to partner '%s' brokeninternal error (this retcode should be handled by caller of NI-layer)partner '%s' not reachedtimeout while pending for route completioninvalid client versionno free connect port found within rangeverify own hostname '%s' failedNiICreateHandleNiICloseHandleNiIInitSocketNiIErrorTextNiIErrorNameNiIMakeSockAddrNiISolveSockAddrNiITraceSockAddrNiITracePeerAddrNiIListenNiIConnectSocketNiIConnectNiICheckPendConnectionNiICheckPeerAddrNiIAcceptNiIBindNiIWriteNiIReadNiIGetSockNameNiIGetPeerNameNiISelectNiIPollNiIPeekNiIPeekListenNiIShutdownHandleNiIBlockModeNiICheckNiICheck2NiICheck2CancelNiIHdlGetStatusNiSetTraceForPeerNiClearTraceForPeerNiGetTraceForPeerListNiAlInitNiAlReleaseNiAlChangeTypeNiAlGetListNiIWalkNitabNiAddrToStrStaticNiIInitNiIExitNiISetIPProtoUsageNiISetConnectAclNiGetParamExNiSetParamExNiEnableTraceNiDisableTraceNiEnableSiTraceNiDisableSiTraceNiSetSiTraceNiIGetSockOptNiISetSockOptNiLocalCheckNiIMyAddrVerifyNiHSBufInitNiAddrToHostNiIDgHdlGroupAdmNiWakeupOpenNiWakeupCloseNiWakeupGetNiHdlNiWakeupGetCntNoNiWakeupCollectNiWakeupCollect2NiWakeupAttachNiWakeupDetachNiWakeupExecNiWakeupExec2NiITcAddHdlNiITcDelHdlNiITcCheckNiITimeConstPasswordCheckNiITraceByteOrderNiIBindSocketNiIAlFindEntryNiIAlCheckAcceptNiIWakeupBindNiIWakeupConnectNiIWakeupSendNiIWakeupReceiveNiITcCheckParamUDI4I6??STDGnew %s: route permission denied (%s to %s, %s)talkmode Native2 not allowedconnection to %s, %s brokenroute canceled by administatorrouter shutdowninfo access denied (%s to %s, %s)maximum number of clients reachedinvalid client requestedSNC processing failed: %sOpcode receivedQueue overflowNetwork packet too bigAccepted handle pendingHandle passed to other processUnexpected function callSAP_O_KNIEINTERNNIEHOST_UNKNOWNNIESERV_UNKNOWNNIESERV_USEDNIETIMEOUTNIECONN_BROKENNIETOO_SMALLNIEINVALNIECONN_REFUSEDNIEPINGNIECONN_PENDINGNIEVERSIONNIENOFREEPORTNIEMYHOST_VERIFYNIESNC_FAILURENIEOPCODENIEQUE_FULLNIETOO_BIGNIEACCEPTNIEPASSEDNIENO_ANSWERNIECALLNIEROUT_HOST_UNKNOWNNIEROUT_SERV_UNKNOWNNIEROUT_CONN_REFUSEDNIEROUT_INTERNNIEROUT_PERM_DENIEDNIEROUT_CONN_BROKENNIEROUT_VERSIONNIEROUT_CANCELEDNIEROUT_SHUTDOWNNIEROUT_INFO_DENIEDNIEROUT_OVERFLOWNIEROUT_MODE_DENIEDNIEROUT_NOCLIENTNIEROUT_EXTERNNIEROUT_SNC_FAILURE???connectNiPConnect2NiPConnect; IPv4/IPv6IPv4NI_FREENI_INITIAL_LISNI_INITIAL_RILNI_INITIAL_CONNI_LISTENNI_RI_LISTENNI_CONN_WAITNI_CONNECTEDNI_ACCEPTEDNI_DG_CONNECTEDNI_DG_UNCONNECTED (IP only) (inc. UDS)TRUEFALSENI_PINGNI_PONG-BUFFERED TRACE SNCoffon (not supported by platform)incdec?not joinleaveupdateaddINVALIDSTREAMDATAGRAMIPv6LOCALSOL_SOCKETIPPROTO_IPIPPROTO_IPV6SI_IPPROTO_TCPSO_SNDBUFSO_RCVBUFSO_ERRORSO_REUSEADDRSO_REUSEPORTSO_KEEPALIVESO_LINGERIP_MULTICAST_IFIP_MULTICAST_TTLIP_MULTICAST_LOOPIP_ADD_MEMBERSHIPIP_DROP_MEMBERSHIPIPV6_MULTICAST_IFIPV6_MULTICAST_HOPSIPV6_MULTICAST_LOOPIPV6_JOIN_GROUPIPV6_LEAVE_GROUPTCP_NODELAY%s: unknown error %d IBnixxi.cppIB%s: NiInit failed (rc=%d) I%s: *ppHdl should be NULL I%s: nitab_free_hdl=NULL; niIsInitialized=%d IBM%s: no more free handles (%d)IB%s: no more free handles (%d) I%s: hdl %d state %s IBM%s: invalid type (%d)IB%s: invalid type (%d) IBM I%s: parameter invalid (pRefPw == NULL)I%s: parameter invalid (pRefPw == NULL) %s: parameter invalid (pUserPw == NULL)%s: parameter invalid (pUserPw == NULL) IBM%s: hdl %d removed from traffic control list IB%s: calling traffic control callback for hdl %d IBM%s: hdl %d must be removed from application remove handle form list IBM%s: invalid TC callback for hdl %d remove handle form list %s: invalid status of hdl %d - remove handle with NiTcDelHdl() %s: parameter invalid (pParam == NULL)I%s: parameter invalid (pParam == NULL) %s: invalid TC checktime '%d' I%s: invalid TC thresholds inOctets = '%lu', outOctets = '%lu' inMsgs = '%lu', outMsgs = '%lu' I%s: invalid TC callback IBM%s: parameter invalid (pHdl == NULL)IBM%s: parameter invalid (pHdl == NULL) IB%s: parameter invalid (pHdl->mType != NI_ACCEPTED)I%s: parameter invalid (pHdl->mType != NI_ACCEPTED) %s: %s hdl %d in traffic control list I%s: invalid family %dIB%s: invalid family %d for hdl %d/sock %d IB%dI; %dIBM; %sIBM%s: %s failed for hdl %d/sock %d (%s/%d; %s; %s%s%s%s) %s: %s failed for hdl %d / sock %d - sock %d (%s/%d%s%s%s) %s: %s failed (%s/%d%s%s%s) IBM%s: %sI0P=I; L=IBM; own high %d; max hds %dIB%s: no datagram sock %d (fam=%d; type=%d); hdl %d (state=0x%x) %s: invalid length (%d<>%d)%s: invalid length (%d<>%d) for hdl %d %s: parameter invalid (pClient == NULL)%s: parameter invalid (pClient == NULL) IBM%s: wakeup server %d already closed IBM%s: send wakeup signal to %d->%d (len=%d; sock %d) %s: send wakeup signal to %d->%d (sock %d) %s: removed hdl %d from traffic control list IB%s: return used friendly slot %d IB%s: no free slot found (max=%d) IBM%s: last free accept list entry in use (%d) IBM%s: called for hdl %d while waiting for connection %s: closing initial hdl %d %s: shutdown and close hdl %d/sock %d - sock %d IBM%s: shutdown and close pseudo listen hdl %d/sock %d IBM%s: shutdown and close hdl %d/sock %d I%s: remove '%s' failed for hdl %d II$I$I%%s: hdl %d closed in the meantime; race? (old rc=%d) IB%s: parameter invalid (ppClient == NULL)IBM%s: parameter invalid (ppClient == NULL) IB%s: parameter invalid (*ppClient == NULL)IB%s: parameter invalid (*ppClient == NULL) I%s: last wakeup client detached from %d IBM%s: wakeup client detached from %d (%d) IBM%s: state of hdl %d %s %s: NiISolveSockAddr failed (rc=%d) IBM%s: CPU byte order: little endian, reverse network, low val .. high val IBM%s: CPU byte order: big endian, network, high val..low val %s: CPU byte order: ???? (%d) I%s: socket does not support IPv6IBM%s: IPv6 address '%s' not supported by hdl %d with AF_INET sock %d (probably IPv6 not enabled (%s)) IBM%s: probably requested address 0.0.0.0 can't be assign to IPv6 socket (hdl %d/sock %d; NI_USE_IP_PROTO=%s) passed over poll/select timeout (%ds>=%dms+%ds) IBM%s: connection of hdl %d to %%s established IBM%s: connection of hdl %d to %%s still in progress (%d) %s: invalid state of hdl %d (%d) IB%s: hdl %d is connecting to %%s (timeout=%d) IB%s: connection of hdl %d to %%s in progress (timeout=0) IBM%s: port still in use after %d tries IB%s: connection of hdl %d established to %%s IBMUDS addr (%d)IB%s: SiSocket failed (sirc=%d; %s; %s; errno=%d: %s) IBM%s: socket number too high (%d)%s: socket number too high (%d>%d;%d;%d) IB%s: set default settings for %shdl %d/sock %d (%s; %s) *** WARNING => %s: connection from %%s has been already shut down (hdl %d) %s: invalid socket type (%d)IBM%s: invalid socket type for %shdl %d/sock %d (%d) I%s: NiIInitSocket failed (rc=%d) IB%s: NiIConnectSocket failed (rc=%d) IBM%s: NiIGetSockName failed (rc=%d) I%s: malloc failed for %d bytesI%s: malloc failed for %d bytes %s: NiIWakeupConnect failed (%d) IB%s: new wakeup client attached to %d->%d (%d) I%s: peek for hdl %d timed out (%c; %dms) IB%s: peek for hdl %d failed (%c; rc=%d) %c; %dI%s: peek successful for hdl %d (%c) IBM%s: hdl %d received %u bytes from %%s I%s: parameter invalid (pServer == NULL)%s: parameter invalid (pServer == NULL) IBM%s: parameter invalid (ppServer == NULL)IBM%s: parameter invalid (ppServer == NULL) IB%s: parameter invalid (*ppServer == NULL)IB%s: parameter invalid (*ppServer == NULL) I%s: delete wakup server %d %s: close wakup server %d I%s: not supported for RI hdl %d%s: not supported for RI hdl %d IBM%s-%sIB%s: set option %s-%s of hdl %d to %s IB%s: could not delete file '%s' for hdl %dIBunlinkI%s: could not delete file '%s' (hdl %d; errno=%d) I%s: port %u already used (errno=%d) ... IBM%s: no free port for hdl %d within min %d max %dIBM%s: no more free ports (hdl %d; [%d,%d]; last port: %d; %d: %s) IBM%s: Could not bind local domain socket, only listening on internet socket I%s: hdl %d bound to %%s%s I%s: invalid type (%d) of hdl %d%s: invalid type (%d) of hdl %d IBM%s: NiIBind failed (rc=%d) %s: parameter invalid (*ppServer != NULL)IB%s: parameter invalid (*ppServer != NULL) I%s: NiIWakeupBind failed (rc=%d) IBwakeup server %dIBM%s: new datagram wakeup server %d I%s: NiIMakeSockAddr failed (rc=%d) %s: %s %s on interface %s I%s: failed to %s %s on interface %s IBM%s: HS Buffer init failed (rc=%d) I%s: set blockmode for hdl %d %s IBM%s: leave blockmode for hdl %d %s I%s: invalid protocol %d (%d/%d)%s: invalid protocol %d (%d/%d) IBM%s: failed to bind UDS (rc=%d;loops=%d) IBM%s: NiIBlockMode failed (rc=%d) IBM%s: peer of hdl %d matches trace mask %s IB%s: unknown type of slot %d (type=%d) I%s: connection rejected (unknown peer %s; max=%d) I%s: connection rejected (friendly peer %s; max=%d) %s: connection rejected (suspicious peer %s; max=%d) IB%s: connection rejected (invader peer %s) I%s: poll looped %d times, caused by EAGAIN (limit=%d) I%s: poll(%p,%d,%d) caused EFAULT IB%s: peek for hdl %d timed out (%dms) IB%s: peek successful for hdl %d %s: invalid status (%d-%d-%d-%d) IB%s: invalid status (%d) IBM%s: invalid type %d%s: invalid type %d for hdl %d %s: hdl %d %s got EAGAIN after select socket successfully; call operating system-supplier I%s: NiIPeekListen failed (rc=%d) IB%s: hdl %d accepted already closed connection I%s: hdl %d accepted connection %s: ACL permission denied for %s (rc=%d) IB%s: hdl %d accepted hdl %d from %%s IBM%s: hdl %d took local address %%s I%s: SiGetSockName failed (sirc=%d) %s: initialization of specialized type failed (rc=%d) I%s: blocked connection to %s (SAP_CONNECT_RESTRICTION) %s%c%dI%s: UDS connect onlyIBM%s: force UDS connect to '%s' failed (%d; %d) I%s: hdl %d tries to connect to '%s' over interface '%s' IBM%s: getHostName failed (rc=%d) --- verify own hostname '%s' --> IB%s: getNodeAddr failed ('%s'; rc=%d) IB%s: NiIListen failed ('%s'; %s; rc=%d) <-- verify own hostname o.k. --- IB%s: NiIConnect failed ('%s'; %s%c%d; %dms; rc=%d) I%s: NiIAccept failed ('%s'; %s%c%d; %dms; rc=%d) IB%s: parameter invalid (pNodeAddr == NULL)IB%s: parameter invalid (pNodeAddr == NULL) I%s: address %s is %slocal I%s: new mask %016lx IBM%s: parameter invalid (pParamData == NULL)I%s: parameter invalid (pParamData == NULL) %s: parameter invalid (pParamData->datatype != NI_DT_BOOL)I%s: parameter invalid (pParamData->datatype != NI_DT_BOOL) %s: switch NIP_PORTRANGE %s IBM%s: parameter invalid (pParamData->datatype != NI_DT_USHORT)IBM%s: parameter invalid (pParamData->datatype != NI_DT_USHORT) IB%s: set NIP_MAXPORT %d %s: set NIP_MINPORT %d %s: parameter invalid (pParamData->datatype != NI_DT_RAW)IB%s: parameter invalid (pParamData->datatype != NI_DT_RAW) I%s: opcode %d unknownIB%s: opcode %d unknown I %s IBM%s: dump failed (rc=%d) IBM%s: parameter invalid (pParamData->datatype != NI_DT_UINT)I%s: parameter invalid (pParamData->datatype != NI_DT_UINT) %s: param %dIBM%s: switch NIP_FRAGTEST off IBM%s: switch NIP_FRAGTEST to %d I%s: switch NIP_CONNLOCAL %s%s I%s: parameter invalid (pParamData->datatype != NI_DT_UCPTR)%s: parameter invalid (pParamData->datatype != NI_DT_UCPTR) IBM%s: parameter invalid (pParamData->value.ucptr_val == NULL)%s: parameter invalid (pParamData->value.ucptr_val == NULL) IBM%s: path too long for param NIP_UDS_PATH (%d>=%d)IB%s: path too long for param NIP_UDS_PATH (%d>=%d) '%s' %s: Set UDS path to %s %s: set NIP_QUEUE_LEN to %d IBM%s: switch NIP_QTEST off IB%s: illegal value (%d, %d) ~ %d for NIP_QTEST I%s: set NIP_QTEST to (%d, %d) ~ %d %s: parameter invalid (pParamData->datatype != NI_DT_NODEADDR)I%s: parameter invalid (pParamData->datatype != NI_DT_NODEADDR) %s: Set NIP_LOCAL_ADDR to %s IB%s: parameter invalid (pParamData->datatype != NI_DT_VOIDPTR)IB%s: parameter invalid (pParamData->datatype != NI_DT_VOIDPTR) I%s: switch NIP_TRACE_ALL %s IBM%s: switch NIP_INC_SERV_NO to %s IB%s: switch NIP_CONT_IN_RANDE %s IBM%s: switch poll/select trace off IB%s: switch poll/select trace to %d %s: set NI hostbuffer timeout %d IB%s: set NI hostbuffer timeout for invalid entries %d IB%s: set NIP_SOCK_BUFFER_SIZE %u IBM%s: param %d unknownIBM%s: param %d unknown IB%s: free nitab %p ISAP_IPv6_ACTIVE%s: invalid value '%s' for SAP_IPv6_ACTIVE [0,1] IBNI_USEIPv6I%s: NI-chain destroyed %s: NI already initialized (%p) IBM%s: malloc failed for %d bytes (%d) IBM%s: allocated nitab (%d at %p) NITAB_FREEI%s: FtInit failed (rc=%d)IB%s: FtInit failed (rc=%d) ISAP_CONNECT_RESTRICTION%s: restrict connect to local addresses IBM%s: invalid value '%s' for SAP_CONNECT_RESTRICTION %s: failed to read local adresses (rc=%d) I%s: found more than %d (%d) local address I%s: no IPv6 address configured, IPv6 will not be initialized IB%s: no IPv6 localhost address '::1' configured, IPv6 will not be initialized IB%s: host/serv bufs already initialized %s: NiLHInit failed (rc=%d) IBM%s: localhost structures already initialized IB%s: FD_SETSIZE (%d) < NI_FD_SETSIZE (%d) IB/tmp/.sapstream%dIB%s: failed to create host/serv bufs (rc=%d) IBM/tmp/.sapstream%%d, %dI%s %s %sIBM%s %sIB HANDLE = %-5d TIME = %sSOCKET = %s STAT = %s TYPE = %s OUT = %lu messages %lu bytes IN = %lu messages %lu bytes LOCAL = %s %s REMOTE = %s OPTIONS = %s%s%s IBhdl %d: %s NiITstWalkI%s: parameter invalid (ppPeerAddrList == NULL)I%s: parameter invalid (ppPeerAddrList == NULL) %s: parameter invalid (ppEntryTypeList == NULL)%s: parameter invalid (ppEntryTypeList == NULL) IBM%s: parameter invalid (pListSize == NULL)IB%s: parameter invalid (pListSize == NULL) I%s: accept list not initialized%s: accept list not initialized IBM%s: parameter invalid (pPeerAddr == NULL)IB%s: parameter invalid (pPeerAddr == NULL) I%s: parameter invalid (NiILocalCheck(pPeerAddr, &tf) == TRUE)IB%s: parameter invalid (NiILocalCheck(pPeerAddr, &tf) == TRUE) I%s: parameter invalid (newEntryType != NI_AL_TYPE_FRIENDLY && newEntryType != NI_AL_TYPE_SUSPICIOUS && newEntryType != NI_AL_TYPE_INVADER)I%s: parameter invalid (newEntryType != NI_AL_TYPE_FRIENDLY && newEntryType != NI_AL_TYPE_SUSPICIOUS && newEntryType != NI_AL_TYPE_INVADER) %s: parameter invalid (pHdl->mType == NI_LISTEN)IBM%s: parameter invalid (pHdl->mType == NI_LISTEN) IB%s: invalid hdl %dI%s: invalid hdl %d %s: parameter invalid (pHdl->mType == NI_RI_LISTEN)%s: parameter invalid (pHdl->mType == NI_RI_LISTEN) IBM%s: accept list already initialized%s: accept list already initialized IBM%s: parameter invalid (addrListSize < 10)IB%s: parameter invalid (addrListSize < 10) I%s: parameter invalid (maxUnknownConns < 1)%s: parameter invalid (maxUnknownConns < 1) IBM%s: parameter invalid (maxFriendlyConns < 1)IBM%s: parameter invalid (maxFriendlyConns < 1) IB%s: parameter invalid (maxSuspiciousConns < 1)I%s: parameter invalid (maxSuspiciousConns < 1) %s: parameter invalid (maxSuspiciousConns > maxUnknownConns)IBM%s: parameter invalid (maxSuspiciousConns > maxUnknownConns) IB%s: parameter invalid (maxUnknownConns > maxFriendlyConns)I%s: parameter invalid (maxUnknownConns > maxFriendlyConns) %s: accept list initialized (size=%d; max conns: %d/%d/%d) %s: parameter invalid (pPeerAddrList == NULL)IB%s: parameter invalid (pPeerAddrList == NULL) I%s: parameter invalid (pPeerAddrMaskList == NULL)IB%s: parameter invalid (pPeerAddrMaskList == NULL) I%s: parameter invalid (pFound == NULL)I%s: parameter invalid (pFound == NULL) %s removed %s: no occupied slotsIB%s: no occupied slots I%s: remove address(es) %s I%s: no more free slots (%d)%s: no more free slots (%d) IBM%s: new address %s %s: hdl %d/sock %d connection has been closed by remote peer %%s IB%s: hdl %d/sock %d ok, data pending (len=%d) IB%s: hdl %d/sock %d connection %%s has pending error (%d: %s) IB%s: hdl %d/sock %d connection %%s has been closed (%d: %s) %s: hdl %d/sock %d ok, no data pending %s: MSG_PEEK not supported. Can't get socket status IBM%s: hdl %d in illegal status %d%s: hdl %d in illegal status %d IBM%s: mixed usage of hdl %d with NiCheck()IBM%s: mixed usage of hdl %d with NiCheck() IB%s: reset hdl %d from status NI_CHECKINT IBIBM%s: invalid mode %d for hdl %dI%s: invalid mode %d for hdl %d %s: data not equal with pending data length (%d<>%d)IBM%s: dataLen <> mPendDataLenToWrite (hdl %d;%d<>%d;%d) I%s: fragmentation %d-%d -> %d-%d (%d) I%s: qtest_count = %d, qtest_prop = %d, blocked_count = %d IBF%s: hdl %d sent incomplete hdr (wrt=%d,pnd=%d,pac=%d) I%s: hdl %d sent incomplete data (wrt=%d,pnd=%d,pac=%d) %s: more data written as passed (hdl %d)IBM%s: more data written as passed (%d>%d;hdl %d) A DzF@GP%s: hdl %d %s got EAGAIN after select socket successfully; call operating system-supplier (count=%u) IB%s: hdl %d %s would block (errno=EAGAIN) IB%s: hdl %d %s failed (errno=%d; hdlLen=%d; dataLen=%d; %s; %s; %s%c%d) %s: reduce data length (hdlLen=%d; dataLen=%d) %s: MTU size reached (%d+%d<=%d;hdl %d)%s: MTU size reached (%d+%d<=%d) for hdl %d; flag connection as broken %s: hdl %d %s WSASend / WSAGetLastError = 0 (count=%u) %s: hdl %d sent data (wrt=%d,pac=%d,%s) IBM%s: return NIETIMEOUT due to NIP_QTEST %s: return NIETIMEOUT due to fragmentation test IBM%s: hdl %d sent incomplete hdr (wrt=%d,pnd=%d) %s: hdl %d sent incomplete data (wrt=%d,pnd=%d,pac=%d,%s,%dms) %s: NiBufIWriteUserMsg failed (rc=%d) I%s: hdl %d sent %s to partner I%s: send incomplete (%d) IB%s: NiIWrite failed (rc=%d) IBMIBM%s: hdl %d sent NI_PING to partner %s: no answer since last NiCheck2 call %s: number of pending messages: %d %s: called while waiting for connection for hdl %d %s: invalid howTo %dIBM%s: invalid howTo %d for hdl %d IBM%s: hdl %d not connected anymore (socket %d; howTo=%d; sirc=%d; errno=%d) I%s: shutdown %c%c of hdl %d IBMpfd at %p: index %d: sock %d, events = %d revents = %d (IBPOLLIN POLLOUT IBMPOLLHUP IBMPOLLERR IBM... IB%s: timeout NI_BLOCK IB%s: timeout %dms IB%s: TIMEOUT occured (%d ms) IBM%s: maximum fd=%d I%s: fds in read-mask: I%d IB%s: read-mask is NULL I%s: fds in write-mask: %s: write-mask is NULL %s: TIMEOUT occured (%dms) %s: buffer length 0%s: RAW_MODE read with buffer length 0 (hdl %d) IBM%s: hdl %d received fragmented hdr (rcd=%d,pac=%d,len=%d) I%s: invalid data (0x%x); probably RAW_IOIBM%s: invalid data (0x%x;mode=%d;hdl %d;peer=%s;local=%d) IBM%s: hdl %d received incomplete data (rcd=%d,pnd=%d,pac=%d) %s: hdl %d receive reached bufferLen (rcd=%d,pnd=%d,pac=%d) IBM%s: hdl %d buffer too small (%d<%d)%s: hdl %d received incomplete hdr (rcd=%d,pnd=%d,pac=%d) I%s: more data received as buffer length (%d>%d+%d)I%s: more data received as buffer length (%d>%d+%d;hdl %d) I%s: recv(%d,%p,%d,0) caused EFAULT %s: hdl %d received data (rcd=%d,pac=%d,%s) IBM%s: hdl %d received incomplete hdr (rcd=%d,pnd=%d) %s: read for hdl %d timed out (%dms) IB%s: hdl %d received incomplete data (rcd=%d,pnd=%d,pac=%d,%s,%dms) %s: raw read for hdl %d timed out (%dms) IBM IB*ERR*1 * ERRORLOCATIONTIMERELEASECOMPONENTVERSIONRCMODULELINEDETAILSYSTEM CALLERRNOERRNO TEXTCOUNTERDESCR MSG NODESCR VARGSDETAIL MSG NODETAIL VARGS;;;;errmsgI(%d) - illegal errnoIBM(%d) - error text too longIERR_MSG_FILEIrErrGetTxt: can't open file %s (%d %s) I722ErrMergeTxt: no vargs for &%c IErrMergeTxt: no vargs IErrIGet: no SAP error info available IBerr.cIBErrIGet: bad length (%d) IBErrIGet: eyecatcher destroyedIBbad err infoIBMErrIGet: error info incomplete (%d fields only)ErrIGet: no text found (msg %s lang %c) IBM%s%-12.12s%.*s %s %s IB%s%-12.12s%s IB %-12.12sIBErrSetLength: bad parameter len (%u)IBMIBM ErrCpNetToInt2: internal area too small (%d<%d)\\IBErrCpNetToInt: bad err info (eyecatcher destroyed)IErrCpNetToInt: error info incomplete (%d fields only)IBErrCpFrom: user error area too small (%d bytes)ErrReplace: no error info available IBM%dIErrReplace: error info too largeIBMErrCpTo: bad err info (eyecatcher destroyed)IBMErrCpTo: error info too large (%d bytes)IBMErrTrace: no error info available I ***************************************************************************** * IB%sI* %s%-12.12s%s * I***************************************************************************** ErrGetFld: no error info available error in localtimeIErrISetSys: error info too largeIBM%s %-12.12s%s ***LOG Q0I=> %s: %s IBM(%d: %s) IB[%s %d] IBMQ0I%14.14s%3dIBM Ierror in localti::::%pI%p IBM%6.6d xx xxI%02.2x %02.2xI IAdresse Offset %s IB------------------------------------------------------------------------ IB%sIBM IXXXXXXXXIBMSiInitSiPeekSiPeekPendConnSiGetMaxSocketsSiSendSocketSiRecvSocketSiTracePlatformInfo-(none)sigaction, sigactionsocketclosebindlistenacceptconnectsendwritevsendtosendmsgrecvreadvrecvfromrecvmsgioctlshutdowngetsocknamegetpeernamegetsockoptsetsockoptfcntlfcntl, fcntlselectpollpoll, getsockoptrecvmsg, recv, closeIBMComponent name : SI (socket interface) IVersion : %d Last modification : Sep 20 2004 I Platform : IBM RS/6000 with AIX IB %d bit big endian IPv6 : %s supportedIBFD_SETSIZE : %d NFDBITS : %d sizeof(fd_mask) : %d sizeof(fd_set) : %d siux.cppIBM%s: invalid received data length (%d<>%u) I%s: no valid message received I%s: no valid descriptor received IB%s: longer socket info received (version %u) IB%s: failed to allocate SI_RAW[%u] I%s: SiRecv failed (rc=%d) I%s: invalid socket info received (%u<>%u) I%s: received sock %d (%s, %s) IBM I%s: invalid sent data length (%d<>%u) I%s: sysconf(_SC_OPEN_MAX) failed; use iteration IBM%s: malloc failed for %d bytes (%d) IBMprotocol family not supportedIBprotocol level or option not supportedIunexpected value retured from system call, which cause invalid internal statusI%s: poll looped %d times, caused by EAGAIN (limit=%d) I%s: SiPoll failed for sock %d (%d-%s) I%s: SiPoll timed out for sock %d (%dms) IBM%s: SiGetSockOpt failed for sock %d(%d-%s) %s: connection of sock %d broken (%d-%s) IB%s: connection of sock %d established I%s: hang up occurred in sock %d IBM%s: an error occurred in sock %d IBSI_OKSI_EINVALSI_EINVAL_SOCKSI_EINVAL_FAMISI_EINVAL_OPTSI_EINTRSI_ESYSCALLSI_EADDR_NAVAILSI_EPORT_INUSESI_ECONN_REFUSESI_ECONN_INPROGSI_ECONN_BROKENSI_ETIMEOUTSI_EINTERNSI_EMFILESI_ENOTIMPLSI_EMEMORYsuccessinvalid parameter passedinvalid socket descriptor, socket probably already closedprotocol family not supportedprotocol level or option not supportedcall was interrupted by a signalsocket function call failed, lastError value is set in SI_SOCK structureaddress not availableservive in useno one listening on the remote addressconnection is in progressconnection to partner brokenserver may be too busyunexpected (invalid) statusmaximum for file descriptors reachedplatform does not support a implementationunable to allocate sufficient memoryAF_UNIXAF_INETAF_INET6SOCK_STREAMSOCK_DGRAMSOCK_RAW(none)SiInitSiExitSiSocketSiSocketIPv4SiSocketIPv6SiSocketUDSSiCloseSiBindSiBind2SiListenSiAcceptSiAccept2SiConnectSiConnect2SiSendSiSendVSiSendToSiSendTo2SiSendMsgSiSendMsg2SiRecvSiRecvVSiRecvFromSiRecvFrom2SiRecvMsgSiRecvMsg2SiGetPendDataLenSiShutdownSiGetSockNameSiGetSockName2SiGetPeerNameSiGetPeerName2SiGetSockOptSiGetSockOpt2SiSetSockOptSiSetSockOpt2SiGetBlockModeSiSetBlockModeSiGetCloseExecSiSetCloseExecSiSelectSiPollSiPeekSiPeekPendConnSiSendSocketSiRecvSocketIBMsixx.cppIBMError: sock %d; error %d (%s) denypermitNiAcl::appendRuleNiAcl::dumpNiAcl::checkAddressNiIAclAppendRuleNiIAclParseStringNiIAclReadFileNiIAclCreateNiIAclDeleteNiIAclDumpNiIAclFlushNiIAclCheckAddrNiIAclGetStatusNiAclCreateNiAclDeleteNiAclDumpNiAclFlushNiAclCheckAddrNiAclGetStatusno rule matchedempty ACLIBnixxacl.cpp%s: parameter invalid (pHdl == NULL)IBM%s: parameter invalid (pHdl == NULL) IB%s: parameter invalid (pHdl->mType != NI_LISTEN)IBM%s: parameter invalid (pHdl->mType != NI_LISTEN) IB%s: parameter invalid (pHdl->lis.mAcl == NULL)I%s: parameter invalid (pHdl->lis.mAcl == NULL) %s: invalid hdl %dI%s: invalid hdl %d %s: %s -> %s (%s, count=%d) IBM%s: %s -> %s %s (count=%d,rule=%d,line=%d) %s: parameter invalid (pNodeAddr == NULL)IB%s: parameter invalid (pNodeAddr == NULL) I%s %d: %s %s (count=%d,line %d) IB< truncated > I%s: dump to buffer truncated at line %d IBM%s: parameter invalid ((*ppTF == NULL && (pBuffer == NULL || len == 0)))IBM%s: parameter invalid ((*ppTF == NULL && (pBuffer == NULL || len == 0))) IB%s: ACL overflow, rule = %d, max size = %d %s: parameter invalid (pLine == NULL)IB%s: parameter invalid (pLine == NULL) I%s: parse ACL line '%s' IBM%s: skip comment line '%s' %s: remove comment '%s' IBM%s: skip empty line '%s' IB I%s: missing token '%s|%s' in '%s' line %d. %s: missing token 'addr/mask' in '%s' line %d. %s: invalid address/mask '%s' in line %d. %s: read permission '%s', address '%s' %dI%s: invald tracelevel '%s' (min=1, max=3) in '%s' line %d. %s: read tracelevel '%d' IB%s: unexpected permission '%s' in line %d. %s: empty ACL applied to hdl %d IBM%s: incomplete ACL (rules=%d) applied to hdl %d IBM%s: parameter invalid (pFileName == NULL)IB%s: parameter invalid (pFileName == NULL) IrbI%s: could not open ACL file '%s'. I%s: out of memory, malloc(%ld) failed I%s: error reading file '%s' errno=%d (%ld %ld) %s: found active ACL IB%s: status=ok -> keep active ACL for fallback I%s: status!=ok -> we do not have a 'last known good' IB%s: out of memory: malloc(%ld) failed I%s: can not load new ACL, keeping 'last known good' IBM%s: parameter invalid (pAclString != NULL && pAclFile != NULL)I%s: parameter invalid (pAclString != NULL && pAclFile != NULL) %s: parameter invalid (pAclString == NULL && pAclFile == NULL)I%s: parameter invalid (pAclString == NULL && pAclFile == NULL) NiIRiCliGetHdlNiIRiCliAcceptNiIRiCliConnectNiIRiSrvPeekNiIRiSrvAcceptNiIRiSrvCloseHandleNiIRiSrvProcEventIBnixxri.cppI%s: reverse invoke (RI) inactive IB%s: reverse invoke (RI) inactive-~STAT_SLOT_FREESTAT_UNKNOWN_ADDRSTAT_UNKNOWN_NAMESTAT_VALID_ADDRSTAT_VALID_NAMENiHsetHostBufTimeoutNiHgetHostBufTimeoutNiIHSBufInitNiIHSBufInit2NiIGetNodeAddrNiIGetHostNameNiIGetServNoNiIGetServNameNiISetHSBufIndexSizeNiIGetHSBufIndexSizeNiISetHBufTimeoutNiIGetHBufTimeoutNiISetHBufEntryNiISetHostInvalidNiISetHSBufTraceLimitNiIGetHSBufTraceLimitNiISetHSBufTimeFuncNiIGetHSBufTimeFuncNiIHSBufFlushNiHBufPrintBufNiHSBufGetAll(null)IPv6IPv4 (fq)--------------------------------------------- # status t address IPv4 hostname --------------------------------------------- --------------------------------------------------------------------- # status t address IPv4/IPv6 hostname --------------------------------------------------------------------- nixxhs.cppI%s: parameter invalid (ppData == NULL)I%s: parameter invalid (ppData == NULL) %s: parameter invalid (*ppData != NULL)%s: parameter invalid (*ppData != NULL) IBM%s: parameter invalid (pDataLen == NULL)IBM%s: parameter invalid (pDataLen == NULL) IB%s: not initialized%s: not initialized IBM%s: malloc failed for %d bytesI%s: malloc failed for %d bytes (%d) IBM* I%s: buffer too smallIBM%s: sprintf failed (%d;%d) %s: NiPGetPid failed (rc=%d) IB* %d IB* %sIBM%s: dumpServLine failed (rc=%d; %d) IBM%s: dumpHostLine failed (rc=%d; %d) IBM%s: parameter invalid (pBuffer == NULL)%s: parameter invalid (pBuffer == NULL) IBM%s: parameter invalid (pBufferLen == NULL)I%s: parameter invalid (pBufferLen == NULL) %s: parameter invalid (pDone == NULL)IB%s: parameter invalid (pDone == NULL) I%s: parameter invalid (*pBufferLen < 0)%s: parameter invalid (*pBufferLen < 0) IBM --------------------------------------- # status port service --------------------------------------- IB%s: get timeout (%s) = '%d' IBMvalid entryunknown nameIBMunknown address%s: set timeout (%s) = '%d' (prev = '%d') I%s: already initialized%s: initialize hostname buffer (IPv4/IPv6) %s: initialize hostname buffer (IPv4) I%s: malloc failed for %s buffer implementationI%s: malloc failed for %s buffer implementation %s: malloc failed for service buffer implementation%s: malloc failed for service buffer implementation IBMSAP_NI_CACHE_DISABLEDIB%s: SAP_NI_CACHE_DISABLED=1 IBM%s: NiIHSBufInit failed (rc=%d) IBM%dI%s: port %s = servicename '%s' %s: servicename '%s' = port %s %s: buffer too small (%d<%d)IBM%s: buffer too small for '%s' (%d<%d) I%s: addr NULL = hostname '%s'%s IBM%s: addr %s = hostname '%s'%s I%s: default loopback address is IPv6 (%s) I%s: default loopback address is IPv4 (%s) I%s: hostname 'NULL' = addr %s I%s: invalid IPv4 address passed (%s)IBM%s: invalid IPv4 address passed (%s) IB%s: invalid IPv6 address passed (%s)IBM%s: invalid IPv6 address passed (%s) IB%s: invalid address passed (%s) IPv6 not active%s: invalid address passed (%s) IPv6 not active IBM%s: only IPv4 addresses availableIB%s: only IPv6 addresses availableIB%s: hostname '%s' = addr %s IBMSN='%s'; Ali[%u]='%s'I; Ali=(null)IBM; Port=%sIB; PC=%s NiSrvLInitNiSrvLGetServNoNiSrvLGetServNameNiSrvLSetIndexSizeNiSrvLFlushNiSrvLDumpBufLinesucceededfailedVALIDUNKNOWN%dI%-4d%-7s %-11s %s%cnixxsl.cppI%s: buffer too smallIBM%s: buffer too small (%d<%d;%d) IBM%d%c%s%c%s%c%s%cIBM%s: service cache flushed I%s: deallocate failed (rc=%d) I%s: init failed (rc=%d) IBM%s: to get %s %s in %dms (tl=%dms%s%s) IBM%s: got port %s from operating system I%s: port %s not found by operating system I%s: service name too long for buffer (%d>=%d) I%s: servbuf overflow IB%s: buffer too small (%d<=%d)IB%s: buffer too small (%d<=%d) I%s: found port number %s in cache I%s: retrying to get service name for '%s' I%s: service name '%s' too long for buffer (%d>=%d) %s: service name too long for bufferIBM%s: service name not cached%s: to get '%s' %s in %dms (tl=%dms%s%s) IB%s: got service name '%s' from operating system IBM%s: service name '%s' not found by operating system IBM%s: found service name '%s' in cache IB%s: retrying to get port number for '%s' IB%s: service name cached as unknownI%s: already initialized%s: already initialized) IB%s: disable serv bufs I%s: malloc failed for %d bytesI%s: malloc failed for %d bytes (%d) IBM%s: alloc serv bufs (%d entries) NiPGetNodeAddrListNiPGetMacAddrListNiPMyHostNameNiPGetHostByNameNiPGetHostByAddrNiPGetServByNameNiPGetServByPort UP DOWNIBniuxi.c%s: SiSocketIPv4 failed (sirc=%d)IB%s: SiSocketIPv4 failed (sirc=%d;%d-%s) IBM%s: ioctl failed (%d)IB%s: ioctl failed IB%s: malloc failed for %d bytesI%s: malloc failed for %d bytes %s: ioctl failed for '%s' (%d: %s) %s: got %d interface(s) from operating system Ireturning only the first %d IBM [%2d-%-8s] IPv%c-Address: %s%s IB%s: '%s' not foundI%dIgetnameinfoNiPGetServByPort: name '%s' too long (%d>=%d) I%s: servname of %s is '%s' addrinfo of '%s': I%d: %s%c%d '%s' IB IBRAW IBMDGRAM ISTREAM (%d-%d-%d-%d-%d) IBgetaddrinfo%s: result for '%s' is NULL%s: result for '%s' is NULL IBM%s: invalid family %dIB%s: invalid family %d INiPGetHostByAddr: name '%s' too long (%d>=%d) I%s: addrname of %s is '%s' gethostname%s: gethostnameU failed IBM%s: getkerninfo failed (%d)%s: getkerninfo failed (%d) IBM%s: malloc failed for %d bytes IBM%s: getkerninfo failedI%s: getkerninfo failed IBM FiXG%s: '%s'/'%s': len=%d; type=%d %02x:%02x:%02x:%02x:%02x:%02x NiHL6InitNiHL6GetNodeAddrNiHL6OSLookupNameToAddrNiHL6GetHostNameNiHL6CacheLookupAddrToNameNiHL6CacheLookupNameToAddrNiHL6AddAddressNiHL6CacheAddNameNiHL6SetIndexSizeNiHL6SetHostEntryNiHL6SetHostInvalidNiHL6FlushNiHL6DumpBufLineNiHL6addPolicyRuleNiHL6InitPolicyIPv4IPv6succeededfailedvalid-namevalid-addressunknown-nameunknown-address-VALIDUNKNOWNnixxhl6.cpp%s: policy rule '%s' too long for buffer (%d>%d) ,/IB%d%c%s%c%c%c%s%c%s%c%s%cIBM%-4d%-7.7s %c %-39.39s %s%c%s: buffer too smallIBM%s: buffer too small (%d<%d;%d) IBM%s: cache flushed I%s: hostname '%s' too long for buffer (%d>=%d) %s: remove hostname '%s' (index=%d) from cache %s: hostname not cached%s: address invalid '%s' IB%s: Entrytype invalid '%d' %s: updating hostname '%s' in cache IBM%s: updating address '%s' in cache %s: set timestamp to '%d' (time=%d) IBM%s: set address to '%s' IBM%s: set hostname to '%s' IB%s: set EntryType to '%d = %s' %s: deallocate failed (rc=%d) I%s: init failed (rc=%d) IBM%s: invalid type(%d) IB%s: address %s not found in cache I%s: found address %s in cache I%s: buffer too small (%d<=%d)IB%s: buffer too small (%d<=%d) I%s: address cached as unknownIB%s: to get %s %s in %dms (tl=%dms%s%s) IBM%s: address '%s' resolved to hostname '%s' from operating system IB%s: NiPGetHostByAddr failed (rc=%d) IBM%s: address %s not found by operating system IB%s: invalid type(%s, %d) IB%s: to get '%s' %s in %dms (tl=%dms%s%s) IB%s: more than %d addresses found (%d) I%s: applying 'preference policy' IB%s: 'policy table' does not match I%s: hostname '%s' (for protocol '%s') not found by operating system IBM%s: hostname '%s' not found by operating system IBM%s: hostname '%s' not found in cache IB%s: found hostname '%s' in cache (%s, %s) Ihostname emptyI%s: hostname too long for bufferIBM%s: protocol %s selected, setting lookup mode to NOBUF %s: hostname '%s' resolved to address '%s' from operating system IBNI_ADDR_POLICYI%s: NI_ADDR_POLICY '%s' to large (%d>=%d) I;IB%s: NI_ADDR_POLICY table overflow (%d>=%d) %s: already initialized%s: already initialized) IB%s: disable host buf IB%s: malloc failed for %d bytesI%s: malloc failed for %d bytes (%d) IBM%s: alloc host buf (%d entries) NiHLInitNiHLGetNodeAddrNiHLGetHostNameNiHLSetIndexSizeNiHLsetHostEntryNiHLsetHostInvalidNiHLFlushNiHLDumpBufLinesucceededfailedVALIDUNKNOWN%-4d%-7.7s %c %-15.15s %s%cnixxhl.cppI%s: buffer too smallIBM%s: buffer too small (%d<%d;%d) IBM%d%c%s%c%c%c%s%c%s%c%s%cIBM%s: cache flushed I%s: hostname '%s' too long for buffer (%d>=%d) %s: hostname not cached%s: found (resetting) hostname '%s' in cache IB%s: address invalid '%s' IB%s: Entrytype invalid '%d' %s: implementation doesn't support IPv6 IBM%s: found (replacing) hostname '%s' in cache IB%s: found (replacing) address '%s' in cache IBM%s: set timestamp to '%d' (time=%d) IBM%s: set address to '%s' IBM%s: set hostname to '%s' IB%s: set EntryType to '%d = %s' %s: deallocate failed (rc=%d) I%s: init failed (rc=%d) IBM%s: to get %s %s in %dms (tl=%dms%s%s) IBM%s: got address %s from operating system IB%s: NiPGetHostByAddr failed (rc=%d) IBM%s: address %s not found by operating system IB%s: hostbuf overflow IB%s: buffer too small (%d<=%d)IB%s: buffer too small (%d<=%d) I%s: found address %s in cache I%s: retrying to get hostname for '%s' Ihostname emptyI%s: hostname too long for bufferIBM%s: to get '%s' %s in %dms (tl=%dms%s%s) IB%s: more than %d interfaces found (%d) %s: got hostname '%s' from operating system IBM%s: NiPGetHostByName failed (rc=%d) IBM%s: hostname '%s' not found by operating system IBM%s: found hostname '%s' in cache IB%s: retrying to get address for '%s' IB%s: hostname cached as unknownI%s: already initialized%s: already initialized) IB%s: disable host buf IB%s: malloc failed for %d bytesI%s: malloc failed for %d bytes (%d) IBM%s: alloc host buf (%d entries) NiBufAlloc2NiBufFreeNiBufFree2NiBufWrapNiBufUnWrapNiBufGetPtrNiBufDupNiBufISetExtFuncNiBufISetExtFunc2NiBufIHdlInitNiBufICloseNiBufISendErrNiBufISendMsgNiBufIProcMsgNiBufISetParamNiBufIWriteUserMsgNiBufSendNiBufReceiveNiBufISetHSNiBufIConnectNiBufCheckPendingConnNiBufISelUpdateNiBufISelSetNiBufISelClearNiBufISelRemoveNiBufISelGetModeNiBufISelGetStatNiBufISelProcessNiBufSendHandleNiBufGetSentHdlNiBufIHostToRouteNiBufIRouteToTableNiBufIRouteGetNextNiBufIAllocNiBufIGetBufHdlNiBufISetStatusNiBufISetErrorNiBufICheckErrorNiBufIAddToUserQueueNiBufISendMsg2NiBufISendSocketNiBufISetHdlParamNiBufIInNiBufIPrivWriteNiBufIFinishHandshakeNiBufIEmptyOutQueueNiBufIWriteNiBufITryToReadNiBufIReadNiBufIAddRouteEntryNiBufICallAllocNiBufICopyToNiBufIStatusTextNiBufIDumpOutQueueNiBufIRemoveFromUserQueueNiBufIAcceptSentHdlSNCUDI4I6??STDGNI_ROUTE3299(unspecified)NI_RTERR (saved)OFFOKCONN_WAITERRACCEPTINGSENDING??? (inc. UDS)nibuf.cppIB%s: parameter invalid (ppBuffer == NULL)IBM%s: parameter invalid (ppBuffer == NULL) IB%s: ref %d for buf %p I%s: clear extension for hdl %d %s: called while buffer filled %c%c IBM%s: mUserQueueLen=%d after freeing queue IB%s: freed out-queue (hdl %d, heap %u) Ivvvvvvvv%s: invalid route receivedI%s: invalid route received (%d;%d) %s: invalid route received (%d;%d;%d) I%s: invalid route received (%d;%d;%d;%d) IB%s: invalid route received (%d;%d;%d;%d;%d) IBM IBM*%s result from total %d entries: IB%-20s/%-*s hostnameIBMservice%-20s/%-*sI< next IB%s: NiBufIRouteGetNext failed (rc=%d) I%s: parameter invalid (*ppBufHdl == NULL)IB%s: parameter invalid (*ppBufHdl == NULL) I%s: new MODE %c%c (%c%c) for hdl %d in set%s IB%s: new STAT %c%c%c (%c%c%c) for hdl %d in set%s IB%s: getSocketPos failed for hdl %d (rc=%d)I%s: getSocketPos failed (sirc=%d;hdl %d) IB%s: init for hdl %d IBM%s: called with filled extensionIBM%s: called with filled extension (%p;%p) IB%s: malloc failed for %d bytesI%s: malloc failed for %d bytes (hdl %d %s: unknown status %d I%s: hdl %d changed from %s to %s IB %s: mpOutQueue for hdl %d %c%p (%d)IB>%p (%d) IBmpNextUser %p: prev %p, next %p IBMmUserQueueLen %d<>%d IB, prev %p, break loop I%s: retured buffer too small (%d<%d)IBM%s: allocfunc returned small buffer (%d<%d;hdl %d;peer=%s;local=%d) IBM%s: Adjusting data in NIBUF len=%d NIBUFIB%s: save data in NIBUF len=%d I%s: put buffer %p in ready-queue for hdl %d IBM%s: NiBufISelUpdate failed (rc=%d) %s: free user-queue (hdl %d, heap now %d) I%s: internal status error I%s: reduced user-queue (hdl %d, %d packets, heap now %d) IB%s: no more packets in user- or ready-queue? IB%s: ready-queue could not be freed (hdl %d) IBM%s: hdl %d in fragment read IBMhandshake for hdl %d = %d I%s: invalid status for hdl %dIB%s: ErrGetAttr failed (rc=%d)IB%s: ErrGetAttr failed (rc=%d) for hdl %d IB%s: malloc failed for %d bytes (hdl %d) IBM%s: invalid talkmode of hdl %dI%s: invalid talkmode of hdl %d %s: send for hdl %d failed (rc=%d) %s: local hdl %dIBM%s: send opCode %d to hdl %d (dataLen=%d) I%s: parameter invalid (pParamData->datatype != NI_DT_RAW)IB%s: parameter invalid (pParamData->datatype != NI_DT_RAW) I%s: parameter invalid (pParamData->value.raw_val != NI_MESG_IO && pParamData->value.raw_val != NI_ROUT_IO && pParamData->value.raw_val != NI_RAW_IO)IBM%s: parameter invalid (pParamData->value.raw_val != NI_MESG_IO && pParamData->value.raw_val != NI_ROUT_IO && pParamData->value.raw_val != NI_RAW_IO) IB%s: set talkmode of hdl %d to %s%s %s: parameter invalid (pParamData->value.raw_val != NI_BUFSTAT_OFF)%s: parameter invalid (pParamData->value.raw_val != NI_BUFSTAT_OFF) IBM%s: hdl %d, bufstat %d %s: parameter invalid (pParamData->datatype != NI_DT_ALLOCFUNC)%s: parameter invalid (pParamData->datatype != NI_DT_ALLOCFUNC) IBM%s: set alloc function for hdl %d to %p IBM%s: parameter invalid (pParamData->datatype != NI_DT_UINT)I%s: parameter invalid (pParamData->datatype != NI_DT_UINT) %s: set max queue for hdl %d to %d %s: set warn queue for hdl %d to %d IBM%s: set max message length for hdl %d to %d IBM%s: mpAcceptedHdl != NULL for hdl %dIBM%s: mpAcceptedHdl != NULL for hdl %d IB%s: mpPassHdlData = NULL for hdl %d%s: mpPassHdlData = NULL for hdl %d IBM%s: NiICreateHandle failed (rc=%d) %s: noOfSockets = %d for hdl %d%s: noOfSockets = %d for hdl %d IBM%s: NiIBlockMode failed (rc=%d) IBM%s: hdl %d accepted hdl %d bound to %%s%s I%s: SiGetSockName failed (sirc=%d) %s: NiBufIHdlInit failed (rc=%d) IB%s: NiBufISetParam failed (rc=%d) I%s: NiIGetPeerName failed (rc=%d) I%s: hdl %d accepted hdl %d from %%s IBM%s: hdl %d took local address %%s I%s: NiIPeek failed (rc=%d) %s: error in hdl %d%s: no errInfo set for hdl %d I%s: send ni-error rc %d to hdl %d I%s: discarding error %d due to older error %s: save rc %d in buffer (hdl %d) I%s: no error information foundI%s: SiSendSocket failed (sirc=%d) for sock %d over hdl %dIB%s: SiSendSocket failed (sirc=%d) for sock %d over hdl %d INI_PING%s: hdl %d received NI_PING, reply NI_PONG %s: NiICheck failed (rc=%d) IBM%s: hdl %d mPendDataLenToWrite > 0 (%d), do not send PONG INI_PONG%s: hdl %d received NI_PONG, check o.k. IBM%s: hdl %d received NI_PONG: wait_count: %d IBM%s: hdl %d received NI_PONG IBM%s: message detected IB%s: invalid error-msg received (%d>%d) %s: hdl %d received rc=%d (%s) from peer ?%s: hdl %d processing opcode %d (len=%d; vers=%d) I%s: NiBufISendMsg failed (rc=%d) IB%s: hdl %d mPendDataLenToWrite > 0 (%d), do not send VERSION IB%s: invalid internal state (hdl %d;%d;%p;%p;%d)%s: invalid internal state (hdl %d;%d;%p;%p;%d) IBM%s: NiBufISendMsg fauled (rc=%d) IB%s: malloc failed for %d bytes (hdl %d)%s: invalid internal state (hdl %d;%d;%p;%d<%d)%s: invalid internal state (hdl %d;%d;%p;%d<%d) IBM%s: sending hdl %d over hdl %d to pid %d IB%s: sent hdl %d successfully IB%s: invalid type of hdl %dI%s: invalid type of hdl %d %s: invalid internal state (hdl %d;%d;%p)IB%s: invalid internal state (hdl %d;%d;%p) I%s: passed by hdl %dIB%s: NiBufISetError failed (rc=%d) I%s: unknown opcode %d receivedI%s: unknown opcode %d received (hdl %d) IBM%s: NiBufISendErr failed (rc=%d) IB%s: hdl %d mPendDataLenToWrite > 0 (%d), do not send ERROR-INFO IBMNIBUF-INIBM%s: NIBUF len=%d IB%s: NI_PING detected on hdl %d %s: error message detected on hdl %d IB%s: packet complete for hdl %d %s: invalid data receivedIB%s: invalid data received (hdl %d;len=%d;msg=%d) IB%s: NiBufIProcMsg failed (rc=%d) IB%dI%s: message length %d exceeds max (%d)I%s: invalid data (len=%d;0x%x;max=%d;hdl %d;peer=%s;local=%d) I%s: NIETOO_SMALL with allocated bufferI%s: NIETOO_SMALL with allocated buffer (hdl %d) IBM%s: PONG received during handshake %s: NiBufIEmptyOutQueue failed (rc=%d) %s: buffer of hdl %d in stat err without errinfoIBM%s: setting errInfo for hdl %d (rc=%d) %s: parameter invalid (pOutHandle == NULL)I%s: parameter invalid (pOutHandle == NULL) %s: invalid hdl %dI%s: invalid hdl %d %s: got nonlocal hdl %d (%s; %s)IBM%s: got nonlocal hdl %d (%s; %s) IB%s: NiBufISendReadyQueue failed (rc=%d) IBM%s: pending data in out-queue I%s: pending data in in-queue IB%s: starting transfer of hdl %d over hdl %d IBM bufIBM%s: hdl %d process %c%c IBM%s: hdl %d connection still in progress after write event I%s: invalid set (%p<>%p)IB%s: invalid set (%p<>%p) for hdl %d IBM%s: remove hdl %d from set%s IB%s: add hdl %d to set%s IBM%s: connect failed for hdl %d (rc=%d) #1 IB%s: connect failed for hdl %d (rc=%d) #2 IB%s: connection established for hdl %d I%s: not enough space (%d>%d-%d)%s: not enough space (%d>%d-%d) IBM/H/%s: malloc failed for %d bytes RouteString <%s> IB/S//P//W/service in route <%s> != servname param <%s> IB%s: NiBufIAddRouteEntry failed (rc=%d) %s: parameter invalid ((protocol & ~(NI_PROTO_FAM_UNSPEC | NI_PROTO_FAM_LOCAL | NI_PROTO_FAM_IPv4 | NI_PROTO_FAM_IPv6)) != 0)IB%s: parameter invalid ((protocol & ~(NI_PROTO_FAM_UNSPEC | NI_PROTO_FAM_LOCAL | NI_PROTO_FAM_IPv4 | NI_PROTO_FAM_IPv6)) != 0) I%s: NiBufIHostToRoute failed (rc=%d) IB%s: connect to route: I <%s> I %s IBM%s: forward route to SAProuter %s: route could not be sent in %dms%s: non-buffered hdl %d could not be sent in %dms (%s) %s: route connect of non-buffered hdl %d to '%s' timeout IB%s: route connect '%s' timeoutI%s: route connect for non-buffered hdl %d failed (rc=%d;%s); pong not received %s: route connect for buffered hdl %d failed (rc=%d;%s); pong not received %s: connection pending after %dmsIBconnect%s: non-buffered connect pending after %dms (hdl %d;%s) IBM %s starting IB%s: queue for hdl %d full (%d packets) %s: added buffer %p to out-queue (hdl %d, %d packets, heap %d) %s: out-queue for hdl %d down to %d packets IBM%s: heap-space exhausted (%d > limit %d) IB%s: parameter invalid (*ppBuffer == NULL)IB%s: parameter invalid (*ppBuffer == NULL) I%s: set max heap to %d %s: external functions already setI%s: external functions already set (%p;%p) %s: required size too big (%d>%d)IB%s: called with len %d > NIBUF_MAXALLOC (%d) IB%s: Heap-space %u exhausted by %u bytes IBM%s: malloc %s, to %d bytes %s: parameter invalid (ppBufferTo == NULL)I%s: parameter invalid (ppBufferTo == NULL) %s: parameter invalid (pBufferFrom == NULL)%s: parameter invalid (pBufferFrom == NULL) IBMNiBufadmIBM%s: invalid type %d%s: invalid type %d IBM%s: parameter invalid (pBuffer == NULL)%s: parameter invalid (pBuffer == NULL) IBM%s: parameter invalid (pData == NULL)IB%s: parameter invalid (pData == NULL) I%s: parameter invalid (pFreeFunc == NULL)IB%s: parameter invalid (pFreeFunc == NULL) I%s: parameter invalid (length < 0)I%s: parameter invalid (length < 0) %s: parameter invalid (spaceLen < 0)IBM%s: parameter invalid (spaceLen < 0) IB%s: parameter invalid (length > spaceLen)IB%s: parameter invalid (length > spaceLen) I%s: buffer too small (%d<%d)NiSelNewSet2NiSelDestroySetNiSelSetNiSelClearNiSelClearSetNiSelSelectNiSelNextNiSelIsMemberNiSelGetErrorNiSelDumpNiSelICreateSetNiSelIInitNiSelISetNiSelIClearNiSelIRemoveNiSelIRemoveAllNiSelISelectNiSelISelectIntNiSelINext2NiSelIGetModeNiSelIGetStatNiSelIGetDataNiSelISetDataNiSelIListInsertNiSelIListRemoveNiSelICreateMsgNiSelIAddMsgNiSelIMoveMsgNiSelIRemoveMsgNiSelIResetMsgsel???buf | handle prv nxt | tI | hdl %-3d %3d %3d |IB EI II LI RI WI CI DI -Inixxsel.cpp%s: internal status error (%d;%d) I%s: remove hdl %d [%d] from %s-list (%d) of set%s I%s: internal status error (hdl %d;%d) I%s: added hdl %d to set%s I%s: new failed for %d*%d bytesI%s: new failed for %d*%d bytes %s: removeAll failed; internal errorIBM%s: removeAll failed; internal error IB%s: removeAll failed; unknown error %dI%s: removeAll failed; unknown error %d NISEL set %p (%s) Iselect list : %d (%d) ready list : %d (%d) next : %d (%c) set handle : %d (-1) sel handle : %d max entries : %d RI servers : %d IB%s: setData failed for hdl %d; handle not member of set%s: setData failed for hdl %d; handle not member of set IBM%s: invalid hdl %dI%s: invalid hdl %d %s: setData failed for hdl %d; unknown error %d%s: setData failed for hdl %d; unknown error %d IBM%s: getData failed for hdl %d; handle not member of set%s: getData failed for hdl %d; handle not member of set IBM%s: getData failed for hdl %d; unknown error %d%s: getData failed for hdl %d; unknown error %d IBM%s: getStat failed for hdl %d; handle not member of set%s: getStat failed for hdl %d; handle not member of set IBM%s: getStat failed for hdl %d; unknown error %d%s: getStat failed for hdl %d; unknown error %d IBM%s: getMode failed for hdl %d; handle not member of set%s: getMode failed for hdl %d; handle not member of set IBM%s: getMode failed for hdl %d; unknown error %d%s: getMode failed for hdl %d; unknown error %d IBM%s: next failed; internal error%s: getStatEx failed (sirc=%d) for pos=%d; hdl %d; sock %d %s: next failed; unknown error %dIB%s: next failed; unknown error %d I%s: not interested in event on hdl %d I%s: add hdl %d [%d] to %s-list (%d) of set%s IB%s: internal status error (%d) %s: handles ready; reset timeout IBpassed over poll/select timeout (%ds>=%dms+%ds) IBM%s: select failed; internal errorIB%s: select failed; internal error I%s: select failed; unknown error %d%s: select failed; unknown error %d IBMhdl %d/sock %dIsock %d%s: remove closed %s IB%s: error detected on %s IB%s: internal status error (hdl %d/sock %d !e [sock %d, sock %d]) IB%s: internal status error (hdl %d/sock %d !e [sock %d]) IBM%s: %d handles selected (%d buffered) I%s: select recall after %d tries IB%s: remove failed for hdl %d; unknown error %dI%s: remove failed for hdl %d; unknown error %d %s: remove failed for hdl %d; handle not member of setI%s: remove failed for hdl %d; handle not member of set %s: remove failed for hdl %d; internal errorIBM%s: remove failed for hdl %d; internal error IB%s: removed hdl %d %s: clear failed for hdl %d; unknown error %dIB%s: clear failed for hdl %d; unknown error %d I%s: clear failed for hdl %d; handle not member of setIB%s: clear failed for hdl %d; handle not member of set I%s: clear failed for hdl %d; internal error%s: clear failed for hdl %d; internal error IBM%s: invalid flags for listen hdl %d%s: invalid flags for listen hdl %d IBM%s: invalid flags for none listen hdl %dIBM%s: invalid flags for none listen hdl %d IB%s: set failed for hdl %d set%s; unknown error %dIB%s: set failed for hdl %d set%s; unknown error %d I%s: set failed for hdl %d set%s; maxSockets reached (%d)IBM%s: set failed for hdl %d set%s; maxSockets reached (%d) IB%s: set failed for hdl %d set%s; internal error%s: set failed for hdl %d set%s; internal error IBM%s: unknown error %dIBM%s: unknown error %d IB%s: param maxSockets invalid (%d)IB%s: param maxSockets invalid (%d) I%s: memory allocation failedIBM%s: memory allocation failed IB%s: internal errorI%s: internal error %s: size of set%s is %d IBMIBM I%s: parameter invalid (pSet == NULL)IBM%s: parameter invalid (pSet == NULL) IB%s: parameter invalid (pFile == NULL)IB%s: parameter invalid (pFile == NULL) I%s: parameter invalid (pSelSet == NULL)%s: parameter invalid (pSelSet == NULL) IBM%s: new failed for %d bytes%s: new failed for %d bytes IBM%s: addSpecImpl failed (sirc=%d)IBM%s: addSpecImpl failed (sirc=%d) IB%XI%s: new set%s I%s: parameter invalid (pNewSelSet == NULL)I%s: parameter invalid (pNewSelSet == NULL) %s: parameter invalid (maxSockets < 0)I%s: parameter invalid (maxSockets < 0) %s: parameter invalid (pImpl != NULL && *pImpl != SISEL_IMPL::POLL && *pImpl != SISEL_IMPL::SELECT && *pImpl != SISEL_IMPL::F_CONN)%s: parameter invalid (pImpl != NULL && *pImpl != SISEL_IMPL::POLL && *pImpl != SISEL_IMPL::SELECT && *pImpl != SISEL_IMPL::F_CONN) SiSelCreateSetSiSelAddSpecImplSiSelPInitSiSelPSetSiSelPClearSiSelPClearSetSiSelPRemoveSiSelPRemoveAllSiSelPSelectSiSelPStartLoopSiSelPNextSiSelPGetModeSiSelPGetStatSiSelPGetStatExSiSelPGetDataSiSelPGetSocketPosSiSelP~SiSelPAddSiSelPOptimizeSetSiSelEPInitSiSelEPSetSiSelEPClearSiSelEPClearSetSiSelEPRemoveSiSelEPRemoveAllSiSelEPSelectSiSelEPNextSiSelEPGetModeSiSelEPGetStatSiSelEPGetStatExSiSelEPGetDataSiSelEPGetSocketPosSiSelEP~SiSelEPAddSiSelSInitSiSelSSetSiSelSClearSiSelSClearSetSiSelSRemoveSiSelSRemoveAllSiSelSSelectSiSelSStartLoopSiSelSNextSiSelSGetModeSiSelSGetStatSiSelSGetStatExSiSelSGetDataSiSelSSetDataSiSelSGetSocketPosSiSelNInitSiSelNSetSiSelNClearSiSelNClearSetSiSelNRemoveSiSelNRemoveAllSiSelNSelectSiSelNStartLoopSiSelNNextSiSelNGetModeSiSelNGetStatSiSelNGetStatExSiSelNGetDataSiSelNGetSocketPosSiSelN~SiSelNAdd (currently) csTRUEfalseADDMODDEL???sixxsel.cpp%s: failed to create select class ISAP_USE_STD_POLLIBM%s: failed to create specialized class %s: invalid implementation type %d %s: parameter too big (%u>%u) I%s: failed to allocate SI_POLL_FD[%u] I%s: failed to allocate FD_EL[%u] IBSISELIB%s: allocate %u bytes for FI (%u) I%s: failed to allocate SAP_RAW[%u] %s: FiInit failed (rc=%d) I%s: FiOpenIndex failed (rc=%d) %s: sock %d negative IB%s: maximum of sockets reached (%u) IBM%s: internal status error (%u<>%u) *%s: FiInsert failed (rc=%d) IBM%s: sock %d added to set pos %u IBM%s: set events of sock %d to: %c%c%c IB%s: sock %d not member of set I%s: cleared set IBM%s: optimizing select set (%u<<%u) %s: moving entry %u to %u I%s: FiRemove failed (rc=%d) IBM%s: internal status error (%u-%u-%u) IB%s: removed last sock %d (pos=%u) I%s: removed sock %d (pos=%u) IB%s: FiCloseIndex failed (rc=%d) IBM%s: removed all sockets IBM%s: start select (timeout=%d) I%s: poll looped %d times, caused by EAGAIN (limit=%d) I%s: SiPoll failed (%d-%s) I%s: of %u sockets %u selected I%s: iterator reseted IB%s: sock %d selected (pos=%u; revt=%c%c%c) %s: an error occurred in sock %d IB%s: a hang up occurred in sock %d I%s: sock %d already closed %s: no more selected sockets (pos=%u) ISIPOLL set %p Isockets in set: %d highest pos +1: %d max entries : %d event pos : %d IBMsocket list : IBM pos pSocket pData nxt FI | socket events revents I %5d: %08x %08x %3d %3d | sock %-3d %2d (%c%c%c) %2d (%c%c%c%c%c%c)Ifree list : IBMempty I>%d%s: failed to allocate epollFD[%u] %s: failed to allocate pollfd memory (%d) IBM Ifffffffg%s: sock %d was already closed %s sock %d with evt=%d ptr=%p %s: sock %d was already closed and valid again %s: pollset_ctl: cmd=%d errno=%d I%s: sock %d was already closed but still in this set; remove now IB%s: wrong FI entry (sock %d<>sock %d) I%s: sock %d was is selected%s I%s: pollset_destroy(epollFD) failed IBM%s: SiEPoll failed (%d-%s) %s: unexpected value retured (%d>%d) IB%s: invalid slot selected I%s: invalid state of selected slot [%d] revt=%d ptr=%p (sock %d;evt=%d) IB%s: sock %d without event selected %s: an invalid fd has been used: sock %d IB%s: invalid1 fd sock %d IBM%s: invalid2 fd sock %d IBMSIEPOLL set %p sockets in set: %d highest pos +1: %d max entries : %d IB%5d: %08x %08x %3d %3d | sock %-3d %2d (%c%c%c) %2d (%c%c%c%c%c)IBMselcted list : IBM%s: sock %d out of range (0<=x<%u) %s: sock %d added to set IB%s: removed sock %d IBM%s: few sockets already closed %s: set selFDs to 1 (no timeout) IB%s: SiSelect returned SI_EINVAL; sleep for %d ms IB%s: SiSelect failed (%d-%s) IBM%s: sock %d selected (revt=%c%c%c%s) IB%s: no more selected sockets IBSISELECT set %p IBMsockets in set: %d highest pos +1: %d max entries : %d event pos : %d socket list : %d invalid socket: %s I pos pSocket pData prv nxt | socket ev rev%5d: %08x %08x %3d %3d | sock %-3d %c%c%c %c%c%cIBMSISELNT set %p sockets in set: %d highest pos +1: %d highest fd +1: %d max entries : %d event pos : %d socket list : %d free list : %d invalid socket: %s IBM pos pSocket pData prv nxt FI | socket ev revIB%5d: %08x %08x %3d %3d %3d | sock %-5d %c%c%c %c%c%c?333333 PTL: %d keys. I#%3d I%cI IB IB %c> IB[%d] IB PT : %d keys I @NiILHInitNiIGetLocalNameNiILocalCheckIBnixxlh.cppI%s: already initialized%s: already initialized IBM%s: NiPMyHostName failed (rc=%d) IB%s: parameter invalid (pNodeAddr == NULL)IB%s: parameter invalid (pNodeAddr == NULL) I%s: local loopback address: %s %s: SiSocket failed (sirc=%d)IB%s: SiSocket failed (sirc=%d;%d-%s) IBM%s: SiBind failed (sirc=%d;%d-%s %s) IB%s: NiILHInit failed (rc=%d) IB%s: %d<=%dI%s: buffer too small (%d<=%d) ) @(#) $Id: //bas/722_REL/src/sec/rng/rngxxi.c#1 $ SAPIBMrngxxi.cIBM%.64s() Hash-error in function: 'haHashAll'. IBiRng_CompleteUpdateRANDOM: Did CompleteUpdate after %d calls, size: %d, values in entropy-pool = %d IB%.64s() : SHA-256 hash alg. returned with returncode: %d IBiRng_RandomStep%.64s() : MD5 hash alg. returned with returncode: %d @(#) $Id: //bas/722_REL/src/sec/rng/rngxxtim.c#1 $ SAPI%.64s() : Use default timer = %d; Resolution of timer: %u IBMiRng_InitHighResTimerIB----------------------------------------------------------- gettimeofdayIBMsap_clockIB*** ERROR => bad %s variable >%s< IPFCLOCKFunction pfclock uses: %s IBM IfffffffgྂmiK/Function PfRuntimeClock uses: %s IBFunction PfSetRuntimeClock uses: %s IBMFunction PfSetStatisticClock uses: %s IPFSTATCLOCKFunction PfStatisticClock uses: %s Function PfSetClock uses: %s 0123456789ABCDEF@(#) $Id: //bas/722_REL/src/krn/ha/haxx.c#1 $ SAPhaxx.cMD5SHA1SHA256SHA384SHA512CRC32IB@@@ 0@51238425632I@(#) $Id: //bas/722_REL/src/krn/ha/haxxenc.c#1 $ SAPhaxxenc.cABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789-_0123456789ABCDEF0123456789abcdef IBM IBMUUUUUUUV@(#) $Id: //bas/722_REL/src/krn/ha/haxxsha2.c#1 $ SAPIBj ggQR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqx@(#) $Id: //bas/722_REL/src/krn/ha/haxxsha1.c#1 $ SAPIBgE#ͫ2Tvb@(#) $Id: //bas/722_REL/src/krn/ha/haxxmd5.c#1 $ SAPIBMgE#ͫ2TvjxǷV|0FFD[\׾qyC%b@@Ǫ/]ء7 *L9Bq8 DK`p'09ۙĬVe)"D#9 ̒}],CS~:5ӑ@(#) $Id: //bas/722_REL/src/krn/ha/haxxcrc32.c#1 $ SAP@(#) $Id: //bas/722_REL/src/krn/ha/haxxsha3.c#1 $ SAPIB˻]b)*6|YZ0p/Y9g3&g 1JhX . dGHOB/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGX@(#) $Id: //bas/722_REL/src/krn/ha/haxxsha5.c#1 $ SAPIBj ggʧ;l٫Ak[~!yB/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGX@(#) $Id: //bas/722_REL/src/sec/rng/rngxx.c#1 $ SAP----------------------------------------------------------- IBM%.64s() : Initialization of the Pseudo-RNG (%u/%u/%u) Rng_PseudoRandomInitIBMrngxx.c%.64s() Hash-error in function: 'haHashAll'. IBRng_RealRandomI%.64s() The Pseudo-RNG was not initialized. IBMRng_PseudoRandomIBM%.64s() Error in function: 'iRng_RandomStep'. !H2#<17f: O?QG L!H2#<17f: O?QG LUUUUUUUVIBM *@(#) $Id: //bas/722_REL/src/krn/ha/haxxhmac.c#1 $ SAPIB@(#) $Id: //bas/722_REL/src/krn/rsec/rseckey.c#1 $ SAPIKey compound has length 0IBKey type %d is not supportedIBMKey compound has incorrect length for key of type 1Key compound has incorrect inner checksumIBLength of reference KeyID "%s" is too longIKey compound has incorrect outer checksum for KeyID#[%]SAPPlatform: rs6000_64#[%]SAPFileVersion: 7220, 5, 24, 9553#[%]SAPSpecialBuild: opt (EXT) (May 24 2015, 15:27:23)#[%]SAPProductVersion: 722, patch 5, changelist 1582417#[%]SAPrbIFileVersion: IBProductVersion: IBMPlatform: ISpecialBuild: qhH@(#)23 1.6 src/bos/usr/ccs/lib/libpthreads/init.c, libpth, bos610 6/21/07 15:28:59@(#)61 1.16 src/bos/usr/ccs/lib/libc/__threads_init.c, libcthrd, bos61B, b2007_33A0 8/2/07 13:09:21q@(#)42 1.1 src/bos/usr/ccs/lib/libc/POWER/crti.C, libcproc, bos610 3/13/07 11:03:08ޭqqw vr d d  ,X ,dd PdFP, +gI+p$+g+p$+g+p(+g+p(+g+p,+g+p,+g+p<+g+p`+g+p+p+p+q +qh+g+q+g+q+g+q+g+r+g+r<+g+rl+r+r+s+sP+g+sh+g+s+g+s+g+s+s+t<+t+t+u+uX+u+v+g+v0+g+vh+v+v+w8+w+g+w+g+w+w+x4+xl+x+x+y+yD+y+y+z+z<+zt+g+z+g+{4+g+{`+g+{+g+{+g+{+g+| +g+|H+g+|+g+|+g+}@+g+}+g+}+g+~ +g+~X+g+~+g+~+g+~+g+4+g+l+g++g+++d+++g+\+g+++$+`++g++g++(+`+++g++g+T++|+++g++g++g++g++p++0++g++g++g+L+g++g++g++g+8+g+|+g++g++g+0+g+t+g++g++g+(+g+t+g++g++++0+t+g+t+g+|+g+|+g++g++g+++<+h++g++g++g++g+<+g+`+g++g++g++g++g++g++g+$+@+\+|++++$+\++++P++++,+X++++ +,+L+t+++$+X+++(+++0+++$+\+++g+(+g++g++g++g++g+L+g+l+g++g++g++g++g+L+g+p+g+++++(+L+p++++++@+`++++g++g+ +g+L+g++g++g++g+L+g++++X++g++g+T+g++g++g++g++g+(+g+X+++4+++++$+P+++++0+T+x+g++g++g+ +g+P+g++g++g++g+ +g+X+g++g++g+ +8+d+++g++g+++0+\+++++L+l+++++0+l++++@+|+g++g++g+ +g+8+g+l+g++g++g++++$+L+g+l+g++g++g++g+ +g+@+g+h+g+++++D+p++++g+ +g+,+g+<+g+L+g+\+g+l+g++g++g++g++H+++,+g+P+g+|+++++T+++D+++ +t+g++g++g++g+4+g+L+g+h+g++g++g++g+T+g+t+g+++8+++g++g+X++++(+\++++0+D+X+p+|++++g++g++4+p+++g+,+g+l+g+|+g++++(+`+g++g++++++L+++ +g+H+g+t+g+¬+g++g++g+4+g+`+g+Ô+g+ø+g++g+ +g+@+g+t+g+Ĭ+++$+X+ń+ż++,+`+Ƥ+++g+<+g+d+g+Lj+g+Ǵ+g++g++g+<+g+\+g+Ȅ+g+ȴ+g++g+$+g+P+g+Ʉ+g+ɤ+g++g++g+H+g+x+g+ʬ++,+d++g++g+T+g+̬+g++L+͔+++g+L+g+ΐ+g+θ+g++g+ +g+4+g+t+g+ϸ+g+4+g+м+g++g+`+g+ѐ+g++g+ +g+\+g+Ҝ+g+++(+T+ӄ+Ӭ++ +D+g+p+g+Ԡ+g++g++g+D+g+x+g+հ+g++,+h+֜++ +H+|+׸+g++g+X+g+ج+g++g+L+g+ِ+g++g++g+0+g+d+g++g+8+g+h+g+۬+g++g+t+g+ܜ+g++g++g++,+P+݀+ݰ+++ +L+g+\+g+t+ހ+ތ+ޠ+ް+޼++++ +\+ߔ++g++g++g+@+g+p+++ +`+g++g++g++g++@+|+|++g++g+H+g+p+g++g++g++g+0+g+h+g++g++g++g+H+g+|+g++g++g+(+g+X+g++g++g++g++g+X+g++g++g++g++g+D+g++g++g+++8+l+++<+++g+@+g++g++g++g++g+D+g+`+g+++++<+g+x+g++g++g+ +g+T+g++g++g+(+g+P+g++g++g++g++g+T+g++g+ +g+H+g+x+g++g++g++g+X+g++g++++,+\+g++g++g++g+L+|++++g+@+g+p++++4+g+\+g++g++g++g++g++g+D+g++g++g++g++g+H+g+\+g+p+g++g++g++g++g++g+ +g+<+g+\++++$+d+++<+`+|+++g++g+ +g+L+g+x+g++g++g++g+`+g++g++g++g+0+g+T+g++g++g++g++g+D+g+X+g+t+g++g++g++g++g,(+g,h,,,,,,, ,0,D,`,t,+g,+g,+g,+g, +g,,+g,T,x,,, +g,L+g,,,,d,+g,+g,P+g,|+g,+g,+g,+g,0+g,T,,,,,8,t,,,,,H,d+g,+g,+g,+g,+g, +g, 8+g, X+g, +g, +g, +g, +g, P, , , , L, , , , @+g, p+g, +g, +g, , (, L, |, , , ,4,`,,,,+g,@+g,d+g,+g,+g,+g,+g,8+g,p+g,+g,,0,l,,+g, +g,\+g,+g,,,,,\,,,, ,8,d,,,, ,0,`,,,,,(,P,,,+g,,+g,+g,+g,+g,P+g,+g,+g,+g,+g,4+g,\+g,+g,+g,+g,4+g,x,,,,(+g,\+g,+g,+g,+g,4+g,p+g,+g,+g,+g,+g, +g,L+g,t+g,+g,+g,,,,\,,+g, +g,x+g,+g, +g, X+g, , , ,! ,!X+g,!+g,!+g," +g,"T,",",# ,#l+g,#+g,#+g,$+g,$d+g,$+g,$+g,%+g,%`+g,%+g,%,%,%,&,&(,&<,&T,&l,&,&,&,&,&,'$,'X,',',',',',(+g,(8+g,(t+g,(+g,(+g,)+g,)t+g,)+g,),*0,*x,*,+,+@,+p,+,++g,++g,,(,,d,,,,,-$+g,-`+g,-,-,.(,.x,.,/,/X,/,0+g,0@+g,0x+g,0+g,0+g,0+g,1,1 ,18,1P,1l+g,1+g,1+g,1+g,2(+g,2T+g,2,2,2,3,3P+g,3+g,3+g,4+g,4D+g,4X+g,4t+g,4+g,5+g,5$+g,5P+g,5+g,5+g,5+g,6<,6,6,7d,7+g,7+g,7+g,8+g,80+g,8\+g,8+g,8+g,8+g,94+g,9,9,9,9,:0,:\,:,:,;,;(,;T,;,;,;,<,,>L,>,>,?4,?\,?|,?,?,@,@@,@,@,A,A@,A,A,B,B<,Bp,B+g,B+g,C ,CT,C,C,C+g,C+g,D +g,D0+g,DP,D,D,D,E8+g,E\+g,E|+g,E+g,E+g,E+g,F+g,F4+g,FT+g,Fl+g,F+g,F+g,F,F,F,G,G@,G`,G,G,G,G,H,HD,Hp,H,H,H,H,I0,Ip,I,I,J,,J`,J,J,K,K0,Kh,K,K,L,L<,L,L,L,M$,Md,M,M,M,N,ND,Np,N,N+g,N+g,O,OH,Ox,O,O,P,P,,PL,Px+g,P+g,P+g,P+g,Q+g,Q<+g,Qp+g,Q+g,R,R8,RX,Rx,R,R,R,S,S,+g,SX+g,S+g,S+g,T+g,T8+g,Tt+g,T+g,T+g,T+g,U$,UP,U,U,V,+g,V\+g,V,V,W,W`,W+g,W+g,X$,Xl,X,Y$,Y,Y,Y,Z,ZL+g,Z|+g,Z+g,Z+g,[8,[\,[,[,\+g,\L+g,\,\,],]T,],],^,^X,^,^,_0,_x,_+g,`$+g,`+g,`+g,`+g,`+g,a@+g,a`+g,a+g,a+g,a+g,b+g,b$+g,b`+g,b+g,b+g,b+g,cH+g,c+g,c+g,dH+g,d+g,d+g,d+g,e+g,e+g,f+g,f<+g,fx,f,f,g,gD+g,g+g,h@+g,h+g,h+g,i+g,iX+g,i+g,i+g,j+g,jP+g,j|+g,j,j,kH,k,k,l ,lT,l,l+g,l+g,m +g,mL+g,m,m,n,n<,n,n,n,o0,op,o,o,p ,pd+g,p+g,p,p,p,q,q8+g,qT+g,qt,q,q,q,r,r,r0,rL,rh,r,r,s(,sl+g,s+g,s+g,s+g,t$+g,t4+g,tL+g,t|+g,t+g,t+g,uD,u,u,vx,v,w4,w|,w,x,xl,x,y,yd,y,y,z<,zd+g,z+g,{+g,{D+g,{|+g,{+g,{+g,|@+g,|+g,|+g,},}`,},~(,~+g,~+g,$+g,+g,+g,D+g,+g,+g,+g, +g,D+g,t+g,+g,+g,+g,@+g,+g,+g,+g,0+g,p+g,+g,+g,4+g,x+g,+g,+g,0+g,x+g,+g,+g,(+g,l,,,,4,,,\,,,<,x,,,4,|,+g,+g,T+g,+g,+g,\+g,+g,+g,@,l,,,,$,T,,+g,+g,$+g,X+g,+g,+g,+g,<+g,,,,,+g,(+g,X+g,+g,,0,l,,+g,,+g,l+g,+g,+g, +g,D+g,x+g,+g,+g,(+g,T+g,+g,+g,+g,+g,,D,x,,,,,8,T+g,+g,+g,+g, +g,L+g,,,,,L+g,p+g,+g,,+g,+g,`+g,+g,,+g,+g,+g,(+g,@+g,X+g,+g,+g, +g,l+g,+g,+g,,+g,|+g,+g,+g,4+g,+g,+g,+g,T+g,+g,+g,0,P,t,,+g,+g,8+g,t+g,+g,+g,+g,+g, ,,,X,+g,+g,T,,, ,X,|,,,, ,L,,,,<,,+g,+g,h+g,+g,,,,X,,+g,+g,`+g,+g,+g,+g,d+g,+g,+g,@+g,+g,+g, +g,D+g,h,,,,+g,+g,\+g,+g,+g, +g,P+g,+g,+g,+g,d,,,,X+g,+g,,,T,,+g, +g,x+g,+g,+g,(+g,|+g,+g,+g,X+g,+g,$+g,+g,+g,D,,,,8,h,,,+g,D+g,t,,,,T+g,+g,+g,+g,8+g,d+g,,,,,+g,T+g,+g,+g,,L,,,X,t,,¬,,,$,P,Ð+g,+g,(,T,Ą,Ĵ,,,,t,Ÿ,+g,$+g,H,l,Ɣ,Ƹ,+g, +g,8+g,h+g,Ǡ+g,+g,,,<,h,Ș+g,ȼ+g,+g, +g,8+g,`+g,Ɍ,ɤ,,,+g,0+g,X+g,|+g,ʨ+g,+g,+g,$+g,T+g,ˈ+g,+g,+g, +g,L+g,̀+g,̨+g,+g,+g,L+g,̈́+g,,,,8,h+g,Π+g,+g, +g,<+g,π+g,+g,+g,\+g,И+g,+g,+g,d,є,,,@,҈,,,`,Ӡ,, ,d,Ԕ,,,$,T,Ր,ռ,, ,T,|,ְ+g,ְ+g,+g,+g,P+g,P+g,נ+g,נ+g,+g,0+g,؀+g,؀+g,،+g,ج+g,,,<,h,ٰ+g,+g,+g,+g,X+g,ڄ+g,ڴ+g,+g, ,H,p,۠,, ,@,܀,,,,,+g,0+g,H,\,t,t,݈,ݜ,ݴ,ݴ,,,,,,0,P,P,l,ހ,ޘ,ޘ,ް+g,+g,,+g,ߐ+g,,|,,4,x+g,+g,+g,$+g,\,,,D,+g,+g,,,4,h,,,,X,+g,+g,@+g,`+g,+g,+g,+g,+g,0+g,d+g,,,,,H,l,,,,,0,L,h+g,+g,+g,+g,+g,0+g,`+g,+g,+g,+g,,D,|,,+g,+g,8,`,,,+g, +g,L+g,x+g,,,,,H+g,p+g,+g,+g,+g,+g,P+g,p+g,,,,,4+g,h+g,+g,+g,+g,+g,,(,l,,+g,+g,$+g,L+g,|+g,+g,+g,+g,+g,(+g,D+g,`+g,|+g,+g,+g,+g,+g,8+g,t+g,+g,+g,+g, +g,L+g,+g,+g,+g,+g,P+g,|+g,+g,+g,+g,<+g,h+g,+g,+g,+g,+g, +g,L+g,p+g,+g,+g,+g, +g,4+g,P+g,|+g,+g,+g,X+g,,,,4,\,,,,d+g,+g,$,h,,,t+g,+g,+g,+g,p+g,+g,----<----p---(-l---@-+g-+g-h----X--- -H-d------ - 0+g- T+g- x+g- +g- +g- \+g- - - - <- l- - - - <+g- +g- - - L- - +g- +g--@-h--+g-+g-@+g-+g---@----H--+g-L+g-+g-+g-+g-T+g-+g-+g-<----P+g-+g--8-t--+g- +g-D-l---+g-+g-0-h---+g-0+g-H+g-|+g-+g- +g-d--X------T+g-+g-+g-L+g-+g-+g- $- t- -!0-!+g-"+g-"t+g-"+g-#4+g-#|+g-#-$-$T-$-$-%@-%-%-&L+g-&h+g-&+g-'+g-'-(-(8-(p-(+g-(+g-)`-)-)-)-* -*(-*P-*x-*-*-+ -+H-+t-+-+-,-,L-,|-,-,----@--p-------.-.-.8+g-.h+g-.-.-/4-/-/-0-0<-0-0+g-0+g-1@+g-1t+g-1+g-2(+g-2+g-2+g-2+g-2+g-3 -3<-3-3-3+g-4+g-48+g-4`+g-4+g-4+g-4+g-5+g-5 +g-58+g-5T+g-5p+g-5+g-5+g-5-5-6-6L-6+g-6+g-6-6-7-7-7H-7t-7-7-8(-8T-8-8-9-98-9p-9-9+g-:$+g-:x+g-:+g-:+g-;(+g-;x+g-;+g-;+g-<,+g- +g->4+g->d+g->+g->+g-?+g-?L+g-?x+g-?+g-?+g-@(-@h-@-@-A<+g-A`+g-A-A-A-B-BD+g-B|+g-B+g-C+g-CL+g-C+g-C+g-D +g-DP-D-D-E-EH-E-E-F-FD+g-F+g-F+g-G+g-G`-G-G-HD-H+g-H+g-I +g-ID+g-I|-I-I-J0-J+g-J+g-K0+g-K|+g-K+g-K+g-L+g-L,+g-LP+g-L|+g-L-L-M(-Mh-M-M-N-NL-N+g-N+g-N-O -Od-O-O+g-P8+g-P-P-P-Q -Q`+g-Q+g-Q+g-Q+g-R +g-R`+g-R+g-R+g-S\-S-S-S-T,-T|-T-U4-U+g-U+g-U-V-VH-V-V+g-W+g-W\+g-W+g-X +g-XH+g-X+g-X+g-X+g-Y4+g-Y|-Y-ZH-Z-[(+g-[x+g-[-\-\`-\-] +g-]4+g-]h+g-]+g-]-]-^-^H-^+g-^+g-^+g-^+g-_4+g-_l+g-_+g-_+g-`@-``-`-`-`+g-a+g-a<-a|-a-b-bh+g-b+g-b-c(-cp-c-d-d\-d-d-e4+g-ex+g-e-e-f -fX-f+g-f+g-g +g-g8+g-gl-g-g-h4-h-h-h-i0-i|-i-i-j-jP+g-j+g-j-j-k-kT-k-k-l-lh-l-m-mH-m-m-n4-n-n-o`-o-o-p<-p-p-q-ql-q+g-r+g-rx+g-r+g-s-sX-s-t-tx-t-u -ul-u-v -vP-v-v-w -wP-w-w+g-x+g-x\+g-x+g-x+g-y +g-yl-y-y-z8-z-z-{H-{-| -|l-|-}0-}-}-~@-~-~-$-|-- -t--@-- -p--D---D---P---X---x--$-x-- -t---\---H-|---X---,---P--@+g-l+g-+g-+g--D-x---(-`----`--+g-8+g-+g-+g-- -X--- -l-- -T---0-h---$-h---,-`----@----4-d--+g-+g-(+g-D+g-h----(-d---,-h--- -L-x----L-----(-T---- -@-d--+g-+g-+g-(+g-d+g-+g-+g-T+g-+g-+g-<+g-+g-+g-(+g-+g-+g-@+g-+g-+g-H+g-+g-+g-,+g-T+g-+g-+g-+g-+g-L+g-x+g-+g-+g-+g- +g-H---H-+g-+g-x+g-+g- +g-0+g-`---,-x+g-+g-+g- +g-L---0-t----(-x--@-- -`--+g-+g-D+g-+g-+g-+g-+g-L+g-+g- +g-+g-+g-+g-+g-+g-@+g-p+g-+g-- -l--+g-h+g--H--<---@----@-t-+g-+g-4-|----4-\-----(-T+g-+g----H-€-¸--,-h-ì--8-Ā+g-+g-$+g-\+g-Ř+g-Ř+g-Ť+g-+g-+g-+g-8+g-X+g-|+g-Ɯ+g-Ƹ--,-X-Ǡ+g-+g-+g-+g-4+g-5+g-(+g-@+g-X+g-p+g-Ȍ+g-Ȥ+g-ȼ+g-+g-8+g-d+g-ɜ+g-ɼ+g---H-t-ʬ+g-+g-+g-(+g-P+g-t+g-˜+g-+g-+g- +g-4+g-T+g-|+g-̜+g-+g-+g-X+g-͔+g-+g-8+g-Δ+g-+g-0+g-t+g-ϼ+g-+g-+g-D+g-Ќ---<-p+g-ќ+g-+g-+g-,-\-҈-Ҵ---,-h-ӄ+g-Ӭ+g-+g-+g- -`-Ԝ--$+g-X+g-Ք+g-ռ+g-+g-+g-@-p-֠--+g-4+g-d+g-ה+g-+g-+g-@+g-`+g-؄+g-+g--P-ٌ--$-ڸ-`--+g-+g-P-݄-ݸ-- -p-ި- -L-߈---d-----L---@-x---0-t---t--,-- -`--4--- -T-+g-+g-$-`---+g-@+g-p---\---\--,-t---d+g-+g-+g-@+g-t+g-+g-+g-+g--,-\-t---L--+g-(+g-`+g-+g---<-|--- -X-+g-+g--4-h--+g- +g-X----<-p--- -4-\--+g-+g-X+g-+g-+g- +g-d+g-+g-+g-+g-D+g-`+g-+g-+g-+g-+g-+g-+g-P+g-x+g-+g-+g-4+g-|+g-+g-+g-(+g-X+g---. ...0.x.+g.+g.0.d...,.T.....T....(.X.....X.....<.p..+g.+g.+g.<+g.p... . 4. X. . . . . X. . . . T. . . (. d. . . . D. . +g.+g.P....(+g.P+g.|+g.+g.+g.+g.D+g.l+g.+g.+g. .@.x..+g.8+g....(.p....<+g.`+g....8.... .d....`....@.x...T.|... .L....$.\....D....<.x...,.\....(.h+g.+g.+g. +g. 8. l. . .!$+g.!d+g.!.!."d.".#H.#l.#.#.$.$,.$`.$.$+g.$+g.% +g.%8+g.%p+g.%+g.%+g.&<+g.&+g.&+g.'T.'x.'.'.(.(,.(h.(.(.).),.)\.).).).* .*D.*p.*.*.+(.+L.+|.+.+.+.,$.,P.,.,.,.-0.-p+g.-+g.-....4..\..+g..+g..+g./<+g./+g.0+g.0(.0`.0.0.1.1.1H.1H.1.1.1.1.2+g.2(+g.2D+g.2t+g.2+g.2+g.3+g.30+g.3P+g.3t+g.3.3.4.4L.4+g.4+g.4+g.58+g.5.5.5.6(.6h.6.6.6.70+g.7`+g.7+g.7+g.8 +g.8<+g.8`.8.8.8.9(+g.9T+g.9+g.9+g.9+g.9+g.:.:8.:\.:.:.:.;.;\.;.;.;.<$.$.>L.>.>.>.?0.?t.?.@.@@.@x.@.@+g.A(+g.Ap+g.A+g.A+g.A+g.B.B0.BT.B|.B+g.B+g.B+g.C+g.CH.Cd.C.C.C+g.C+g.D.DT.D.D.EL+g.Ex+g.E+g.E+g.F +g.FP+g.F+g.F+g.G`+g.G+g.G+g.H(+g.H+g.I+g.IL.Ih.I.I.I+g.J+g.JP+g.Jh+g.J+g.J+g.J+g.K+g.KL+g.K+g.K+g.K+g.K+g.L+g.LL+g.L+g.L+g.L+g.M,+g.MD+g.Md+g.M+g.M+g.N+g.NH+g.N|+g.N+g.N+g.O.O.P.P.QL.Q.Q.R.RT.R.R.R.S(+g.S|+g.S+g.T<+g.T+g.U +g.U+g.U+g.U+g.V(+g.V+g.V+g.W+g.W`+g.W+g.W+g.X.XD.Xt.Xt.X+g.X+g.YH+g.Y+g.Y.Z.ZT.Z.Z+g.[+g.[P.[.[.[.\ +g.\D+g.\l+g.\+g.\+g.\+g.\+g.]+g.]4+g.]X+g.]+g.]+g.^$+g.^T+g.^+g.^+g.^+g._,+g._._.`|.a .a+g.a+g.b$+g.bT+g.b+g.b+g.cT+g.c+g.dH.d.d.e.e`+g.e+g.e+g.e+g.f+g.f@+g.ft+g.f+g.f+g.g+g.g0+g.gX+g.g+g.g+g.h +g.hD+g.hh+g.h+g.h+g.h+g.i+g.iD+g.i.i.i.j.jX.j.j.j.k8.k|.k.lD.l+g.m+g.m@+g.m+g.m+g.m+g.n+g.n0+g.n\+g.n+g.n+g.n+g.o +g.oL+g.o+g.o+g.o+g.p4+g.p+g.p+g.p+g.q4+g.qx+g.q+g.q+g.q+g.r+g.rL+g.r+g.r+g.r+g.s,+g.s.s.t.u.u.u.v .vT.v+g.v+g.v.w.wH.w.w.x .xH.x.x.y.y@.y.y.y.z0.zt.z.z.{0.{t.{.{.|(.|l.|.|.} .}X.}+g.}+g.~$+g.~P+g.~+g.+g.+g.+g.+g.h+g.+g.0+g.L+g.h+g.+g.+g.+g.h+g.+g.+g.D+g.`+g....0.d+g.+g.+g.+g.`+g.+g.+g.`+g...<.x....H.|....P+g.+g.+g.+g.4+g.d+g....,.h+g.+g.+g.0+g.|+g.+g....0.\+g.+g.+g.+g.+g.h+g.+g.+g.0+g.+g.+g.L+g.+g.+g.p+g.+g.`+g.|+g.+g.+g.8.t...+g.+g. +g.0+g.\+g.+g.+g.+g.+g.,+g.X+g.|+g.+g.+g.4+g.p+g.+g.+g.8+g.+g... ..l...@....`..L..|. +g.`+g.+g.+g.d+g.+g.+g.@+g.l+g.+g.+g.+g..4.t...<.p....P....8.t...$.\....4.l....X....D.t...+g.4+g.h+g.+g...@.t.+g.+g.D+g.p+g...(.d..D...x+g.+g.(....+g.8+g.d+g.+g.+g.+g.$+g.L+g.x+g.+g.+g.+g.@+g.X+g.|...,.h...|.+g.+g.P...h.+g.+g.8...H...,.l.+g.+g.(+g.X+g.+g.+g. +g.|+g.+g.T+g....4.X.|.ð...D.Ā.ļ..L.Ő..H.ƌ...d.ǔ...0.l.Ȩ.. +g.D+g.h+g.Ɍ+g.ɴ.. .P.ʨ+g.+g.0+g.˘+g.+g.$+g.P+g.x+g.̤...<.|+g.ͤ+g.+g.+g.$+g.\+g.Μ..$.l.ϴ..H.И..$.\.ј...4.l.Ҭ+g.+g.+g.,+g.h+g.Ӥ+g.+g.+g.\+g.Ԅ+g.԰+g.+g..D.Հ..+g.4+g.\+g.ք+g.ְ+g.+g.+g.,+g.\+g.׈+g.׼+g.+g. +g.<+g.l+g.ؘ+g...`.ٴ. .P.ڜ..H+g.\+g.x+g.ۄ+g.ې.۰...8.`.ܘ.. .(.P.|.ݸ...(.`.ވ...<.\.߈.߰...(.T.+g.+g.+g.,+g.X+g.|+g.+g.+g.+g.+g.4.h...+g.@+g.|+g.+g.+g.H+g.+g.+g. +g.D+g.+g.+g.+g.+g.P+g.+g...,.\.+g.+g.+g.+g.X....(+g.h+g.+g.+g.+g.T+g.+g.+g.(+g.l+g.+g.+g.+g.+g.0+g.\+g.+g.+g.8+g.|+g.+g.+g.0+g.+g.+g.,+g.+g.+g.0+g.h+g.+g.+g.@...0.|+g.+g..(.\....D.|...@....<.l...H.. .@.|..+g.`+g.+g.+g.L+g.+g.+g.+g.d+g.+g.+g.+g. +g.D+g.p+g.+g.+g.@+g.t+g.+g..$.p.//l//,/+g/+g/+g/+g/,/h///H///H/+g/+g/d+g/+g/ /t//4/+g/+g/+g/+g/+g/T+g/// T/ / 4/ / / T/ +g/ <+g/ +g/ (+g/ / //T//// /P+g/+g/+g/(+g/h+g/+g///@/p/+g/+g/H+g/+g/+g/+g/<+g/+g/+g/D+g/+g/+g/P+g/+g/ +g/d+g///$/T/+g/+g/+g/$+g/\+g/+g/+g/d+g///H////P////X///0///4/t// /`/// 4/ / / /!/!H/!t/!/!/"/"</"l/"/"+g/#+g/#H/#d/#/#/#/#/$,/$d/$+g/$+g/$+g/%+g/%\+g/%+g/%+g/%+g/&0+g/&d+g/&+g/&+g/'+g/'4+g/'l+g/'+g/'+g/(+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g/(8+g/(p+g/(+g/(+g/) +g/)L+g/)+g/)+g/)+g/*+g/*8+g/*\+g/*+g/*+g/*+g/++g/+D+g/++g/,+g/,+g/,+g/,+g/-+g/-D+g/-l+g/-+g/-+g/.+g/.<+g/.l+g/.+g/.+g// +g//<+g//p+g//+g//+g/0+g/0@+g/0p+g/0+g/0+g/0+g/1+g/1H+g/1+g/1+g/2d+g/2/3l/3/4`/4+g/58+g/5+g/5+g/68+g/6+g/7\+g/7+g/7+g/7+g/8+g/8X+g/8+g/8+g/8+g/9H+g+g+g+g+g+g+g+g+g+g+g+g+g/9+g/9+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g/:L+g/:p+g/:+g/:+g/;,+g/;X+g/;+g/;+g/<4+g/<+g/<+g/=L+g/=+g/>+g/>h+g/>+g/?D+g/?+g/?+g/@D+g/@+g/@+g/AD+g/A+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g/A+g/A+g/B+g/B<+g/Bh+g/B+g/B+g/B+g/C+g/CT+g/C+g/C+g/C+g/D+g/D(+g/DT+g+g+g+g+g/D+g/D+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g/E8+g/El+g/E+g/E+g/F(+g/FX+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g/F+g/F+g/F+g/G+g/GP+g/G+g/G+g/G+g/H,+g/H\+g/H+g/H+g/I+g/I@+g/It/I/J/Jx/J+g/K0+g/K+g/K+g/L<+g/L+g/L+g/M$+g/M+g/M+g/N0+g/Nl+g/N/N/O /OD/O|/O/P/PX/P/P/Q /QX/Q/Q/R/Rd/R/S/SX/S/T+g/T@+g/Tt+g/T+g/T+g/U+g/UX+g/U+g/U+g/U+g/V/VH/V/V+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g/V/W8/Wx/W/X+g/X4+g/Xl+g/X+g/X/Y /Yd/Y/Y+g/Z<+g/Z/Z/Z/Z/[/[</[`/[/[+g/[+g/\+g/\$+g/\L+g/\+g/]+g/]0+g/]\+g/]+g/]+g/]+g/^+g/^H+g/^x+g/^+g/^+g/^+g/_(+g/_P+g/_+g/_+g/_+g/`+g/`@+g/`p+g/`/`/a4/a|/a+g/b+g/bD+g/bt+g/b+g/b+g/c +g/c4+g/c\+g/c+g/c/c/d/d,/d`/d/d/e/eX+g/e+g/e+g/e+g/f+g/fL+g/f+g/f+g/f+g/g+g/g@+g/gx+g/g+g/g+g/h8+g/h+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g/h+g/i+g/i,/iH/id/i/i+g/j+g/jl+g/j+g/j+g/k+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g/k\+g/k+g/k+g/k+g/l+g/lH+g/l+g/l+g/l+g/m+g/m<+g/ml+g/m+g/m+g/m+g/n(+g/n\+g/n+g/n+g/n+g/o+g/oH+g/o|+g/o+g/o+g/p +g/p<+g/pl+g/p+g/p+g/q+g/q0+g/q`+g/q+g/q+g/q+g/r,+g/rT+g/r+g/r+g/r+g/s+g/sP+g/sx+g/s+g/s+g/t +g/t<+g/tt+g/t+g/t+g/t+g/u0+g/u`+g/u+g/u+g/u+g/v +g/vT+g/v+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g/v+g/w +g/w+g/w+g/w+g/w+g/x+g/x@+g/xl+g/x+g/y+g/y(+g/yP+g/y+g/y+g/zH+g/z+g/z+g/z/{@/{/{/|(+g/|X+g/|/|/|/}/}H+g/}+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g/~+g/~P+g/~+g/~+g/+g/T+g/+g/+g/+g/D+g/+g/+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g/+g/8+g/h+g/+g/+g/+g/ +g/X+g/+g/+g//8/h////$/L/t+g/+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g/8+g/p+g/+g/+g/H+g/+g//h//h//h//`/+g/0+g/+g/+g//D///+g/\+g/////+g/4+g/T+g/p+g/+g/+g/+g/+g/H+g/p+g/+g/+g/+g/H+g////</+g/+g/0+g/P+g/|////D+g/l+g/+g/+g/+g/D+g/+g/+g/0+g/\+g/+g/+g/`+g/+g////\///D//+g/\+g//T//4///@//+g/0+g/+g/+g/+g/@+g/|+g/+g/+g/ +g/D+g/h+g/+g/+g///H//+g/+g/0+g/h+g/+g/ +g/+g/+g/+g/+g///0/`////(+g+g+g+g/d+g/+g/$/P/|////8/d/+g/+g/+g/+g/8////p///$/d////P+g/+g/+g/P+g//,//8/+g/+g/x+g/+g/+g/+g/+g/(+g/P/x///+g/t+g/+g/ +g/p+g/+g+g+g+g+g/+g/+g/+g/P+g/+g/+g/+g/H+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g////T////0/p////+g/(+g/T/x///+g/ +g/H+g/p+g///P///L///L+g/+g/+g/+g/P////8+g/t+g////\/+g/+g/ +g/X+g/+g/+g//</x//+g/4+g/l////$/D/d/„/¨+g/+g/+g/+g/ +g/<+g/X+g/t+g/Ô+g/+g/T/Ą/Ĵ//4/p/Ŝ//$+g/p+g/+g/+g/D+g/Lj+g//$/d/ȼ//@/h/ɤ// /4/p/ʨ///@/x+g/+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g/4+g/H+g/`+g/p+gWWE333333333333333@@(#) non-Unicode@(#) $Id: //bas/722_REL/src/ccm/rsbr/bruxsub.c#3 $ SAPLLLLLLLLLLXLLLXLLLLLLLLLLLLLLLLLLLLXX`L\\XT4PT<,ɌʄDˤd$̈́pΠΠР<<<<       DDDDDLLLL X0T''/t7t>H?BD E\ItRZZZ ,Dd4X+g+g+h+h+h +h,+h8+hD+hP+hX+h`+hh+ht+h|+h+h+h+h+h+h+h+h+h+h+h+h+i+i +i+i +i,+i8+iD+iP+i\+ih+it+i+i+i+i+i+i+i+i+i+i+i+i+i+i+j+j+j+j(+j4+j@+jH+jP+j\+jh+jp+jx+j+j+j+j+j+j+j+j+j+j+j+j+k+k+k +k,+k8+kD+kT+kd+kx+k+k+k+k+k+k+k+l+l(+l<+lL+l\+ll+l+l+l+l+l+l+l+m+m+m +m8+mL+m`+mt+m+m+m+m+m+m+m+m+n +n$+n0+nD+n\+np+n+n+n+n+n+n+o+o+o(+o<+oT+od+ot+o+o+o+o+o+o+p+pBRXXXXXXX CdB@d f+g@xxxxxxxxlog+g3Ph3Pp@(#) non-Unicode@(#) $Id: //bas/722_REL/src/ccm/rsbr/brxxsub.c#3 $ SAP ` dTXp0,\l+p$+g+p$+g/̀+g/x+g/Έ+g/l+g/Ќ+g/Ѥ+g/+g/ӈ+g/P+g/(+g/ +g/ָ+g/p+g/D+g/@+g/+g/+g/ +g/L+g/ވ+g/+g/8+g/+g/+g/\+g/X+g/+g/D+g/,+g/+g/+g/+g/+g/d+g/L+g/+g/+g/l+g/+g/d+g/+g/+g/d+g/+g/`+g/+g0h+g0`+g0+g0+g0h+g0 T+g0 `+g0 <+g08+g0+g0(+g0+g0+g0+g0+g0+g0(+g0+g0+g0+g0 +g0!+g0#+g0%\+g0'(+g0(+g0*x+g0++g0,+g0.+g0/+g014+g02+g03+g05+g06X+g07+g09+g0<+g0>+g0AX+g0C+g0F+g0H+g0Jh+g0K+g0M,+g0Nx+g0O+g0P<+g0P+g0Q+g0Qx+g0Q+g0R@+g0R+g0R+g0SL+g0S+g0T +g0Tp+g0VH+g0Xl+g0Z+g0[+g0]8+g0^+g0`l+g0bH+g0c+g0d+g0f+g0ht+g0i+g0k,+g0l+g0n+g0o +g0pT+g0q+g0s+g0u+g0w+g0y+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g0z+g0{$+g0{+g0|+g0~H+g0x+g0+g0+g0+g0,+g0+g0 +g0L+g0+g0+g0+g0\+g0\+g0+g0<+g0<+g0h+g0+g04+g0+g0+g0+g0+g0`+g0+g0+g0P+g08+g0+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g0h+g0+g0+g0h+g0+g0@+g0+g0+g0h+g0`+g0Ȩ+g0+g+g+g+g+g+g+g+g+g+g+g+g+g+p(+g+p(+g0D+g0+g0Ш0,0Ѽ0X0+g0+g0+g0D+g0ِ0$00l0 +g0+g0+g0+g0h000$0+g0\+g0L00080+g0p+g0+g0|+g0+g0+g0 +g0+g0+g0+g0+g0+g0+g0p+g0+g0 +g0+g0+g0+g1+g1D+g1+g1@+g1|+g1+g1p+g1<+g1+g1 4+g1 @+g1\+g1p+g1+g1+g1+g1(+g1+g1+g1+g1l+g1+g1+g1`+g1 p+g1"+g1#+g1%(+g1'h+g1)+g1*H+g1*+g1++g1,1-(1-1.d1/11121517 19x1;1>T1@+g1A+g1B1Cx1DL1EH1F8+g1G+g1I81J1L1M1OL1P(1P1Q1R+g1T+g1W+g1W+g1X+g1X+g1Yl+g1[|+g1]+g1^ +g1^1`01a1c1eT+g1e+g1ft+g1g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g1g+g1h +g1h+g1i8+g1i+g1j+g1k+g1l+g1l+g1m4+g1m+g1nd+g1o0+g1p+g1q+g1q+g1r+g1r+g1s+g1t+g1v+g1v+g1v+g1x+g1z+g1{+g1|+g1~P+g1+g1x+g1+g1+g1+g1+g1+g1+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g1+g1+g1+g1d+g1t+g1<+g14+g1(+g1\+g1+g14+g1<+g1+g1+g1`+g1+g11`1(11111L1t+g1+g1+g1(+g1+g1H+g1+g1P+g1+g1(+g1t+g1+g1+g1<+g1+g1+g1ü1x1,11ƨ1ʐ11\18+g1+g1״+g1+g1811ߌ1L11111+g1+g1(+g1+g1+g1x+g1(+g1\+g1+g1H+g1+g1h+g1+g14+g1+g1+g1+g1T+g1+g1+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g2 +g2+g2+g2+g2+g2x+g2+g2@+g2+g2 +g2 P+g2+g2t+g2+g2+g2T+g2(+g2+g2+g2+g2 +g2+g2p+g2+g2P+g2+g2T+g2+g2!4+g2!+g2!+g2#+g2&+g2&+g2'+g2'+g2(L+g2)+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g2+L+g2,+g2.+g2/`+g2/2225282<(+g2=+g2>H+g2>+g2?(2A2B2D2F+g2G+g2H+g2I+g2Ix+g2K8+g2M@+g2O+g2Q+g2Q+g2R,+g2R+g2S+g2U+g2WT+g2Y(+g2[$+g2[+g2\+g2]+g2^t+g2^+g2_<+g2`X+g2a+g2b+g2c+g2d`+g2d+g2e+g2f+g2g$+g2g+g2h +g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g2h+g2j +g+g+g+g+g2l+g2l+g2m$+g2n+g2p<+g2p+g2p+g2qP+g2q+g2rP+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g2r+g2s+g2u+g2u+g2v+g2yH+g2|(+g2|+g2}+g2~H+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g2~+g2+g2+g2+g2d222+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g2\+g2+g2H+g2+g2t+g2+g2P+g2+g2d+g2X+g2+g2+g2P+g2\+g+p$+g+p$+g2l+g2,+g2+g24+g2T+g2t+g+g+g+g+g2+g2+g2+g2+g2$+g2D+g2h+g2+g2+g2+g2+g2 +g2P+g2h+g2+g2+g2+g2+g20+g2L+g2t+g2+g2+g2$+g2d+g2+g2+g2$+g2\+g2+g2+g2+g2+g2P+g2+g2+g2 +g2P+g2+g2+g28+g2+g2+g20+g2l+g2+g2+g2+g2+g2D+g2+g2+g2+g2,+g2l+g2+g2+g2+g2\+g2+g2+g2+g20+g2d+g2+g2+g2,+g2l+g2+g2+g28+g2t+g2+g2+g2<+g2l+g2+g2+g2(+g2h+g2+g2+g28+g2t+g2+g2+g2H+g2d+g2+g2+g2+g2+g2+g2$+g2H+g2d+g2+g2+g2+g2+g2D+g2|+g2+g2+g2<+g2t+g2+g2+g2,+g2h+g2+g2+g2 +g2X+g2œ+g2+g2 +g2X+g2Ø+g2+g2+g2L+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g2Ĉ+g2İ+g2+g2+g2H+g2|+g2Ŵ+g2+g2+g2L+g2ƈ+g2+g2+g2@+g2DŽ+g2Ǭ+g2+g2 +g2D+g2t+g+g+g+g+g2Ȱ+g2+g2 +g24+g2d+g2Ɍ+g2ɼ+g2+g2+g2@+g2t+g2ʜ+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g2+g2+g24+g2`+g2ː+g2˴+g2+g2+g20+g2T+g2̄+g2̨+g+g+g+g+g+g+g+g+g+g+g+g+g2+g2+g2+g2 +g2`2`2͔2͔2+g2 +g2L+g2΀+g22222\+g2ό+g2+g2 +g2\2\2И2И2+g2+g2@2@2ш2ш2+g2+g2`+g2Ҡ+g2+g2+g2T+g2Ӝ+g2+g2,+g2p+g2԰+g2+g2,+g2h+g2դ+g2+g2+g2T+g2ք+g2+g2+g2+g28+g2`+g2ל+g2+g2 +g2h+g2ؼ+g2+g2l+g2+g2+g2h+g2ڠ+g2+g20+g2ۄ+g2+g2(+g2`+g2+g2,+g2p+g2԰+g2ܨ+g2+g2+g2,+g2\+g2|+g2ݰ242l282x222D2222T2+g2+g2<2222`+g2+g22T222,2t222H+g2x+g2+g2+g2+g24+g2p+g2+g2+g2+g2L+g2+g2+g2+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g2 +g24+g2d+g2+g2+g2+g2+g2@+g2p+g2+g2+g2+g2(+g2L+g2+g2+g2+g2+g24+g2\+g2+g2+g2+g2+g2H+g2h+g2+g2+g2+g2$+g2`+g2+g2+g2+g2T+g2|+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g2+g2+g2+g20+g2`+g2+g2+g2+g2+g2$+g2D+g2x+g2+g2+g2+g2+g2H+g2h+g2+g2+g2+g2+g2+g24+g2X+g2+g2+g2+g2+g2(+g2L+g2p+g2+g2+g2+g2+g24+g2P+g2p+g2+g2+g2+g2+g2+g2 +g2<+g2`+g2+g2+g2+g2+g2+g28+g2T+g2t+g2+g2+g2+g2+g2+g2<+g2T+g2p+g2+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g2+g2+g2 +g2D+g2p+g2+g2+g2+g2+g2H+g2+g2+g2+g2+g2H+g2d+g2+g2+g2+g2+g2,+g2L+g2x+g2+g2+g2+g2+g2,+g2X+g2x+g2+g2+g2+g3 +g3<+g3\+g3+g3+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g3+g3+g3(+g3L+g3x+g3+g3+g3+g3+g30+g3T+g3x+g3+g3+g3+g3+g3$+g3H+g3t+g3+g3+g3+g3+g38+g3`+g3+g3+g3+g3+g38+g3\+g3x+g3+g3+g3+g3+g3,+g3D+g3l+g3+g3+g3+g3+g3$+g3\+g3+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g3+g3+g+g+g+g+g3+g3D+g3|+g3+g3+g3 +g3 L+g3 t+g3 +g3 +g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g3 +g3 4+g3 l+g3 +g3 +g3 +g3 (+g3 \+g3 +g3 +g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g3 +g3 +g3 8+g3 d+g3 +g3 +g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g+g3 +g3 8+g3 p+g3 +g3 +g3+g3D+g3t+g3+g3+g3+g3,+g3`+g3l+g@(#) non-Unicode@(#) $Id: //bas/722_REL/src/ccm/rsbr/brtools.c#3 $ SAP7.20 (42)00000000000000+_ԍ+_ +_,W[+_8 +_,W\+_t3+_+_(+_m+_+_n+`+`81+`D +`p!+`| +`>+` +`a+` +a(\+a4 +a(]+ad +an+a+a2?+a)+b+b$ +bL+bX+b+b+bՕ+b,+b"+c +b"+c(#+cTA+c`+c+c+c+c7+dJ+ds+d8|+dD+dl+dx+dl+d+d)Y+d+df+e+e0*+e<+ed+ep +ex+e!+eE+e"+f"+f #+f4+f@$+fhBE+ft%+f+f&+f +f'+gl+g(+g83+gD)+gl gg+gx*+g J+g+g1+gT4lLD@(#) non-Unicode@(#) $Id: //bas/722_REL/src/ccm/rsbr/brntsub.c#3 $ SAP@(#) non-Unicode@(#) non-Unicode       @@  @(#) non-Unicode cc?@(#) non-Unicode@(#) non-Unicodew0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-x@(#) non-Unicode??      !1Aa  0@` #+3;CScstt$,<HXh@(#) non-Unicode444 44(484H4X4h4x444444444444444 4,484D@(#) non-Unicode@(#) $Id: //bas/722_REL/src/ccm/rsbr/brcopy.c#2 $ SAP(D0@x8 Hlpp4U@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/sap/sappar0.c#1 $ SAP4VRSecSSFsKeyRSecSSFsDataRSecSSFsLockAWA,`[z4V@(#) non-Unicode4|04|@4|P4|\@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/dptrc/dptrace.c#1 $ SAP@(#) non-Unicode@(#) non-Unicode@(#) non-Unicode@(#) non-Unicode@(#) non-Unicode@(#) non-Unicode@(#) non-Unicode@(#) non-UnicodeLx  D<\r@@(#) non-Unicoded@(#) non-Unicode@(#) non-Unicode@(#) non-Unicode@(#) non-Unicode@(#) $Id: //bas/722_REL/src/flat/nlsui5.c#1 $ SAP@(#) non-Unicode@(#) $Id: //bas/722_REL/src/flat/nlsui1.c#1 $ SAP@(#) non-Unicode 3 3 3 3 4 4 4 4 4  4( 40 48 4@ 4H 4P 4X 4` 4h 4p 4x 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 5 5 5H 5P 5X 5` 5h 5p 5x 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 3 6 6 6 6 6  6( 60 68 3 6@ 3 6H 3 6P 3 6X 3 6` 3 6h 3 6p 3 6x 3 6 3 6 3 6 3 6 3 6 3 6 3 6 3 6 3 6 3 6 3 6 3 6 3 6 3 6 3 6 3 6 3 7 3 7 3 7 3 7 3 3 7  3 7( 3 70 3 78 3 7@ 3 7H 3 7P 3 7X 3 3 7` 3 7h 3 7p 3 7x 3 7 3 7 3 7 3 7 3 7 3 7 3 7 3 7 3 7 3 7 3 7 3 7 3 7 3 7 3 7 3 7 3 8 3 8 3 8 3 3 8 3 8  3 8( 80 3 3 3 88 3 8@ 3 3 8H 3 3 3 8P 3 3 3 3 3 8X 3 3 8` 3 3 3 8h 3 3 3 3 3 3 3 8p 3 8x 3 8 3 3 8 3 3 3 3 8 3 3 8 3 3 3 8 3 8 3 3 8 3 3 3 8 3 8 3 3 3 3 3 8 8 3 8 8 3 8 8 3 8 3 8 3 8 3 8 3 9 3 9 3 9 3 9 9  3 9( 3 90 3 98 3 9@ 3 9H 3 9P 3 9X 3 9` 3 9h 3 3 9p 9p 3 9x 3 3 3 9 3 9 3 9 3 9 3 9 3 9 3 9 3 9 3 9 3 9 3 9 3 9 3 9 3 9 3 9 3 9 3 : 3 : 3 : 3 : 3 3 3 :  3 :( 3 :0 3 :8 3 :@ 3 :H 3 :P 3 :X 3 :` 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 :h :p 3 :x : 3 : 3 : 3 3 3 3 : 3 3 : 3 3 3 3 : : 3 3 3 3 3 : 3 3 : 3 3 : 3 3 3 3 3 3 3 3 3 3 : 3 3 : 3 3 3 3 : 3 : : 3 3 3 3 3 3 : ; ;$ ;, ;4 3 ;< ;D ;L ;T ;\ ;d ;l ;t ;| ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; < <  < < 3 ;D ;t 3 3 3 ; ; 3 3 3 3 <$ 3 <, 3 <4 3 << 3  > > 3 > 3 >  3 >( 3 >0 3 >8 3 >@ 3 >H 3 >P 3 >X 3 >` 3 >h 3 >p 3 >x 3 > 3 > 3 > 3 > 3 3 3 3 3 3 3 3 3 3 3 > 3 > 3 > 3 > 3 > 3 > 3 > 3 > 3 > 3 > 3 > 3 > 3 ? 3 ? 3 ? 3 ? 3 ?  3 ?( 3 ?0 3 ?8 3 ?@ 3 ?H 3 ?P 3 ?X 3 ?` 3 ?h 3 3 ?p 3 ?x 3 3 3 ? 3 3 3 ? 3 3 3 3 ? 3 ? 3 ? 3 ? 3 ? 3 ? 3 ? 3 ? 3 ? 3 ? 3 ? 3 ? 3 ? 3 ? 3 @ 3 @ 3 @ 3 @ 3 @  3 3 3 @( @p @x @ @ @ @ @ @ @ @ @ @ @ @ @ @ A 3 A  3 A( 3 A0 3 A8 3 A@ 3 AH 3 AP 3 AX 3 A` 3 Ah 3 Ap 3 Ax 3 A 3 A 3 A 3 A 3 A 3 A 3 A 3 A 3 A 3 A 3 A 3 A 3 A 3 A 3 A 3 A 3 B 3 B 3 B 3 B 3 B  3 B( 3 B0 3 B8 3 B@ 3 BH 3 BP 3 BX 3 B` 3 Bh 3 Bp 3 Bx 3 B 3 B 3 B 3 B 3 B 3 B 3 B 3 B 3 B 3 B 3 B 3 B 3 B 3 B 3 B 3 B 3 C 3 C 3 C 3 C 3 C  3 C( 3 C0 3 C8 3 C@ 3 CH 3 CP 3 CX 3 C` 3 Ch 3 3 3 3 3 B 3 3 3 3 3 Cp 3 Cx 3 C 3 C 3 C 3 C 3 C 3 C 3 C 3 C 3 C 3 C 3 C 3 C 3 C 3 C 3 C 3 C 3 D 3 D 3 D 3 D 3 D  3 D( 3 D0 3 D8 3 D@ 3 DH 3 DP 3 DX 3 D` 3 Dh 3 Dp 3 Dx 3 D 3 D 3 D 3 D 3 D 3 D 3 D 3 D 3 D 3 D 3 D 3 3 3 3 3 3 D D D D D E E E 3 3 3 3 3 3 3 3 E E  E( E0 E8 E@ 3 3 3 3 3 3 3 3 3 3 EH EP EX E` Eh Ep Ex E 3 3 3 3 3 3 3 3 E E E E E E E E 3 3 3 3 3 3 3 3 E E E E E E 3 3 3 3 3 3 3 3 3 3 3 E 3 F 3 F 3 F 3 3 3 3 3 3 3 3 F F  F( F0 F8 F@ FH FP 3 3 3 3 3 3 3 3 FX F` Fh Fp Fx F F F F F F F F F 3 3 F F F F F F F G 3 3 3 3 3 3 3 3 G G G G  G( G0 G8 G@ 3 3 3 3 3 3 3 3 GH GP GX G` Gh Gp Gx G 3 3 3 3 3 3 3 3 G G 3 G 3 3 3 3 3 3 3 3 3 3 ;| 3 3 3 3 G 3 3 3 3 3 3 3 3 3 3 3 3 G G 3 3 3 3 3 3 3 3 3 3 3 3 3 3 G G 3 3 3 G 3 3 3 3 3 3 3 3 3 3 3 3 3 G H  H H H$ H, H4 H< HD HL HT H\ Hd Hl Ht H| H H H H H H H H H H H H I I I I( I4 I@ IL IX Id Ip I| I I I I I I I I I I J J  J J$           ( 0 8 @ H P X ` h p x                   <  D L  T  \    d l  t  |                                  $  ,   4  < D  L T \  d  l t    |                                                      $ $  ,  4 < D  L  T  \  d  l  t  |                                             $ T \ d l t |                       $ , 4 < *  * * *  *  * *  * * * * * * * + + + + +  +( +0 +8 +@ +H  +P +X +` +h +p +x *T + + +            + + + + + + + + + + + , ,  , , ,$ ,, ,4 ,< ,D ,L ,T ,\ ,d ,l ,t ,| , , , , , , , , , , , , , , , , - -  - - -$ -T -\ -d -l -t -| - - - - - - - - - - -                . .  . . .$ ., .4 .<         .D .L .T .\ .d .l           .t .| . . . . . .         . . . . . . . .         . . / /  / /            /$  /,  /4  /<         /D /L /T /\ /d /l /t /|                         / / / / / / / /         / / / / / / / /         0 0  0 0 0$ 0, 04 0<         0D 0L 0T 0\ 0d            0l 0t 0| 0 0            0 0 0 0             0 0 0 0 0            0 0 0 0 0 18 1@ 1H 1P 1X 1` 1h 1p 1x 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2$ 20 2< 2H 2T 2` 2l 2x 2 2 2 2 2 2 2 2 2 2 2 3 3 3  3, 38 3D 3P@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/rscp/rscpsca7.c#1 $ SAP@(#) non-Unicode5151515151515252(52D52\52x52525252525252525353$53853L53d53p5353535353535353535353545454$54454D54X54h54x54545454545454555555(55455@55P55`55l55x5555555555555555565656(56856D56P56`56p56p565656565656565656575757 57057@57P57`57p575757575757575758 5858(58858H58\58p58585858585858595959059@59P59`59t59595959595959595:5:@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/ni/nixx.c#2 $ SAP!!!$!!!!$!}!}!}!}!}!}!}!}!}!}!}!}!}!}!~!~!}!P,!P@!P@!PT!Ph!OH!OH!OH!Ph!P,!OH!OH!Ph!OH!OH!OH!P,!MD!M\!M\!MD!Mt!Mt!M!M!Mt!MD!M!M!Mt!M!M!M!MD D L T \ d l t |5qp5q5q5q5q5q5q5q5q5r 5r5r,5r85rP5rd5rp5rx5r5r5r5r5r5r5r5r5r5r5s5s5s$5s45sH5s\5st5s5s5s5s5s5s5s5s5s5s5t5t5t$5t45tD5tT5th5tx5t5t5t5t5t5t5t5t5u5u5u05u@5uT5ud5ut5u5u5u5u5u5u5u5u5v5v5v,5v@5vP5vd@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/ni/nixxi.cpp#1 $ SAP""P"""x"`"H"0"""""p"""8"P" """"""""P"""X"p"P"X"X"@"(""""" """x"""""`"""""""",$$$$$$$$$$$$$l$$$$##<#T#X#####D# ###<#x#ʜ##˘####H#t#Ҡ#D#p###|######$####,#\#######,#k#m$#m$#m$#m$#m$#m$#m$#m$#m$#m$#m$#m#n #m$##############t###"8##$","""""""""x"d"P"<"(""""""""l"T"<"$"@" """"@"""|"d"L"4"""5o55 5$5(@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/dptrc/err.c#1 $ SAP5,545@5H5P5\5d5h5p5x55555555$s$w$$wp$wp$wp$wp$wp$s$w|$wp$w$wp$w$x($x($wp$x($wp$_T$_l$_$_$_$_$_$_$`$`,$`D$`\$`t$`rX            [.<(+!&]$*);^-/Ѧ,%_>?`:#@'="abcdefghijklmnopqrƤ~stuvwxyzޮ|{ABCDEFGHI }JKLMNOPQR\STUVWXYZ0123456789 7-./% <=2&?'@@@@O{[lP}M]\Nk`Kaz^L~no|JZ_myС@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@Aj@ڛdebfcghtqrsxuvwi쿀YDEBFCGHTQRSXUVWIp܍@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/rscp/rscpsce8.c#1 $ SAP@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/rscp/rscpsc5.c#1 $ SAP@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/rscp/rscpsc2.c#1 $ SAP 7-./  % <=2&?'@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/rscp/rscpsc6.c#1 $ SAP, FAST-ATT-NEWSID:ANON:SID%3aANON%3a@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/dptrc/sapxxpr.c#1 $ SAP@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@O{[lP}M]\Nk`Kaz^L~noc_myCY@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@A|@@ڛdebfJghtqrsxuvwi࿀ZDEBFGHTQRSXUVWIjpЍ {.<(+!&~$*);^-/[,%_>?`:#'="abcdefghiޱjklmnopqr Ƥstuvwxyz@|ABCDEFGHI JKLMNOPQR}STUVWXYZ\0123456789] 5o5p5p5p45pH5pX5p|5p5p5q 5q(5qP5o555555$54@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/si/siux.cpp#1 $ SAP%3H%3P%3H%3X%3X%3X%3X%3`%3h%3h%3p%3x%3x%3%3%3%3%3%3%3%3%3%3%3%3%3%3%3%3%3%3%3%3%3%3%3%3%3%4%3%3%4%4%4%4%3%4 $׼$$$$$$$$$$$$$4$$4$$$$$$$$L$d$$4$$$$H$$$$$$$$$$$$$l$$$$$Ր$մ$$$մ$$$$$$$$$l$$$$$$$$$մ@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/si/sixx.cpp#1 $ SAP%9 %9(%94%9@%9L%9X%9d%9p%9|%9%9%9%9%9%9%9%9%9%=H%=P%=X%=`%=h%=p%=x%=%=%=%=%=%=%=%=%=%=%=%=%=%=%=%=%>%>%>%>%> %>(%>0%>8%>@%>H%>P%>X%>`%>h%>p%>x%>%>%>%>%>%>%>%>%:@%:L%:X%:d%:p%:|%:%:%:%:%:%:%:%:%:%:%:%;5Р5Ш5а55555 55,5<5H5T5d5t5р5ь5ј5Ѥ5Ѵ@(#) non-Unicodeޭp8 @(#) $Id: //bas/722_REL/src/krn/ni/nixxacl.cpp#1 $ SAP555(585H5X5l@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/ni/nixxri.cpp#1 $ SAP0rrsrsrs05<5T5l5|5ی5ۜ5۬5ۼ55555$545H5`5x5܌5ܠ5ܰ5@(#) non-UnicodeޭP@@sHs`rsxsssssts0585D5T5h5|5@(#) non-Unicode5(5<5P5`5t55@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/ni/niuxi.c#1 $ SAP5t t8rtPthttttttu555505D5`5|55555555@(#) non-Unicode555555555,5u(u@ruXupuuuuuvv555$545H5\5p5|@(#) non-Unicode5o@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/rscp/rscpscb7.c#1 $ SAP6 6,686D6P6\6h6t666666666 66(646D6\6l6|66666666 6 646@6P6`6p6666666666(686D6X6h6x666@(#) non-UnicodevHv`vxvvv@(#) $Id: //bas/722_REL/src/krn/ni/nibuf.cpp#2 $ SAP'@'p'X'''&&&&&&\&&&h&|&&&&6(6(6(6)6)6) 6)06)<6)H6)X6)h6)t6)6)6)6)6)6)6)6)6)6*6*6*$6*46*H6*\6*l6*|6*6*@(#) non-Unicodeޭh@(#) $Id: //bas/722_REL/src/krn/ni/nixxsel.cpp#1 $ SAPޭvwޭvw6<6<6<6<6<6<6<6=6=6=(6=86=D6=T6=d6=t6=t6=6=6=6=6=6=6=6=6=6>6>6>,6>86>H6>X6>l6>l6>|6>6>6>6>6>6>6>6>6>6? 6?6?(6?86?H6?X6?h6?x6?6?6?6?6?6?6?6?6@6@ 6@6@,6@<6@<6@L6@`6@h@(#) non-Unicodeޭp@(#) $Id: //bas/722_REL/src/krn/si/sixxsel.cpp#1 $ SAPޭXHXH`0xXpHw8wPwhwwwwwwxx(x@xXxpxxxxxyyy0yHy`yxyyyyyzz z8zPzhzzzzzz{{({@{X{p{{{{{|||0|H|`|x|||||}} }8}P}h}}}}}}~~(~@~X~p~~@(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/fi/fixx.c#1 $ SAP~~0H`x 8Phwwwwx(x@xX(xxx@Xyp0H`x 8Ph5o5o5o6N@6NL6N\@(#) non-Unicode5o@(#) non-Unicode@(#) $Id: //bas/722_REL/src/flat/sapstr.c#1 $ SAP4W\6PP @(#) non-Unicode6Q@(#) non-Unicode @(#) non-Unicode@(#) $Id: //bas/722_REL/src/krn/perf/pfclock.c#2 $ SAP===6T6T6T6T6T6U06U06U06Ut6U6Ut6U6Ut6U6U6U6U@(#) non-Unicode6S6T @(#) non-Unicode**4****6U@(#) non-Unicode6W(@(#) non-Unicode6W@(#) non-Unicode6YP@(#) non-Unicodew0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-6Y@(#) non-Unicode6\@(#) non-Unicode6_@(#) non-Unicodersecstoc@(#) non-Unicodersecstorqu%4=>[@(#) $Id: //bas/722_REL/src/krn/rsec/rsecstoc.c#2 $ SAPABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=l| @(#) non-Unicode      @     )4%/7(3-!0,1'8"5.*2$ @(#) $Id: //bas/722_REL/src/krn/rsec/rsecdes.c#1 $ SAP91)! :2*" ;3+# <4,$?7/'>6.&=5-%  :2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'(08@ '/7?&.6>%- 5=$, 4<#+ 3;"* 2:!) 19                                                                                                                           6a@(#) non-Unicode@(#) non-Unicode7.20 (42)@(#) non-Unicode@(#) $Id: //bas/722_REL/src/proj/sapversion/sapversion.c#1 $ SAP@_7`$/$$$$%%@%`%@%%%%%%@%%%`%`&1&V&b&d&d`&d&* &3`&E@&`&W&p&& &`&&&l&q&|`&@&& && &&@&&'(&@(&(:(F(H(I@(I(J`(K(K(L (L(M (M(N@(N(O(P(P(Q (Q(W(R@(X(]`(d(g(h(q(s(v(w(`(@(((@(((@(((( ((((((À(( (Ԁ(ր(܀((@( ((`((`(@((@((((`( ))`))`))))@))$)")# )`)p`)%)*@)1)5 )6 ):@)= )A)A`)S)U)Z)[)[)\)^)e)c@)c)X' (9x(9(9(9(9(9(9''ˠ' '`''''''(((`(((% (9@(&'`(,`(.@(0`(2(4(6@(6&@###`)*-2 Qf+Yq Pq@(0+_3Phhq3!! !%(h%h%,,--- --x- -(-0-8-@-H-P-X-\-`-d-h-p-|-3P3X3`3p3x33333333333@5xmxX`dhp4 x (4 x4 (48@r4h4`hXݘ`4Ur(ݨݸ4|04P4440X4xx4@4@4 AH4(X((5- i)P)X4U)`)h)p0@515op0H: :(:8 j5:@<@P>B`5 krprrDDDDEEEEE E(E0E8E@EH5H5ʐ5Ј5Ќ5А5Д5И5МKKK5РL5MMMMNH5NPPPp58P5(555Q8Q@Q55R@RRS566S`Sh666Sx6666666 6 kH6v0666 SW6<6(YHYPYXY`YhYpYxY6<]@]^_(_`6M l`~6N6N 6N6N6N6N6N a6N$6N(6N,b0bcpdd`6N0dh6N46N8d6N<d6N@ `6P6P6P 6P6P6P6P6P 6P$6P(6P,6P06P46P86P<6P@6PD6PH6PL(de eeX6Qee 6R@Xf6PP6Sf6T f6U6W(6WgXg6Y6\l6_lDlH6a mm 6ah6ap6ap6c Ai*H*8@ @@ @ %@ -@ 5@ =@ I@ P@ X@ _@ p@ ~@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ !@ 0@ ?@ M@ [@s@@@@@@@@ @ @ @ @ @ @ @ @ '@ 0@ <@ F@ O@ Y@ b@ l@ u@ @ @ @ @ @ @ @ @ @ @ @ @ @ @  @ @ @ (@ 3@ >@ G@ P@ Z@ b@ i@ s@ }@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ !@ )@ 3@ =@ D@ O@ W@ _@ h@ p@ y@ @ @ @ @ @ @ @ @ @ @ @ @ @  @ @ @ 0@ 9@ C@ K@ U@ ^@ j@ r@ y@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @  @ @ @ %@ 0@ :@ E@ P@ Z@ i@ q@ z@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ *@ 6@ D@ N@ ]@ k@ v@ @ @ @ @@@@@@ @@ 3@ AH MH Y@ e@ q@ @ qX! ?? ? ?(?0?x?3H??????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?!?!?!?!?! ?!(?!0?!8?!@?!H?!P?!X?!`?!h?!p?!x?!?!?!?!?!?!?!?!?!?!?!?!?!?!?!?!?"?"?"?"?" ?"(?"0?"8?"@?"H?"P?"X?"`?"h?"p?"x?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?#?#?#?#?# ?#(?#0?#8?#@?#H?#P?#X?#`?#h?#p?#x?#?#?#?#?#?#?#?#?#?#?#?#?#?#?#?#?$?$?$?$?$ ?$(?$0?$8?$@?$H?$P?$X?$`?$h?$p?$x?$?$?$?$?$?$?$?$?$?$?$?$?$?$?$?$?%?%?%?%?% ?%(?%0?%8?%@?%H?%P?%X?%`?%h?%p?%x?%?%?%?%?%?%?%?%?%?%?%?%?%?%?%?%?&?&?&?&?& ?&(?&0?&8?&@?&H?&P?&X?&`?&h?&p?&x?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?'?'?'?'?' ?'(?'0?'8?'@?'H?'P?'X?'`?'h?'p?'x?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?(?(?(?(?( ?((?(0?(8?(@?(H?(P?(X?(`?(h?(p?(x?(?(?(?(?(?(?(?(?(?(?(?(?(?(?(?(?)?)?)?)?) ?)(?)0?)8?)@?)H?)P?)X?)`?)h?)p?)x?)?)?)?)?)?)?)?)?)?)?)?)?)?)?)?)?*?*?*?*?* ?*(?*0?*8?*@?*H?*P?*X?*`?*h?*p?*x?*?*?*?*?*?*?*?*?*?*?*?*?*?*?*?*?+?+?+?+?+ ?+(?+0?+8?+@?+H?+P?+X?+`?+h?+p?+x?+?+?+?+?+?+?+?+?+?+?+?+?+?+?+?+?,?,?,?,?, ?,(?,0?,8?,@?,H?,P?,X?,`?,h?,p?,x?,?,?,?,?,?,?,?,?,?,?,?,?,?,?,?,?-?-?-?-?- ?-(?-0?-8?-@?-H?-P?-X?-`?-h?-p?-x?-?-?-?-?-?-?-?-?-?-?-?-?-?-?-?-?.?.?.?.?. ?.(?.0?.8?.@?.H?.P?.X?.`?.h?.p?.x?.?.?.?.?.?.?.?.?.?.?.?.?.?.?.?.?/?/?/?/?/ ?/(?/0?/8?/@?/H?/P?/X?/`?/h?/p?/x?/?/?/?/?/?/?/?/?/?/?/?/?/?/?/?/?0?0?0?0?0 ?0(?00?08?0@?0H?0P?0X?0`?0h?0p?0x?0?0?0?0?0?0?0?0?0?0?0?0?0?0?0?0?1?1?1?1?1 ?1(?10?18?1@?1H?1P?1X?1`?1h?1p?1x?1?1?1?1?1?1?1?1?1?1?1?1?1?1?1?1?2?2?2?2?2 ?2(?20?28?2@?2H?2P?2X?2`?2h?2p?2x?2?2?2?2?2?2?2?2?2?2?2?2?2?2?2?2?3?3?3?3?3 ?3(?30?38?3@?3H?3P?3X?3`?3h?3p?3x?3?3?3?3?3?3?3?3?3?3?3?3?3?3?3?3?4?4?4?4?4 ?4(?40?48?4@?4H?4P?4X?4`?4h?4p?4x?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?5?5?5?5?5 ?5(?50?58?5@?5H?5P?5X?5`?5h?5p?5x?5?5?5?5?5?5?5?5?5?5?5?5?5?5?5?5?6?6?6?6?6 ?6(?60?68?6@?6H?6P?6X?6`?6h?6p?6x?6?6?6?6?6?6?6?6?6?6?6?6?6?6?6?6?7?7?7?7?7 ?7(?70?78?7@?7H?7P?7X?7`?7h?7p?7x?7?7?7?7?7?7?7?7?7?7?7?7?7?7?7?7?8?8?8?8?8 ?8(?80?88?8@?8H?8P?8X?8`?8h?8p?8x?8?8?8?8?8?8?8?8?8?8?8?8?8?8?8?8?9?9?9?9?9 ?9(?90?98?9@?9H?9P?9X?9`?9h?9p?9x?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?:?:?:?:?: ?:(?:0?:8?:@?:H?:P?:X?:`?:h?:p?:x?:?:?:?:?:?:?:?:?:?:?:?:?:?:?:?:?;?;?;?;?; ?;(?;0?;8?;@?;H?;P?;X?;`?;h?;p?;x?;?;?;?;?;?;?;?;?;?;?;?;?;?;?;?;?<?<?<?<?< ?<(?<0?<8?<@??>?>?>?> ?>(?>0?>8?>@?>H?>P?>X?>`?>h?>p?>x?>?>?>?>?>?>?>?>?>?>?>?>?>?>?>?>?????????? ??(??0??8??@??H??P??X??`??h??p??x?????????????????????????????????@?@?@?@?@ ?@(?@0?@8?@@?@H?@P?@X?@`?@h?@p?@x?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?A?A?A?A?A ?A(?A0?A8?A@?AH?AP?AX?A`?Ah?Ap?Ax?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?B?B?B?B?B ?B(?B0?B8?B@?BH?BP?BX?B`?Bh?Bp?Bx?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?C?C?C?C?C ?C(?C0?C8?C@?CH?CP?CX?C`?Ch?Cp?Cx?C?C?C?C?C?C?C?C?C?C?C?C?C?C?C?C?D?D?D?D?D ?D(?D0?D8?D@?DH?DP?DX?D`?Dh?Dp?Dx?D?D?D?D?D?D?D?D?D?D?D?D?D?D?D?D?E?E?E?E?E ?E(?E0?E8?E@?EH?EP?EX?E`?Eh?Ep?Ex?E?E?E?E?E?E?E?E?E?E?E?E?E?E?E?E?F?F?F?F?F ?F(?F0?F8?F@?FH?FP?FX?F`?Fh?Fp?Fx?F?F?F?F?F?F?F?F?F?F?F?F?F?F?F?F?G?G?G?G?G ?G(?G0?G8?G@?GH?GP?GX?G`?Gh?Gp?Gx?G?G?G?G?G?G?G?G?G?G?G?G?G?G?G?G?H?H?H?H?H ?H(?H0?H8?H@?HH?HP?HX?H`?Hh?Hp?Hx?H?H?H?H?H?H?H?H?H?H?H?H?H?H?H?H?I?I?I?I?I ?I(?I0?I8?I@?IH?IP?IX?I`?Ih?Ip?Ix?I?I?I?I?I?I?I?I?I?I?I?I?I?I?I?I?J?J?J?J?J ?J(?J0?J8?J@?JH?JP?JX?J`?Jh?Jp?Jx?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?K?K?K?K?K ?K(?K0?K8?K@?KH?KP?KX?K`?Kh?Kp?Kx?K?K?K?K?K?K?K?K?K?K?K?K?K?K?K?K?L?L?L?L?L ?L(?L0?L8?L@?LH?LP?LX?L`?Lh?Lp?Lx?L?L?L?L?L?L?L?L?L?L?L?L?L?L?L?L?M?M?M?M?M ?M(?M0?M8?M@?MH?MP?MX?M`?Mh?Mp?Mx?M?M?M?M?M?M?M?M?M?M?M?M?M?M?M?M?N?N?N?N?N ?N(?N0?N8?N@?NH?NP?NX?N`?Nh?Np?Nx?N?N?N?N?N?N?N?N?N?N?N?N?N?N?N?N?O?O?O?O?O ?O(?O0?O8?O@?OH?OP?OX?O`?Oh?Op?Ox?O?O?O?O?O?O?O?O?O?O?O?O?O?O?O?O?P?P?P?P?P ?P(?P0?P8?P@?PH?PP?PX?P`?Ph?Pp?Px?P?P?P?P?P?P?P?P?P?P?P?P?P?P?P?P?Q?Q?Q?Q?Q ?Q(?Q0?Q8?Q@?QH?QP?QX?Q`?Qh?Qp?Qx?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?R?R?R?R?R ?R(?R0?R8?R@?RH?RP?RX?R`?Rh?Rp?Rx?R?R?R?R?R?R?R?R?R?R?R?R?R?R?R?R?S?S?S?S?S ?S(?S0?S8?S@?SH?SP?SX?S`?Sh?Sp?Sx?S?S?S?S?S?S?S?S?S?S?S?S?S?S?S?S?T?T?T?T?T ?T(?T0?T8?T@?TH?TP?TX?T`?Th?Tp?Tx?T?T?T?T?T?T?T?T?T?T?T?T?T?T?T?T?U?U?U?U?U ?U(?U0?U8?U@?UH?UP?UX?U`?Uh?Up?Ux?U?U?U?U?U?U?U?U?U?U?U?U?U?U?U?U?V?V?V?V?V ?V(?V0?V8?V@?VH?VP?VX?V`?Vh?Vp?Vx?V?V?V?V?V?V?V?V?V?V?V?V?V?V?V?V?W?W?W?W?W ?W(?W0?W8?W@?WH?WP?WX?W`?Wh?Wp?Wx?W?W?W?W?W?W?W?W?W?W?W?W?W?W?W?W?X?X?X?X?X ?X(?X0?X8?X@?XH?XP?XX?X`?Xh?Xp?Xx?X?X?X?X?X?X?X?X?X?X?X?X?X?X?X?X?Y?Y?Y?Y?Y ?Y(?Y0?Y8?Y@?YH?YP?YX?Y`?Yh?Yp?Yx?Y?Y?Y?Y?Y?Y?Y?Y?Y?Y?Y?Y?Y?Y?Y?Y?Z?Z?Z?Z?Z ?Z(?Z0?Z8?Z@?ZH?ZP?ZX?Z`?Zh?Zp?Zx?Z?Z?Z?Z?Z?Z?Z?Z?Z?Z?Z?Z?Z?Z?Z?Z?[?[?[?[?[ ?[(?[0?[8?[@?[H?[P?[X?[`?[h?[p?[x?[?[?[?[?[?[?[?[?[?[?[?[?[?[?[?[?\?\?\?\?\ ?\(?\0?\8?\@?\H?\P?\X?\`?\h?\p?\x?\?\?\?\?\?\?\?\?\?\?\?\?\?\?\?\?]?]?]?]?] ?](?]0?]8?]@?]H?]P?]X?]`?]h?]p?]x?]?]?]?]?]?]?]?]?]?]?]?]?]?]?]?]?^?^?^?^?^ ?^(?^0?^8?^@?^H?^P?^X?^`?^h?^p?^x?^?^?^?^?^?^?^?^?^?^?^?^?^?^?^?^?_?_?_?_?_ ?_(?_0?_8?_@?_H?_P?_X?_`?_h?_p?_x?_?_?_?_?_?_?_?_?_?_?_?_?_?_?_?_?`?`?`?`?` ?`(?`0?`8?`@?`H?`P?`X?``?`h?`p?`x?`?`?`?`?`?`?`?`?`?`?`?`?`?`?`?`?a?a?a?a?a ?a(?a0?a8?a@?aH?aP?aX?a`?ah?ap?ax?a?a?a?a?a?a?a?a?a?a?a?a?a?a?a?a?b?b?b?b?b ?b(?b0?b8?b@?bH?bP?bX?b`?bh?bp?bx?b?b?b?b?b?b?b?b?b?b?b?b?b?b?b?b?c?c?c?c?c ?c(?c0?c8?c@?cH?cP?cX?c`?ch?cp?cx?c?c?c?c?c?c?c?c?c?c?c?c?c?c?c?c?d?d?d?d?d ?d(?d0?d8?d@?dH?dP?dX?d`?dh?dp?dx?d?d?d?d?d?d?d?d?d?d?d?d?d?d?d?d?e?e?e?e?e ?e(?e0?e8?e@?eH?eP?eX?e`?eh?ep?ex?e?e?e?e?e?e?e?e?e?e?e?e?e?e?e?e?f?f?f?f?f ?f(?f0?f8?f@?fH?fP?fX?f`?fh?fp?fx?f?f?f?f?f?f?f?f?f?f?f?f?f?f?f?f?g?g?g?g?g ?g(?g0?g8?g@?gH?gP?gX?g`?gh?gp?gx?g?g?g?g?g?g?g?g?g?g?g?g?g?g?g?g?h?h?h?h?h ?h(?h0?h8?h@?hH?hP?hX?h`?hh?hp?hx?h?h?h?h?h?h?h?h?h?h?h?h?h?h?h?h?i?i?i?i?i ?i(?i0?i8?i@?iH?iP?iX?i`?ih?ip?ix?i?i?i?i?i?i?i?i?i?i?i?i?i?i?i?i?j?j?j?j?j ?j(?j0?j8?j@?jH?jP?jX?j`?jh?jp?jx?j?j?j?j?j?j?j?j?j?j?j?j?j?j?j?j?k?k?k?k?k ?k(?k0?k8?k@?kH?kP?kX?k`?kh?kp?kx?k?k?k?k?k?k?k?k?k?k?k?k?k?k?k?k?l?l?l?l?l ?l(?l0?l8?l@?lH?lP?lX?l`?lh?lp?lx?l?l?l?l?l?l?l?l?l?l?l?l?l?l?l?l?m?m?m?m?m ?m(?m0?m8?m@?mH?mP?mX?m`?mh?mp?mx?m?m?m?m?m?m?m?m?m?m?m?m?m?m?m?m?n?n?n?n?n ?n(?n0?n8?n@?nH?nP?nX?n`?nh?np?nx?n?n?n?n?n?n?n?n?n?n?n?n?n?n?n?n?o?o?o?o?o ?o(?o0?o8?o@?oH?oP?oX?o`?oh?op?ox?o?o?o?o?o?o?o?o?o?o?o?o?o?o?o?o?p?p?p?p?p ?p(?p0?p8?p@?pH?pP?pX?p`?ph?pp?px?p?p?p?p?p?p?p?p?p?p?p?p?p?p?p?p?q?q?q?q?q ?q(?q0?q8?q@?qH?qP?qX?q`?qh?qp?qx?q?q?q?q?q?q?q?q?q?q?q?q?q?q?q?q?r?r?r?r?r ?r(?r0?r8?r@?rH?rP?rX?r`?rh?rp?rx?r?r?r?r?r?r?r?r?r?r?r?r?r?r?r?r?s?s?s?s?s ?s(?s0?s8?s@?sH?sP?sX?s`?sh?sp?sx?s?s?s?s?s?s?s?s?s?s?s?s?s?s?s?s?t?t?t?t?t ?t(?t0?t8?t@?tH?tP?tX?t`?th?tp?tx?t?t?t?t?t?t?t?t?t?t?t?t?t?t?t?t?u?u?u?u?u ?u(?u0?u8?u@?uH?uP?uX?u`?uh?up?ux?u?u?u?u?u?u?u?u?u?u?u?u?u?u?u?u?v?v?v?v?v ?v(?v0?v8?v@?vH?vP?vX?v`?vh?vp?vx?v?v?v?v?v?v?v?v?v?v?v?v?v?v?v?v?w?w?w?w?w ?w(?w0?w8?w@?wH?wP?wX?w`?wh?wp?wx?w?w?w?w?w?w?w?w?w?w?w?w?w?w?w?w?x?x?x?x?x ?x(?x0?x8?x@?xH?xP?xX?x`?xh?xp?xx?x?x?x?x?x?x?x?x?x?x?x?x?x?x?x?x?y?y?y?y?y ?y(?y0?y8?y@?yH?yP?yX?y`?yh?yp?yx?y?y?y?y?y?y?y?y?y?y?y?y?y?y?y?y?z?z?z?z?z ?z(?z0?z8?z@?zH?zP?zX?z`?zh?zp?zx?z?z?z?z?z?z?z?z?z?z?z?z?z?z?z?z?{?{?{?{?{ ?{(?{0?{8?{@?{H?{P?{X?{`?{h?{p?{x?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?|?|?|?|?| ?|(?|0?|8?|@?|H?|P?|X?|`?|h?|p?|x?|?|?|?|?|?|?|?|?|?|?|?|?|?|?|?|?}?}?}?}?} ?}(?}0?}8?}@?}H?}P?}X?}`?}h?}p?}x?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?~?~?~?~?~ ?~(?~0?~8?~@?~H?~P?~X?~`?~h?~p?~x?~?~?~?~?~?~?~?~?~?~?~?~?~?~?~?~????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x?€?ˆ??˜? ?¨?°?¸????????????? ?(?0?8?@?H?P?X?`?h?p?x?À?È?Ð?Ø?à?è?ð?ø????????????? ?(?0?8?@?H?P?X?`?h?p?x?Ā?Ĉ?Đ?Ę?Ġ?Ĩ?İ?ĸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ŀ?ň?Ő?Ř?Š?Ũ?Ű?Ÿ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ƀ?ƈ?Ɛ?Ƙ?Ơ?ƨ?ư?Ƹ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ǀ?Lj?ǐ?ǘ?Ǡ?Ǩ?ǰ?Ǹ????????????? ?(?0?8?@?H?P?X?`?h?p?x?Ȁ?Ȉ?Ȑ?Ș?Ƞ?Ȩ?Ȱ?ȸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ɀ?Ɉ?ɐ?ɘ?ɠ?ɨ?ɰ?ɸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ʀ?ʈ?ʐ?ʘ?ʠ?ʨ?ʰ?ʸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ˀ?ˈ?ː?˘?ˠ?˨?˰?˸????????????? ?(?0?8?@?H?P?X?`?h?p?x?̀?̈?̐?̘?̠?̨?̰?̸????????????? ?(?0?8?@?H?P?X?`?h?p?x?̀?͈?͐?͘?͠?ͨ?Ͱ?͸????????????? ?(?0?8?@?H?P?X?`?h?p?x?΀?Έ?ΐ?Θ?Π?Ψ?ΰ?θ????????????? ?(?0?8?@?H?P?X?`?h?p?x?π?ψ?ϐ?Ϙ?Ϡ?Ϩ?ϰ?ϸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?Ѐ?Ј?А?И?Р?Ш?а?и????????????? ?(?0?8?@?H?P?X?`?h?p?x?р?ш?ѐ?ј?Ѡ?Ѩ?Ѱ?Ѹ????????????? ?(?0?8?@?H?P?X?`?h?p?x?Ҁ?҈?Ґ?Ҙ?Ҡ?Ҩ?Ұ?Ҹ????????????? ?(?0?8?@?H?P?X?`?h?p?x?Ӏ?ӈ?Ӑ?Ә?Ӡ?Ө?Ӱ?Ӹ????????????? ?(?0?8?@?H?P?X?`?h?p?x?Ԁ?Ԉ?Ԑ?Ԙ?Ԡ?Ԩ?԰?Ը????????????? ?(?0?8?@?H?P?X?`?h?p?x?Հ?Ո?Ր?՘?ՠ?ը?հ?ո????????????? ?(?0?8?@?H?P?X?`?h?p?x?ր?ֈ?֐?֘?֠?֨?ְ?ָ????????????? ?(?0?8?@?H?P?X?`?h?p?x?׀?׈?א?ט?נ?ר?װ?׸????????????? ?(?0?8?@?H?P?X?`?h?p?x?؀?؈?ؐ?ؘ?ؠ?ب?ذ?ظ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ـ?و?ِ?٘?٠?٨?ٰ?ٸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ڀ?ڈ?ڐ?ژ?ڠ?ڨ?ڰ?ڸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ۀ?ۈ?ې?ۘ?۠?ۨ?۰?۸????????????? ?(?0?8?@?H?P?X?`?h?p?x?܀?܈?ܐ?ܘ?ܠ?ܨ?ܰ?ܸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?݀?݈?ݐ?ݘ?ݠ?ݨ?ݰ?ݸ????????????? ?(?0?8?@?H?P?X?`?h?p?x?ހ?ވ?ސ?ޘ?ޠ?ި?ް?޸????????????? ?(?0?8?@?H?P?X?`?h?p?x?߀?߈?ߐ?ߘ?ߠ?ߨ?߰?߸????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x???? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?!?!?!?! ?!(?!0?!8?!@?!H?!P?!X?!`?!h?!p?!x?!?!?!?!?!?!?!?!?!?!?!?!?!?!?!?!?"?"?"?"?" ?"(?"0?"8?"@?"H?"P?"X?"`?"h?"p?"x?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?#?#?#?#?# ?#(?#0?#8?#@?#H?#P?#X?#`?#h?#p?#x?#?#?#?#?#?#?#?#?#?#?#?#?#?#?#?#?$?$?$?$?$ ?$(?$0?$8?$@?$H?$P?$X?$`?$h?$p?$x?$?$?$?$?$?$?$?$?$?$?$?$?$?$?$?$?%?%?%?%?% ?%(?%0?%8?%@?%H?%P?%X?%`?%h?%p?%x?%?%?%?%?-?3?3?4?4?4?4?4?4?4?4?4?4?4?4?5?5?5?5?5 ?5(?50?58?5@?5H?5P?5X?5`?5h?5p?5x?5?5?5?5?5?5?5?5?5?5?5?5?5?5?5?5?6?6?6?6?6 ?6(?60?68?6@?6H?6P?6X?6`?6h?6p?6x?6?6?6?6?6?6?6?6?6?6?6?6?6?6?6?6?7?7?7?7?7 ?7(?70?78?7@?7H?7P?7X?7`?7h?7p?7x?7?7?7?7?7?7?7?7?7?7?7?7?7?7?7?7?8?8?8?8?8 ?8(?80?88?8@?8H?8P?8X?8`?8h?8p?8x?8?8?8?8?8?8?8?8?8?8?8?8?8?8?8?8?9?9?9?9?9 ?9(?90?98?9@?9H?9P?9X?9`?9h?9p?9x?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?:?:?:?:?: ?:(?:0?:8?:@?:H?:P?:X?:`?:h?:p?:x?:?:?:?:?:?:?:?:?:?:?:?:?:?:?:?:?;?;?;?;?; ?;(?;0?;8?;@?;H?;P?;X?;`?;h?;p?;x?;?;?;?;?;?;?;?;?;?;?;?;?;?;?;?;?<?<?<?<?< ?<(?<0?<8?<@??>?>?>?> ?>(?>0?>8?>@?>H?>P?>X?>`?>h?>p?>x?>?>?>?>?>?>?>?>?>?>?>?>?>?>?>?>?????????? ??(??0??8??@??H??P??X??`??h??p??x?????????????????????????????????@?@?@?@?@ ?@(?@0?@8?@@?@H?@P?@X?@`?@h?@p?@x?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?A?A?A?A?A ?A(?A0?A8?A@?AH?AP?AX?A`?Ah?Ap?Ax?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?B?B?B?B?B ?B(?B0?B8?B@?BH?BP?BX?B`?Bh?Bp?Bx?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?C?C?C?C?C ?C(?C0?C8?C@?CH?CP?CX?C`?Ch?Cp?Cx?C?C?C?C?C?C?C?C?C?C?C?C?C?C?C?C?D?D?D?D?D ?D(?D0?D8?D@?DH?DP?DX?D`?Dh?Dp?Dx?D?D?D?D?D?D?D?D?D?D?D?D?D?D?D?D?E?E?E?E?E ?E(?E0?E8?E@?EH?EP?EX?E`?Eh?Ep?Ex?E?E?E?E?E?E?E?E?E?E?E?E?E?E?E?E?F?F?F?F?F ?F(?F0?F8?F@?FH?FP?FX?F`?Fh?Fp?Fx?F?F?F?F?F?F?F?F?F?F?F?F?F?F?F?F?G?G?G?G?G ?G(?G0?G8?G@?GH?GP?GX?G`?Gh?Gp?Gx?G?G?G?G?G?G?G?G?G?G?G?G?G?G?G?G?H?H?H?H?H ?H(?H0?H8?H@?HH?HP?HX?H`?Hh?Hp?Hx?H?H?H?H?H?H?H?H?H?H?H?H?H?H?H?H?I?I?I?I?I ?I(?I0?I8?I@?IH?IP?IX?I`?Ih?Ip?Ix?I?I?I?I?I?I?I?I?I?I?I?I?I?I?I?I?J?J?J?J?J ?J(?J0?J8?J@?JH?JP?JX?J`?Jh?Jp?Jx?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?K?K?K?K?K ?K(?K0?K8?K@?KH?KP?KX?K`?Kh?Kp?Kx?K?K?K?K?K?K?K?K?K?K?K?K?K?K?K?K?L?L?L?L?L ?L(?L0?L8?L@?LH?LP?LX?L`?Lh?Lp?Lx?L?L?L?L?L?L?L?L?L?L?L?L?L?L?L?L?M?M?M?M?M ?M(?M0?M8?M@?MH?MP?MX?M`?Mh?Mp?Mx?M?M?M?M?M?M?M?M?M?M?M?M?M?M?M?M?N?N?N?N?N ?N(?N0?N8?N@?NH?NP?NX?N`?Nh?Np?Nx?N?N?N?N?N?N?N?N?N?N?N?N?N?N?N?N?O?O?O?O?O ?O(?O0?O8?O@?OH?OP?OX?O`?Oh?Op?Ox?O?O?O?O?O?O?O?O?O?O?O?O?O?O?O?O?P?P?P?P?P ?P(?P0?P8?P@?PH?PP?PX?P`?Ph?Pp?Px?P?P?P?P?P?P?P?P?P?P?P?P?P?P?P?P?Q?Q?Q?Q?Q ?Q(?Q0?Q8?Q@?QH?QP?QX?Q`?Qh?Qp?Qx?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?R?R?R?R?R ?R(?R0?R8?R@?RH?RP?RX?R`?Rh?Rp?Rx?R?R?R?R?R?R?R?R?R?R?R?R?R?R?R?R?S?S?S?S?S ?S(?S0?S8?S@?SH?SP?SX?S`?Sh?Sp?Sx?S?S?S?S?S?S?S?S?S?S?S?S?S?S?S?S?T?T?T?T?T ?T(?T0?T8?T@?TH?TP?TX?T`?Th?Tp?Tx?T?T?T?T?T?T?T?T?T?T?T?T?T?T?T?T?U?U?U?U?U ?U(?U0?U8?U@?UH?UP?UX?U`?Uh?Up?Ux?U?U?U?U?U?U?U?U?U?U?U?U?U?U?U?U?V?V?V?V?V ?V(?V0?V8?V@?VH?VP?VX?V`?Vh?Vp?Vx?V?V?V?V?V?V?V?V?V?V?V?V?V?V?V?V?W?W?W?W?W ?W(?W0?W8?W@?WH?WP?WX?W`?Wh?Wp?Wx?W?W?W?W?W?W?W?W?W?W?W?W?W?W?W?W?X?X?X?X?X ?X(?X0?X8?X@?XH?XP?XX?X`?Xh?Xp?Xx?X?X?X?X?X?X?X?X?X?X?X?X?X?X?X?X?Y?Y?Y?Y?Y ?Y(?Y0?Y8?Y@?YH?YP?YX?Y`?Yh?Yp?Yx?Y?Y?Y?Y?Y?Y?Y?Y?Y?Y?Y?Y?Y?Y?Y?Y?Z?Z?Z?Z?Z ?Z(?Z0?Z8?Z@?ZH?ZP?ZX?Z`?Zh?Zp?Zx?Z?Z?Z?Z?Z?Z?Z?Z?Z?Z?Z?Z?Z?Z?Z?Z?[?[?[?[?[ ?[(?[0?[8?[@?[H?[P?[X?[`?[h?[p?[x?[?[?[?[?[?[?[?[?[?[?[?[?[?[?[?[?\?\?\?\?\ ?\(?\0?\8?\@?\H?\P?\X?\`?\h?\p?\x?\?\?\?\?\?\?\?\?\?\?\?\?\?\?\?\?]?]?]?]?] ?](?]0?]8?]@?]H?]P?]X?]`?]h?]p?]x?]?]?]?]?]?]?]?]?]?]?]?]?]?]?]?]?^?^?^?^?^ ?^(?^0?^8?^@?^H?^P?^X?^`?^h?^p?^x?^?^?^?^?^?^?^?^?^?^?^?^?^?^?^?^?_?_?_?_?_ ?_(?_0?_8?_@?_H?_P?_X?_`?_h?_p?_x?_?_?_?_?_?_?_?_?_?_?_?_?_?_?_?_?`?`?`?`?` ?`(?`0?`8?`@?`H?`P?`X?``?`h?`p?`x?`?`?`?`?`?`?`?`?`?`?`?`?`?`?`?`?a?a?a?a?a ?a(?a0?a8?a@?aH?aP?aX?a`?ah?ap?ax?a?a?a?a?a?a?a?a?a?a?a?a?a?a?a?a?b?b?b?b?b ?b(?b0?b8?b@?bH?bP?bX?b`?bh?bp?bx?b?b?b?b?b?b?b?b?b?b?b?b?b?b?b?b?c?c?c?c?c ?c(?c0?c8?c@?cH?cP?cX?c`?ch?cp?cx?c?c?c?c?c?c?c?c?c?c?c?c?c?c?c?c?d?d?d?d?d ?d(?d0?d8?d@?dH?dP?dX?d`?dh?dp?dx?d?d?d?d?d?d?d?d?d?d?d?d?d?d?d?d?e?e?e?e?e ?e(?e0?e8?e@?eH?eP?eX?e`?eh?ep?ex?e?e?e?e?e?e?e?e?e?e?e?e?e?e?e?e?f?f?f?f?f ?f(?f0?f8?f@?fH?fP?fX?f`?fh?fp?fx?f?f?f?f?f?f?f?f?f?f?f?f?f?f?f?f?g?g?g?g?g ?g(?g0?g8?g@?gH?gP?gX?g`?gh?gp?gx?g?g?g?g?g?g?g?g?g?g?g?g?g?g?g?g?h?h?h?h?h ?h(?h0?h8?h@?hH?hP?hX?h`?hh?hp?hx?h?h?h?h?h?h?h?h?h?h?h?h?h?h?h?h?i?i?i?i?i ?i(?i0?i8?i@?iH?iP?iX?i`?ih?ip?ix?i?i?i?i?i?i?i?i?i?i?i?i?i?i?i?i?j?j?j?j?j ?j(?j0?j8?j@?jH?jP?jX?j`?jh?jp?jx?j?j?j?j?j?j?j?j?j?j?j?j?j?j?j?j?k?k?k?k?k ?k(?k0?k8?k@?kH?kP?kX?k`?kh?kp?kx?k?k?k?k?k?k?k?k?k?k?k?k?k?k?k?k?l?l?l?l?l ?l(?l0?l8?l@?lH?lP?lX?l`?lh?lp?lx?l?l?l?l?l?l?l?l?l?l?l?l?l?l?l?l?m?m?m?m?m ?m(?m0?m8?m@?mH?mP?mX?m`?mh?mp?mx?m?m?m?m?m?m?m?m?m?m?m?m?m?m?m?m?n?n?n?n?n ?n(?n0?n8?n@?nH?nP?nX?n`?nh?np?nx?n?n?n?n?n?n?n?n?n?n?n?n?n?n?n?n?o?o?o?o?o ?o(?o0?o8?o@?oH?oP?oX?o`?oh?op?ox?o?o?o?o?o?o?o?o?o?o?o?o?o?o?o?o?p?p?p?p?p ?p(?p0?p8?p@?pH?pP?pX?p`?ph?pp?px?p?p?p?p?p?p?p?p?p?p?p?p?p?p?p?p?q?q?q?q?q ?q(?q0?q8?q@?qH?qP?qX?q`?qh?qp?qx?q?q?q?q?q?q?q?q?q?q?q?q?q?q?q?q?r?r?r?r?r ?r(?r0?r8?r@?rH?rP?rX?r`?rh?rp?rx?r?r?r?r?r?r?r?r?r?r?r?r?r?r?r?r?s?s?s?s?s ?s(?s0?s8?s@?sH?sP?sX?s`?sh?sp?sx?s?s?s?s?s?s?s?s?s?s?s?s?s?s?s?s?t?t?t?t?t ?t(?t0?t8?t@?tH?tP?tX?t`?th?tp?tx?t?t?t?t?t?t?t?t?t?t?t?t?t?t?t?t?u?u?u?u?u ?u(?u0?u8?u@?uH?uP?uX?u`?uh?up?ux?u?u?u?u?u?u?u?u?u?u?u?u?u?u?u?u?v?v?v?v?v ?v(?v0?v8?v@?vH?vP?vX?v`?vh?vp?vx?v?v?v?v?v?v?v?v?v?v?v?v?v?v?v?v?w?w?w?w?w ?w(?w0?w8?w@?wH?wP?wX?w`?wh?wp?wx?w?w?w?w?w?w?w?w?w?w?w?w?w?w?w?w?x?x?x?x?x ?x(?x0?x8?x@?xH?xP?xX?x`?xh?xp?xx?x?x?x?x?x?x?x?x?x?x?x?x?x?x?x?x?y?y?y?y?y ?y(?y0?y8?y@?yH?yP?yX?y`?yh?yp?yx?y?y?y?y?y?y?y?y?y?y?y?y?y?y?y?y?z?z?z?z?z ?z(?z0?z8?z@?zH?zP?zX?z`?zh?zp?zx?z?z?z?z?z?z?z?z?z?z?z?z?z?z?z?z?{?{?{?{?{ ?{(?{0?{8?{@?{H?{P?{X?{`?{h?{p?{x?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?|?|?|?|?| ?|(?|0?|8?|@?|H?|P?|X?|`?|h?|p?|x?|?|?|?|?|?|?|?|?|?|?|?|?|?|?|?|?}?}?}?}?} ?}(?}0?}8?}@?}H?}P?}X?}`?}h?}p?}x?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?}?~?~?~?~?~ ?~(?~0?~8?~@?~H?~P?~X?~`?~h?~p?~x?~?~?~?~?~?~?~?~?~?~?~?~?~?~?~?~????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P????????(?8?H?X?h?x???????????(?8?H?X?h?x???????????(?8?H?X?h?x???????????(?8?H?X?h?x???????????(?8?H?X?h?x???????????? ?(?H?P?????????? ?(?0?8?߀?߈?ߐ?ߘ?ߠ?ߨ?߰?߸????????????? ?(?0?8?@?H?P?X????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x?????????????h?p??`????(?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p???????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?!?!?!?!?! ?!(?!0?!8?!@?!H?!P?!X?!`?!h?!p?!x?!?!?!?!?!?!?!?!?!?!?!?!?!?!?!?!?"?"?"?"?" ?"(?"0?"8?"@?"H?"P?"X?"`?"h?"p?"x?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?#?#?#?#?# ?#(?#0?#8?#@?#H?#P?#X?#`?#h?#p?#x?#?#?#?#?#?#?#?#?#?#?#?#?#?#?#?#?$?$?$?$?$ ?$(?$0?$8?$@?$H?$P?$X?$`?$h?$p?$x?$?$?$?$?$?$?$?$?$?$?$?$?$?$?$?$?%?%?%?%?% ?%(?%0?%8?%@?%H?%P?%X?%`?%h?%p?%x?%?%?%?%?%?%?%?%?%?%?%?%?%?%?%?%?&?&?&?&?& ?&(?&0?&8?&@?&H?&P?&X?&`?&h?&p?&x?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?'?'?'?'?' ?'(?'0?'8?'@?'H?'P?'X?'`?'h?'p?'x?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?(?(?(?(?( ?((?(0?(8?(@?(H?(P?)x?)?)?)?)?)?)?)?)?)?)?)?)?)?)?)?)?*?*?*?*?* ?*(?*0?*8?*@?*H?*P?*X?*`?*h?*p?*x?*?*?*?*?*?*?*?*?*?*?*?*?*?*?*?*?+?+?+?+?+ ?+(?+0?+8?+@?+H?+P?+X?+`?+h?+p?+x?+?+?+?+?+?+?+?+?+?+?+?+?+?+?+?+?,?,?,?,?, ?,(?,0?,8?,@?,H?,P?,X?,`?,h?,p?,x?,?,?,?,?,?,?,?,?,?,?,?,?,?,?,?,?-?-?-?-?- ?-(?-0?-8?-@?-H?-P?-X?-`?-h?-p?-x?-?-?-?-?-?.?.?.?.?. ?.(?.0?.8?.@?.H?.P?.X?.`?.h?.p?.x?.?.?.?.?.?.?.?.?.?.?.?.?.?.?.?.?/?/?/?/?/ ?/(?/0?/8?/@?/H?/P?/X?/`?/h?/p?/x?/?/?/?/?/?/?/?/?/?/?/?/?/?/?/?/?0?0?0?0?0?0?0?0?0?0?0?1?1?1?1?1 ?1(?10?18?1@?1H?1P?1X?1`?1h?1p?1x?1?1?1?1?1?1?1?1?1?1?1?1?1?1?1?1?2?2?2?2?2 ?2(?20?28?2@?2H?2P?2X?2`?2h?2p?2x?2?2?2?2?2?2?2?2?2?2?2?2?2?2?2?2?3?3?3?3?3 ?3(?30?4?4 ?4(?40?48?4@?4H?4P?4X?4`?4h?4p?4x?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?5?5?5?5?5 ?5(?50?58?5@?5H?5P?5X?5`?5h?5p?5x?5?5?5?5?5?5?5?5?5?5?5?5?5?5?5?5?6?6?6?6?6 ?6(?60?68?6@?6H?6P?6X?6`?6h?6p?6x?6?6?6?6?6?6?6?6?6?6?6?6?6?6?6?6?7?7?7?7?7 ?7(?70?78?7@?7H?7P?7X?7`?7h?7p?7x?7?7?7?7?7?7?7?7?7?7?7?7?7?7?7?7?8?8?8?8?8 ?8(?80?88?8@?8H?8P?8X?8`?8h?8p?8x?8?8?8?8?8?8?8?8?8?8?8?8?8?8?8?8?9?9?9?9?9 ?9(?90?98?9@?9H?9P?9X?9`?9h?9p?9x?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?:?:?:?:?:8?:H?:P?:X?:`?:?:?:?:?:?:?:?:?:?:?;?;?;?;?; ?;(?;0?;8?;@?;H?;P?;X?;`?;h?;p?;x?;?;?;?;?;?;?;?;?;?;?;?;?;?;?;?;?<?<?<?<?< ?<(?<0?<8??W?? ??(?0?8?@?H?hP?X?`?*h?Kp?7x?Y?:?????d?}????????F??=?A?? ?(?0? 8?@?H?P?X?`? h?p?6x???w???D?U?8? ?R?i??? ?g????v?? ?(?90?8?@?H?P?X?`?h?p?x?????j???G???I?J???]?-?0???? ?0?8?@?H?P?X?`?h?p?nx??[??q?Z?????Q????????$??? ?(?/0?.8?@?H?P?X?`?h?p?x?o???P????????????????? ?(?O0?8?@?H?P?X?`?h?p?x?x?y??????X????????N???p??B ?(?0?8?@?H?P?X?`?h?p?x?+?T?l?????????z?|?{????t?e?? ?(?H0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?Eh?p?x??????????????? ?!???L?_?^ ?(?0?8?@?H?P?X?`?h?p?x??????r??????????????? ?(?0?8?#@?"H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x?`???????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?2(?0?8?@?H?P?X?`?h?p?x?????????????M?~? ?????? ?(?0?8?c@?H?P?X?`?/usr/lib:/usr/vac/lib:/usr/vacpp/lib:/usr/lib:/liblibc.ashr_64.olibpthreads.ashr_xpg5_64.olibC.aansi_64.olibC.ashr_64.oenvironerrnoaccesschdirchmodclosefsync getgroupskillmkdirpipepollset_create pollset_ctlpollset_destroy readlinkrenamermdir setreuidstatfssymlinkumaskunameunlinksocketbindlisten shutdown setsockopt getsockopt ngetsockname ngetpeername gethostname getkerninfo_system_configuration ___memcmp64 ___bzero64 ___memset64 ___memmove64 ___fill64_iob __lc_charmap __mod_initmalloccallocreallocfreegetenvread_real_timeexitatexitstrlen freopen64fopen64open64fprintffclosegeteuidgetuid strncasecmpisdigitstrchratoi strcasecmpabortsprintfwrite sigactiongetpidtime snprintffputs gettimeofdayfflushfcntlusleep vsnprintf vsprintf vfprintfprintffwritetolowermblenreadstrncmpstrrchrfputcfgetsungetcstrtodatofsscanf __fd_poll __fd_select pollset_pollsigsetsignalperrorisspacememchrsetsidgetppidsleepfreadislowertoupperatol getpwuidftellfseekstrdupfgetcrewindlstat64fstat64stat64 fseeko64strtokstrspnstrpbrk localtime_r gmtime_r asctime_r localtimegmtimeasctimemktimetzsetisalphatime_base_to_timesystemwaitpidexeclisprintsendto nrecvfromioctlgetsgetcwdforkstrstrdup2opendir closedirreaddirpclosepopensrandrandexecvwaitexecvpgetgidputenvputstmpnamwritevsetvbuf getgrnamsysconf strerror strftimegetegid fp_raise_xcpreadvdlopendlsymstrtolgetcputc_unlockedremoveclocksendconnectnacceptrecv setregidgetpass difftime truncate64 ftruncate64 funlockfile flockfile _res_init getnameinfodlerror freeaddrinfo getaddrinfo nrecvmsg nsendmsg __f64tou64rz__run_final_dtors__run_initial_ctors __n_pthreads__crt0v daylight timezone__malloc_user_defined_name __pth_init __pthread__CleanupCatchV6a __ReThrowV6 __dl__FPv __nw__FUl __vd__FPv __vn__FUl__PureVirtualCalled#__setUncaughtExceptionFlag__3stdFb__startp P g( k z | sh tT @ s   $ (xZTZcd @@pV|Vmm@tPtz z@<`@DX `d@D$%**23 :H:AA@GG@_` oxou,u`}},`D |à͌t۠d8`h++<<D$D`j|j~  |  @  p &@&`747`BBNxNYYeeq`q~$~`p  @@     $L$23 AA@NN\\jj4`@tР  @X't'99GG@OPZhZde qr ||   @ `)x)404`=>GGRDRV@x 34 CPCVVw(w`l  ɔ4`l(<(`NN[\ bb@hhst @@ t T,T`]]pqT$`` @Xht pd #8#`12 45 II`]]hhxۨhx%%() *+++@/000@4(4`4p48 8@8P8<<<= A0A`ApAETEEEITIIIM\MMMS S@SPSYY@YPY]]]^aa@aPaff@fPfjtjjjnnnos(s`spsvw w0w`zzz{~4~`~p~ 0` 0` @P4`p@4`p@@l@P ƄՄ @@t&&@7 7@HI88EEgg̐DڀH**@FdFSSchclluvzzmn xy@@@4`tՠ\٠@ t @T8`   t   @  @  @  @  @  @ ! "@ & &@ * + . / 2 3 6 7 : ; > > B B F 4 `8`lˠ8` @߈,`,h,>@>C`C@`d t @ lƠD <` x |;<RlRXX@^_h,h`rs@@  TŀΨ @t @,` | $x$() //55<<@BdBJ0J`R\RX|X__lluu@L    33@99@NOZ`ZHx   XӀ ܼl8`>@]|&,`PHX !!$$@%& ((++@--@/h/0`0404`:D:;;>>DEEhELM Q\QVlVZ@Z]l]__atabbj0j`jk@l0l`m m`nPnnooop4pww `@dl$`@,``@ $`l0pX $ `,`@@ !"#x#%8%(d(+X`xP @@ h (`IhIkk@klnLnnP4` d`@ @   H    tP@|  D  @     d     `     H P@`d (` @ @@P8`lp(`L @(` ( ` l      X       @ L  0`0``p  x %%%& 't''(,@,,,-. .d./8/`11@112\23H334@455X5566@69:@\@ABF4F`HI I(I`IlIIJ KLLL@PPPQ Q0Q`R`R\\]0]`]t]]]^0^`^^^_ _4_`_t__` `p````a apaab b4b`btbc4c`cd eemmmn npnno opoop ppppppq qpqqr r,r`rrxxxy ypyyz zxzz{ ~~@~H~<`@@4` tP@PL@T@P @dP <` t Dt+,,-- -`--//112p2:; >>?@ CC@I\IK0K`NOO|OPQRxRRRSS@SHS`XYYY@YDYYYYZ [$[`[|[[[\\@\H\\] ^H^^_ `T`dd@d D0PHT @HX @    @ T      ( `    @ !!4!`&&&' 'd''(((@))*+,, ---. 12 2H222344(4`4l4445`567 9X9:8:`:l::: ??@@DDGDGGHHIJK L@T@,`0`  @   X @d(p(`@ 0``D@@`L@@  @X`p   \`p   \(`| P p@ P Tdp@  @h!!%0@H < @ @ ,`   @ |   x@@  @"# %&((++--/012@444`77@9: <= ?@ BC ELEHI IIIJJJ@O|OST XX ]]@a0a`efff@fTffffgjDjnXnqrrr@whw|} x p @ xDHHh H @l(`(`äTŀƼP΀ @l֠,`ۤHXP@@,` @@ H 8`,`` 3h3;< >>@ABBDDGlGIIKKOO@RxRUV YXY[T[]^cLcjjp@pw\w~@h@@,`@` 8` `@XǠ\ʠͬ,`H؀4`@ @$`PHD@XI@ `    @#(#&'@'(@**`67 :0:>??d??@ CtCE$E`H$HJJMM@M\MUV VPV]\]bdbftfjkvxvx x`\DP< ȨLˠ `l`ݠ  lD$`  Xx(` h @ L`t%%& &`&''('`'(2$2`34 5666@6D666= =`YpYYZ ZlZZ[ [l[[[\$\`^__h_aadd@k<kl@lmm@q@qv v`xy}}~4`@lH@  @DL`@8 xH=7@: :     @@H@Ld!!`#$ %& *+,- -4-`1 1@1H1123,345 8,8`:x:?@ B(BW4WY\Y^|^```de e`eefggij@mn@tlttuxx`}L}@<`\H (`€hǀ t Θ`ϐ,`ٜ @`@<`xTL0< x@\d `DH@@ Pp\@L @H<(`$`|@ $ ``@@!"@%%@'')D)*H*++--@..0,0`1t12h24 4`5(5`77@@|@LLNNPL 4@ ` $`pL!L <@`|h#$@'( )$)`)p))*-.1pT X    xh"0"&&()`,D,..@64699`:4::::;@?,?B4$@@ !0!$%@(L())-0(tP   p  4``@ |t"d"%`%-L-/0 77:(:`>>AACC`MN@PQQ8QRpRXY YhYbpbkkl(l`n8nvv~ @L4`@`\@@L@Hd @$`    @ @@Hx!$!`$$''`*p*--`00225X57\79\9< <@< @\@ 0HD/P<`@   @   8`@`T  %4%`'8'`()*h*..@/0567h78p899<<==@A B4B`FG H4H`KLM$M`N,N`OOPPQQRS SHSSSTT@UUUV VW WDWWWWXXX@XHX[\\] aacd fXflm oXopq r00qD/h@ @LDDD  D    D    D    @ ` p    (  x@`H h h@(H h@t `T<#,#`&' **-d-.p.2(2`679D9>@\    @ `   &x&((*d*-hp `@  @ D P   `@@D @@d 8`""#(#`'x'+, 2l22223 30 @L 0 `     H  D     @ h   @ T   @x$@@`\ 8@!`!""@"T"""$h$%,%`%&(()L)* *@---. .4.`.l..../ /4/`00@0T0001p11112 335`5747`89::Z֏v֏ ֏     ҏ֏"2LX bfr~֏֏ ֏ *.T` jnr     "*6֏:$>ҏRl ™vz pҏX frt &26BЏJ` ҏ ϙ ".6:h`hh ,:ҏ\v֏֏֏֏<V֏t֏֏֏6֏Tn֏֏֏֏4N֏l֏֏.֏Xn֏F4ҏҏҏ@Xp֏֏֏$2֏Tb֏֏ W$:< \  ڏҏ֏  0 L ^ t     !zԏ!~ڏ!֏!؏!܏!֏! !؏"֏"`""""""ԏ""܏"" #####*#.#2#\#p###$$$$,$6$:$T$` $j$v$$$֏$؏$֏$ $؏$֏$$%% %%ԏ%&%*܏%H%T %^%b%n%z%%%%ԏ& & &<&Z&^&f&x&&&& &&&&'ҏ','D'\'t'֏''֏''ҏ((ҏ(8 ՙ(J؏(ZF(h (zҏ(((() N) ))*)0):)< )N֏)R؏)n֏)| )؏)֏))))))ԏ))܏** *****6*>*B*F*Zԏ*p *ԏ* **** **++@+X+,,p,---..D.t V.../ /T//00P0` 0|0000 6118 T1h111122@2x22223, X3H3\3!344L4455$"5@5d5v5~ԏ555Џ5܏55 5˙555ԏ55Џ6܏66 606x6:67,7778$808N8R8Z8l8v8z88 88 8!99(9H9`9|99!)9 d999999999 ::r:::::::: :;;F;ҏ;;";*;.;B;|;;;ҏ;F;;;<<4<> ߙ>0>F>\ 8>x>?D?\??@ @@@@@@@A AAA&A.ABAFARA`AjAnAA AA WA WB WB$ WB@ WB\ WBx WB WB WBߙBBBBCCC(C4 C>CPߙCpCCCCCDDߙDHD`DtDDDDDDDD DDE, WEH WEd WE WE WE WE WE WF WF$ߙF<ߙF\FtFFFFFGGG6G@GP GnGxGGG GGGGH H2H4HBHPH\ HHHHH HHH HHIII II( I6I:IHIX IfIjII IIII IIJJ JJ(J8 JRJ`Jl JzJJ JJJJJ JJJK KKK"K.ԏK>KLKlKKKKKKKԏL LL< fLL!LnLLLLLLLL LLԏLLMЏM܏M M, M:MFԏMJMNMVЏMZ܏M^M MMMԏMMvM MMvM N XN.vN4 NHNdN|NNNNNNNNO O O"O&O2O>OFOJONOzO~OOOOOO OOOPPPP(P2P6PPP\ PfPjPvPPPPPPPPPPQQ QQ"Q&QT Q^QbQnQxQQԏQQ܏QbQQ QQQQQQQR*֏R8RVRZRfRtR~RRR RRRRSS(S@SXSpSSSSSTTT0THT`TxTTTTTUU U8UPUhUUUUUUVV(V@VXVpVVVVVWWW4WLWdW|WWWWWX X$X<XTXlXXXXXXYY0YHY`YxYYYYYZZ(Z@ZXZpZZZZZ[[[0[H[`[x[[[[[\\ \8\P\h\\\\\\]](]@]X]p]]]]]^^^0^H^`^x^^^^^__ _8_P_h______``(`@`X`p`````aaa0aHa`axaaaaabbbb&b8bBbNbdbp bzbbb b c^ԏcb֏cf؏cj܏crڏc c؏cҏdd2d.Fd2d60d:dFЏdJdVdZdde heҏe*ҏe>eN؏ejevezeeeee eeeef ٙf؏f8 fZfffjfxffff fffffvg g g ֙g, g8 gX gd˙gggggЏg ggghhh h h*h2hVhfhth~h hhhhhhhhh iiii&i4i>i@ iNiRibifiiiii iiiij( j0"jjjt j j"jj k"kBkL k^vkd kp k|֙kkkkkkkk kklllll"lD l\ lԏl֏m؏m&ڏmF܏mp mz؏m֏mmmmmmԏmm܏mm nn nn"n*n.n2nVnZnbnfnjҏnnnn nnnnnoo ooo"o&o2o:o>oBoRҏoVo`!`oooo oooopp p pp&p6؏p:֏pd pn؏p~֏ppppppԏpp܏pp ppq qqq"q&q:ԏq q qqq brrrrr,r6r8 rBrFr`rpr|r֏r؏r r؏r֏rrss ssԏs&s*܏sHsT s^sbsnszssssԏs s ssstdt \t6ԏt:܏tBtX tfthttttttt tttttuuuuu*u@uL uVuZul!`uvuuuu uuuuԏuuvЏv ܏v( v>v@vVvXvpvvvvvvvvww ww<wbwfwxwwwwww wwwx(x\xvx xxxxxxxxyy&y( yNLy^ڏyd >y >yHz >z$ >zD >zT >zd >zt >z >z >zvz z zhz֙z >z >{ >{ {:{X H{z{|{P{ >{R{ >{T{ >{V{ >{v{ { {h|֙| >|$ >|0 >|< >|H >|T >|` >|l >|x >| >| >| >| >| >| >| >| >| >| >| >} >} >} >}, >}8 >}D >}P >}\ >}h >}t >} >} >} >} >} >} >} >} >} >} >} >~ >~ >~ >~( >~4 >~@ >~L >~X >~d >~p >~| >~ >~ >~ >~ >~ڏ~ >~~0p  dz26HRV^t~ $.2>Xbd | $d,6:F`jl ԏ܏ <Z^pz~ (Lp$Hl8B(X؏0JZhrv  8\ h &ԏ*֏.ڏ2؏:܏֏ ֏ $0 :>JV^bf֏֏֏Џ ֏6֏D Z֏jnz |   P֏ 68    *.:@ ֏֏ҏ.֏J֏X n֏   0 Bh &( >h\ p ԏ֏ڏ"܏&؏x    *6BFN~ Џ8 Rl fЏ   ˙6>BЏNl "Џ   L Vflv 0 Jҏfddd *4 B` n   0 Vh ~  p(H` 8Pp4Txҏ ,Ll    &@L VZfrz~"ԏ&֏r؏zڏ܏֏ ؏֏(26ԏBF܏dp z~ԏ܏ ԏF܏$ >BԏN܏` ~ԏ܏ ԏ܏ ԏ܏ *ԏ26܏H Zԏ^܏v ԏ܏ ԏ܏ ԏ ܏( :ԏ>B܏` rԏvz܏ ԏ܏ ԏ܏ ԏ.6܏D RԏZ^܏x ԏ܏ ԏ܏ ԏ܏ 26ԏ:܏L fԏnr܏ ԏ܏ ԏ܏ ԏ ܏, >ԏBF܏d ԏ܏ ԏ܏ ԏ܏ ԏ"܏@ RԏVZ܏x ԏ܏ ԏ܏ ԏ܏ "ԏ*.܏H fjԏn܏ ԏ܏ ԏ܏ ԏ܏ *ԏ.܏6P ^ԏfj܏ ԏ܏ ԏ܏ ԏ ܏$ 2ԏ:>܏X fԏnr܏ ԏ܏ ԏ܏ ԏ ܏, :ԏBF܏` nԏvz܏ ԏ܏ ԏ܏ ԏ"܏4 NԏVZ܏l ~ԏ܏ ԏ܏ ԏ܏ .ԏ2:܏X fԏjr܏ ԏ܏ ԏ܏ ԏ"*܏H bԏfn܏ ԏ܏ ԏ܏ ԏ܏4 FԏJN܏l ԏ܏ ԏ܏ ԏ܏ 2ԏ6:܏L jnԏv܏ ԏ܏ ԏ܏ ԏ܏, JNԏV܏h ԏ܏ ԏ܏ ԏ܏ *.ԏ6܏H bԏfj܏ ԏ܏ ԏ܏ ԏ ܏, >ԏBF܏d vԏz܏~ ԏ܏ ԏ܏ ԏ"&܏D VԏZ^܏| ԏ܏ ԏ܏ ԏ܏$ 6ԏ:܏>\ nrԏz܏ ԏ܏ ԏ܏ ԏ"܏@ NԏVZ܏t ԏ܏ ԏ܏ ԏ܏ "ԏ*.܏H Vԏ^b܏| ԏ܏ ԏ܏  ԏ܏( BԏFJ܏d vԏz܏ ԏ܏ ԏ܏ &ԏ*.܏H Vԏ^b܏ ԏ܏ ԏ܏ ԏ܏$ 2ԏ6܏>X fԏnr܏ ԏ܏ ԏ܏ ԏ܏0 >ԏFJ܏h vԏ~܏ ԏ܏ ԏ܏ ԏ"&܏@ Zԏ^b܏t ԏ܏ ԏ܏ ԏ܏ 6:ԏB܏T nԏrv܏ ԏ܏ ԏ܏ ܏ԏ8 JԏNR܏p ‚ԏ†Š܏¨ ¶ԏ¾܏ ԏ܏ *ԏ.2܏P ^ԏb܏jÄ ÒԏÚÞ܏ø ܏ԏ ԏ܏ .ԏ2:܏X fԏjr܏Đ ĮIJԏĶ܏ ԏ܏ ԏ܏&8 FԏJR܏p ~ԏłņ܏Ť ŲԏŶž܏ ԏ܏ ԏ&*܏D RԏZ^܏x ƆԏƎƒ܏Ƭ ƺԏƾ܏ ԏ܏ *ԏ.6܏T nrԏ~܏ǐ ǮDzԏǺ܏ ԏ܏ "ԏ&*܏D bfԏn܏Ȁ ȖԏȚȞ܏ȸ ԏ܏  ܏ԏ, :ԏBF܏` nԏvz܏ɔ ɢԏɪɮ܏ ԏ܏ ԏ"܏*@ RԏVZ܏x ʊԏʎʒ܏ʰ ܏ԏ ԏ܏ >BԏJ܏\ vԏz~܏˘ ˪ԏˮ˲܏ ԏ܏ ԏ"܏@ RԏVZ܏x ̊ԏ̎̒܏̰ ԏ܏ ԏ܏ 2ԏ6:܏X vzԏ͂܏͔ ͮԏͲͶ܏ ԏ܏ "&ԏ.܏D Zԏ^b܏| ΎԏΒΖ܏δ ԏ܏ ԏ ܏( BFԏN܏` zԏ~ς܏Ϝ Ϯԏϲ϶܏ ԏ܏ *ԏ.2܏L ^ԏbf܏Є ОТԏЮ܏ ԏ܏ ԏ܏, FJԏR܏d zԏ~܏цќ ѪԏѲѶ܏ ԏ܏ "&ԏ2܏D Zԏ^b܏| ҊԏҒҖ܏Ұ Ҿԏ܏ ԏ܏ 26ԏ:܏T bԏfj܏ӌ ӚԏӢӦ܏ ҏԏ܏ .ԏ26܏P ^ԏfj܏Ԅ ԒԏԚԞ܏Ը ԏ܏ ԏ"&܏@ ^bԏf܏x ՎԏՒՖ܏հ վԏ܏ ԏ܏ .ԏ26܏T nrԏ~܏֐ ֦ԏ֪֮܏ ԏ܏  ԏ܏0 NRԏV܏h ~ԏׂ׆܏נ ׮ԏ׶׺܏ ԏ܏ "ԏ&*܏D RԏZ^܏x ؆ԏ؎ؒ܏ج ؾԏ܏ ԏ܏ :>ԏB܏T jԏnr܏ٌ ٚԏ٢٦܏ ԏ܏ ԏ ܏( FJԏN܏` vԏz~܏ژ ڦԏڮڲ܏ ԏ܏ ԏ"܏< Z^ԏb܏t ۊԏێے܏۬ ԏ܏ ԏ܏ >BԏF܏X nԏrv܏ܐ ܞԏܦܪ܏ ԏ܏ ԏ܏4 FԏJ܏bl ݊ݎԏݒ܏ݤ ݺԏݾ܏ ԏ܏ .2ԏ:܏L bԏfj܏ބ ޒԏޚޞ܏޸ ԏ܏ ԏ܏, >ԏBF܏d vԏz~܏ߜ ߺ߾ԏ܏ ԏ܏ "ԏ&*܏H Zԏ^b܏ ԏ܏ ԏ܏ ԏ܏$ 6ԏ:>܏\ z~ԏ܏ ԏ܏ ԏ܏ ԏ"&܏D VԏZ܏^| ԏ܏ ԏ܏ ԏ܏ :>ԏJ܏\ vԏz~܏ ԏ܏ ԏ܏ ԏ.܏2@ ^bԏj܏| ԏ܏ ԏ܏ ԏ܏ .ԏ6:܏T bԏjn܏ ԏ܏ ԏ܏ ԏ ܏$ BFԏN܏` zԏ~܏ ԏ܏ ԏ܏ ԏ"܏< NԏRV܏t ԏ܏ ԏ܏ ԏ܏ "ԏ*.܏H Vԏ^b܏| ԏ܏ ԏ܏ ԏ܏$ 6ԏ:܏>\ nԏrv܏ ԏ܏ ԏ܏ ԏ܏< JڏRԏV܏Z ԏ܏ ԏ܏  ԏ܏( :ԏ>B܏` rԏvz܏ ԏ܏ ԏ܏ ԏ"܏@ RԏVZ܏x ԏ܏ ԏ܏ ԏ܏ >BԏF܏X rԏz~܏ ԏ܏ ԏ܏ ԏ"&܏8 RVԏ^܏p ԏ܏ ԏ܏ ԏ܏ 6:ԏB܏T nԏrv܏ ԏ܏ ԏ܏ ԏ܏0 JԏNR܏d rԏz~܏ ԏ܏ ԏ܏ ԏ܏4 BԏJN܏h vԏ~܏ ԏ܏ ԏ܏ ԏ"&܏D RԏZ^܏x ԏ܏ ԏ܏ ԏ܏ *ԏ.2܏P bԏf܏n ܏ԏ ԏ܏ ԏ܏, :ԏBF܏` nԏvz܏ ԏ܏ ԏ܏ ԏ"&܏8 F܏JRԏp ~ԏ܏ ԏ܏ ԏ܏ ԏ&*܏H Vԏ^b܏| ԏ܏ ԏ܏ ԏ܏ .ԏ6:܏T bԏjn܏ ԏ܏ ԏ܏ ԏ ܏$ BFԏJ܏\ vԏ~܏ ԏ܏ ԏ܏ ԏ܏8 FԏNR܏l zԏ~܏ ԏ܏ ԏ܏ ԏ"*܏H Vԏ^b܏| ԏ܏ ԏ܏ ԏ܏ &ԏ.2܏L Zԏbf܏ ԏ܏ ԏ܏ ԏ܏ ( :ԏ>B܏` rԏvz܏ ԏ܏ ԏ܏ ԏ"܏@ RԏVZ܏x ԏ܏ ԏ܏ ܏ԏ 2ԏ6:܏X jԏnr܏ ԏ܏ ԏ܏ ԏ܏8 JԏNR܏p ԏ܏ ԏ܏ ԏ܏ *ԏ.2܏P bԏfj܏ ԏ܏ ԏ܏ ԏ ܏, >ԏBF܏d ԏ܏ ԏ܏ ԏ܏ ԏ"&܏D VԏZ^܏| ԏ܏ ԏ܏ ԏ܏$ 6ԏ:>܏\ nԏrv܏ ԏ܏ ԏ܏ ԏ܏< JԏRV܏t ԏ܏ ԏ܏ ԏ܏ &ԏ.2܏P ^ԏfj܏ ԏ܏ ԏ܏ ԏ܏0 >ԏFJ܏h vԏ~܏ ԏ܏ ԏ܏ ԏ"&܏@ ^bԏj܏| ԏ܏ ԏ܏ ԏ܏ 2ԏ6:܏X rԏz~܏ ԏ܏ ԏ܏  ԏ  ܏ 4  R Vԏ ^܏ p  ԏ ܏   ԏ  ܏  ԏ  ܏   6ԏ : >܏ P  bԏ f j܏   ԏ ܏  ԏ  ܏  ԏ  ܏ ,  :ԏ >܏ F `  nԏ v z܏  ԏ  ܏  ԏ  ܏   ԏ ܏ 0  Nԏ R V܏ h  vԏ z ܏  ԏ  ܏  ԏ  ܏  ԏ " &܏ @  Nԏ V Z܏ t  ԏ ܏    ԏ ܏  ԏ܏ *ԏ.2܏P bԏfj܏ ԏ܏ ԏ܏  ԏ܏0 NRԏV܏l ԏ܏ ԏ܏ ԏ܏ 26ԏ>܏P jԏrz܏ ԏ܏ 6ԏ܏ .ԏ26܏H VԏZb܏ ԏ܏ ԏ܏ ԏ ܏( FJԏR܏d ~ԏ܏ ԏ܏ ԏ܏ ԏ"&܏D VԏZ^܏| ԏ܏ ԏ܏ ԏ܏ >BԏJ܏\ vԏ~܏ ԏ܏ ԏ܏ ԏ܏4 F6bԏjn܏ ԏ܏ ԏ܏ ԏ ܏( :ԏ>B܏` rԏvz܏ ԏ܏ 6ԏ ܏ :ԏ>B܏T bԏfn܏ ԏ܏ ԏ܏  ԏ܏0 >ԏFJ܏d ԏ܏ ԏ܏ ԏ܏ ԏ"*܏H Zԏ^b܏ ԏ܏ ԏ܏ ԏ ܏( :ԏ>B܏` rԏv~܏ ԏ܏ ԏ܏ &ԏ.2܏D VԏZ^܏| ԏ܏ ԏ܏ ԏ܏ 26ԏ>܏P jԏrv܏ ԏ܏ ԏ܏ ԏ܏4 FԏJN܏l zԏ܏ ԏ܏ ԏ܏ "ԏ&*܏H Zԏ^b܏ ԏ܏ ԏ܏ ԏ܏, FԏJN܏` nԏr܏~ ԏ܏ ԏ܏   ԏ "܏ 4  Nԏ V Z܏ l  ~ԏ  ܏  ԏ  ܏  ԏ  ܏! !"ԏ!&܏!6!L !^ԏ!b!f܏! !ԏ!!܏! !܏!X!!ԏ" ""&܏"2ԏ"Jԏ"N܏"d "nX"z"܏"ԏ" ""܏"ԏ"ԏ"܏# #X#*#2܏#6ԏ#p #~#܏#ԏ#ԏ#܏# #X##܏#ԏ$ $.$6܏$Bԏ$Zԏ$^܏$t $~X$$܏$ԏ$ $$܏$ԏ% ԏ%܏%$ %.X%:%jԏ%n܏%r% %ԏ%%܏% %X%ԏ%܏%& &X&&ԏ&*܏&.&L &VX&^&ԏ&&܏& &ԏ&&܏' ' X'ԏ'܏''8 'BX'N'V܏'Zԏ' ''܏'ԏ'ԏ'܏' 'X'ԏ'܏'( (&X(2ԏ(6(:܏(p (ԏ((܏((X(܏(ԏ( ()܏)ԏ)*ԏ).܏)D )NX)Z)b܏)fԏ) ))܏)ԏ)ԏ)܏) )X*ԏ* ܏**, *6X*Bԏ*F*J܏* *ԏ**܏*X*ԏ**܏* +ԏ++܏+&ԏ+.+2܏+H +RX+^+f܏+jԏ+ ++܏+ԏ+ԏ+܏+ +X, ,܏,ԏ,P ,^,f܏,rԏ,ԏ,܏, ,X,,܏,ԏ- --܏-"ԏ-:ԏ->܏-T -^X-j-r܏-vԏ- --܏-ԏ-ԏ-܏. .X..:ԏ.>.B܏.T .ԏ..܏. .X.ԏ.܏.. .X./ԏ/"/&܏/8 /nԏ/v/z܏/ /X/ԏ/܏// /X/0ԏ0܏0"08 0jԏ0r0v܏0 0X0ԏ0܏00 0X0ԏ0܏00 1X11Rԏ1V܏1Z1t 1ԏ11܏1 1X1ԏ1܏11 2X2 ԏ2܏220 2:X2Bԏ2F܏2J2h 2rX2~2ԏ2܏22 3 ԏ33܏3, 36X3>ԏ3B܏3F3d 3nX3vԏ3z܏3~3 3X33ԏ3܏34 4:ԏ4B4F܏4\ 4fX4nԏ4r܏4v4 4X4ԏ4܏44 4X45ԏ55 ܏5 5^ԏ5f5j܏5 5X5ԏ5܏55 5X56 ԏ6܏66( 6Zԏ6b6f܏6| 6X6ԏ6܏66 6X6ԏ6܏66 6X77 ܏7ԏ7@ 7N7V܏7bԏ7zԏ7~܏7 7X77܏7ԏ7 78܏8ԏ8*ԏ8.܏8D 8NX8Z8bԏ8f܏8 8ԏ8܏888X8܏8ԏ9 9.96܏9Bԏ9Zԏ9^܏9t 9~X99܏9ԏ9 99܏9ԏ: ԏ:܏:$ :.X:::B܏:Fԏ: ::܏:ԏ:ԏ:܏: :X::ԏ:܏;0 ;Bԏ;F܏;R;j;rX;z܏;~ԏ; ;;܏;ԏ;ԏ;܏< <X<<:ԏ<>>܏> >Nԏ>V>Z܏>p >zX>ԏ>܏>> >X>>܏>ԏ? ??܏?"ԏ?:ԏ?>܏?T ?^X?j?r܏?vԏ? ??܏?ԏ?ԏ?܏@ @X@@"܏@&ԏ@` @n@v܏@ԏ@ԏ@܏@ @X@ԏ@܏@@ @XAA ܏AԏA@ ANAV܏AbԏAzԏA~܏A AXAԏA܏AA AXAA܏AԏB B.B6܏BBԏBZԏB^܏Bt B~XBB܏BԏB BB܏BԏC ԏC܏C$ C.XC:CB܏CFԏC CC܏CԏCԏC܏C CXCC܏CԏD0 D>DF܏DRԏDjԏDn܏D DXDD܏DԏD DD܏EԏEԏE܏E4 E>XEJER܏EVԏE EE܏EԏEԏE܏E EXEԏE܏EF F&XF2F:܏F>ԏFp F~F܏FԏFԏF܏F FXFF܏FԏG G.G6܏GBԏGZԏG^܏Gt G~XGG܏GԏG GG܏GԏH ԏH܏H$ H.XH:HB܏HFԏH HH܏HԏHԏH܏H HXHԏH܏HI IXI"I*܏I.ԏI` InIv܏IԏIԏI܏I IXII܏IԏJ JJ&܏J2ԏJJԏJN܏Jd JnXJvԏJz܏J~J JXJJ܏JԏJ JK܏KԏK*ԏK.܏KD KNXKZKb܏KfԏK KK܏KԏKԏK܏K KXLԏL ܏LL, L6XLBLJ܏LNԏL LL܏LԏLԏL܏L LXLL܏LԏM0 M>MF܏MRԏMjԏMn܏M MXMM܏MԏM MM܏NԏNԏN܏N4 N>XNJNR܏NVԏN NN܏NԏNԏN܏N NXNԏNO܏O$ O.XO6ԏO:܏O>O\ OfXOnԏOr܏OvO OXOԏO܏OO OXOԏO܏OP PXP"ԏP&܏P*PL PVXP^ԏPf܏P~P PXPԏP܏PP PXPPԏP܏Q Q2ԏQ6܏QBQZQ^ԏQn܏Q QXQԏQ܏QQ QXQԏQ܏QQ QXRԏR ܏RR0 R:XRBԏRF܏RJRl RvXR~ԏR܏RR RXRԏR܏RR RXRԏS ܏SS S*XS6ԏS:S>܏Sd SnXSvԏSz܏S~S SXSԏS܏SS SXSԏS܏ST TXT&ԏT*܏T.TP TZXTbԏTf܏TjT TXTԏT܏TT TXTԏTT܏U UXUԏU܏U"U@ UJXURԏUV܏UZU| UXUԏU܏UU UXUԏU܏UU UXVԏV ܏VV0 V:XVBԏVF܏VJVl VvXV~ԏV܏VV VXVԏV܏VV VXVԏVV܏W W&XW.ԏW2܏W6WT W^XWfԏWj܏WnW WXWԏW܏WW WXWԏW܏WX XXXԏX"܏X*XD XNXXVԏXZ܏X^X XXXԏXX܏X XXXԏX܏XX YXY ԏY܏YY4 Y>XYFԏYJ܏YNYp YzXYԏY܏YY YXYԏYY܏Y YXYԏY܏ZZ$ Z.XZ6ԏZ:܏Z>Z` ZjXZvԏZzZ~܏Z ZXZԏZ܏ZZ ZXZԏZ܏Z[ [X[&ԏ[*܏[.[P [ZX[bԏ[z܏[~[ [X[ԏ[܏[[ [X[ԏ[܏[\ \X\֏\؏\>֏\L \V؏\f֏\v\z\\\\ԏ\\܏\\ \\\\]] ]]]&ԏ] ] ]ԏ]܏]] ]ԏ]]܏^ ^*ԏ^.܏^2^H ^bԏ^j^n܏^ ^ԏ^^܏^ ^ ^ _Fԏ_J֏_Nڏ_܏_؏_ `` `` `*`:`T`` `j`n`z```````````$aXa4a>XaBaLaZXanXaaaaXaXbbXb(b6XbHbVXbhbvXbbXbbXbbXbbXccXc(c6XcHcVXchcvXccXcXcdXd"d,d6Xd\dfXdjdtdXdXddde Xe.XeTebXeteXeXeeef Xf&Xf:Xf`ftffXfXggg<gJXgbXgXgggXggXghh Xh0h:Xh>hHhRXhVh`hjXhnhxhXhhhhXhXhhhXhiXiiiXii(i2Xi6i@iJiNXijXinixi jT jvjjjjjj jjjjjjk k llllllmm mm"m.m:mH m mmmmmmm nn nn"n*n.nT n` nzn~nn nnnn nnnno o$ oT pnprpp ppppp ppppq q"q( q6q:qNqXqbqfqq qqqqq rrr0 rDrpr~XrrrrXrrrrssXss$s2s8sFsLsZs`stsXssssss stuXuuu*u0u>uP udux u uԏu֏u܏v؏v ڏvP vX v vvvvvvvv vvwwwww2w:wFwNҏw\ wrҏwwwwwww wwwxx RxBҏy, Ly>yyyzzz z z, zBҏzl zt z zzzzz {{{{{&{*{ { { {{{|| ||4|@ |J|N|Z|f|r|v}}6ԏ}>֏}B܏}F؏}Nڏ} } } }}}}}~~ ~, ~6~:~F~R~^~b~f~~ R~ҏ~ $ , X bnx Del t   *6:ԏ ֏ڏ܏"؏j֏x ؏֏ԏ܏ *6:>R$VԏZ܏^  : <@ @z!Lҏ ֏֏ ؏&֏4 >؏N֏^bnxԏ܏ ԏP \ x Fҏ ֏֏؏֏$ .؏>֏NR^drԏ~܏ ԏ  ( B\ t :  jԏv֏z؏~܏ڏ   <FJV`jn $, 6h | *6>` :T u u D"i <,"iBFNdnr  u"iD <ߙhߙ0 @L FZҏbt~    &*6<Rlvx   ".:Bl t   *26nڏr܏ԏ֏؏֏ ؏֏".8BFԏRV܏t $ԏ܏ ԏ܏< T :p <Pߙ @ Fҏ $.0 :֏R֏V؏r֏ ؏֏ԏ܏  &2:>Rԏ   (24 >JV^f֏j؏֏ ؏֏ԏ܏ *.:FNRfԏ|  ߙd vԏz܏  :  ԏ֏ڏ؏܏D nr$   : :4 VZfpz h t  < <`F < < @ @Ll ,Lfjnr "$ X z~ , 8 bt   : 4@ JNZfnrv  ^ԏj֏nڏr؏v܏ ؏֏,6:FPZ^ԏjn܏ T D u"$&ԏ*܏.T fԏj܏  : : <.@ <F2D <Z֏^؏z֏ ؏֏ԏ܏ ".:BFJ^ԏk   < @*4 @b֏f؏֏ ؏֏ԏ܏ &*6BJNRfԏ|   , 6:FJV^p "i"i$"i6D <d"iz~ԏ܏  .ԏ2܏L ^d :| uT u  ^ԏbڏj֏n؏r܏ $, < uT : < @< ^bnx X d  &.X z~ , 8 d t u : ".:FJNp  ڏ"؏&܏:ԏ>֏r֏ ؏֏$ԏ܏  : :` < > @ @֏؏֏, 6؏F֏VZfpz~ԏ܏ ԏH T n֏r؏֏ ؏֏ԏ܏( 26BNVZnԏ    :"&ԏ26܏T` jnz  VԏZڏ^֏b؏n܏  0< JRVZ^vҏ l8 י°  , :BFJR   2:>HV^|Ĉ ĒĖĚĞĢ    ŦԏŪ֏Ů؏Ų܏žڏ֏ &؏6֏dvv~̺̼ ֏؏֏$ .؏>֏NR^hrvԏ͂͆܏ͤͰ ͺ;ԏX d ΀˙ΒΚԏΞ΢ήЏβ܏ζ ֏؏֏ ؏*֏:>JT^bԏnr܏ϐϜ ϦϪ϶ԏ  ؏&.ԏ6:FЏJ܏Np z֏ВДЦШо 68NPfh~ріјѮѰ&(>@VXnp҆҈ҞҠҶҸ*0FH^`vxӎӐӦӨӾ 28NPfhԎԔԬ6ԏ:BFNЏR܏Vx Ղ֏Ւ؏զժնԏ܏ &2:>Bd x *ԏ.ڏ2֏6؏V܏װ ׺؏֏4@ JNZfnrv؜0Ldـٜ ڬ R,>FRVЏ| ۆ֏ۊ؏۰ ۺ؏֏(4 >BNZbf  ( fRVZ^bjnzݘݸ   &4PZ\ nސޞެ޶޸  f Џ, <˙$0 :FRZt  6ҏvD ulƙ˙ F˙ F ,H fh˙|" ;  @N\fh |ƙ(Lƙ˙Џ  F"ЏD P˙bnr~Џ  F Џ< T ffvx fЏ ˙.:>JЏh x"֏؏ ؏֏0< FJVbjn  Џ  $ 8 JZ^jЏ Џ Џ 6FJVЏt Џ Џ $<JXbd vЏ Џ  *ЏH h| f  Џ< JZ^jЏ Џ Џ *:>JЏh vЏ Џ  T| u ;$.0 Xjt~  "0xƙ˙Џ , F6DVbjrЏ ˙Џ  F 2@RZfjЏ  fv f&.6ЏX h˙zЏ "Џ (@ T ^rЏ Џ  *ЏH VfjvЏ   "FVZfЏ   u(l|   "$ Tfpz|  f  4 D\ Wrz ֏؏ ؏֏2>@VZt~ 8 D fn  8Xx    0BLVX p f   u H   "8BD t  f   4D p < T h   DN|  , fL x    DV`jl  uTd    ,BPZ\ jr 0D`  f     2 < F H  ^ h z          (  `  p        0 H         " L X  b x       0 P d          (26`l v  vԏzڏ~֏؏܏֏  ؏֏*.:DNRԏ^b܏ <l &֏*؏F֏T ^؏n֏~ԏ܏  ԏ  &$4FҏTn$$ R ֏"؏>֏L V؏f֏vzԏ܏ ԏ( 4 hz~ԏЏ܏  f"&2Hp   W W W W W8 WT Wp W W W   ҏ kL `x  ҏ hԏ܏"DNP f fԏЏ܏ ˙"&.Dt ԏЏ܏ (˙:BԏFJVЏZ܏|   F D ut ; ԏ"*Џ.܏T `˙rzԏ~Џ܏   F ` u ;  2 < F H  |  ԏ   Џ ܏      ԏ!܏!$ !X!l!!ԏ!܏! !! !!!"""&"( "j"x"""" """""## #, 6#T #l #~######## #$ $ W$8 W$T W$p W$ W$ W$ W$ W$ W% W%8 %L %d %rҏ%% k% %% & &6ҏ&L h&b&x&ԏ&܏&&&& & f''ԏ'܏'8 'l'''ԏ'܏' '' (((((4(>(@ (N(((((( ()))),)6)8 )F) 6) ) ))***&$*4*Nҏ*d*v$**$**$**+ + +8+J+R+V+Z+t+~+ԏ++܏++ ++,,,,,(,2,6ԏ,B,F܏,h,t ,~,,,,,,,ԏ,,܏,- - --, -8 -ԏ-֏-؏-܏-ڏ. .*...:.D.N.^.x. ........4..L/$/2/`/p/////////0 0$020L י0 00000001 1111*12161:1 1 1 1111122(24 2>2B2N2Z2b2f2j2 2 2 22 2 3R֏3Vڏ3Z؏3^܏3ԏ3֏3 3؏3֏34 4ԏ444&Џ4*܏424T 4^֏4n؏4~֏4 4؏4֏444444ԏ44܏5 5 5"5&525>5J5N5bԏ5 5 5؏5v55 f5v56 6v6 6.64 6>v6L 6Zv6b6h f6rv6z6v66ԏ666Џ6܏66 6֏6؏7 ˙7؏7"֏7>֏7L 7V؏7f֏7v7z7777ԏ77܏77 77778 888&ԏ8` 8l 88ԏ888Џ8܏88 8֏88ԏ899 Џ9܏998 9B֏9V9bԏ9f9j9rЏ9v܏9~9 9֏99ԏ999Џ9܏9: :֏:":.ԏ:2:6:BЏ:F܏:J:l :v֏::::::ԏ::܏:: ::;;;;";&;H ;` ;ԏ;֏;ڏ;؏;܏>>>&>*>.> > >>>>>???8?D ?N?R?^?b?n?z? ??????@@$ @.@2@>@J@V@Z@^@ @ @@ @@@AA AA(A4 A>ABARAVAbAlAvAzAA AAAAAAAABB B0B< BFBJBVBbBnBrBvB B C.ԏC2ڏC6֏C:؏CF܏C֏C C؏C֏DD6D:DFDPDZD^ԏDjDn܏DD DDDDDDDE EE`EzEEEEԏE܏E EEEF יF"F.֏F2؏FN֏F\ Ff؏Fv֏FFFFFFԏFF܏FF FFGGGGG.ԏGt G GGԏGGЏG܏G G֏G؏H֏H H؏H.֏H>HBHNHXHbHfԏHrHv܏HH HHHHHHHHԏI I I6I8ITI` Il IԏI֏IڏJ&܏J*؏Jh JKK KK K*K:KTK` KjKnKzKKKKKҏKK ϙKLL*LFLJLPLl LzL|L L LLLMMM"M<MH MRMVMbMnMvMzM~M M N, NNNRN^NhNrNNN NNNNNNNO O O:O<OXOd Op PԏPڏP"֏P&؏P2܏Pz֏P P؏P֏PQQ"Q&Q2Q<QFQJԏQVQZ܏QxQ QQQQQQQQQ"QRR.ڏR\XFXJXPX^ԏXb܏Xt XXXX X֏X؏X֏X X؏Y֏YYY&Y0Y:Y>ԏYJYN܏YlYx YYYYYYYYԏZ, Z8 ZRZd fZzZvZZ ZvZ ZZ fZZ Z F[[ԏ[Џ["[&[2܏[6[\ [j[t f[v[[[ [ [[ f[[ԏ\\ Џ\܏\\8 \H˙\^\bԏ\f\jЏ\v܏\z\ \"\Џ\\֏\؏\֏] ]؏]&֏]6]:]F]P]Z]^ԏ]j]n܏]] ]]]]]]]]ԏ] ^ ^"^&ԏ^.^2܏^>^X ^j^rԏ^v^zЏ^܏^^ ^^ԏ^^Џ^܏^^ __:_lƙ__ԏ__Џ_܏__ _ƙ``ԏ``"Џ`.܏`2`P `f`p ``ԏ``Џ`܏`` ` ``ԏ``Џa܏a a( a:aBԏaFaJЏaV܏aZax aaavaƙb bԏbbЏb&܏b*bH bdƙbbԏbbЏb܏bb bvbb ccԏccЏc"܏c&cD cVvc\ cncpccccccccccccddd*d,dBdDdZd\drdtddddddddddeeeee2e4eJeLebedeze|eeeeeeeeeef f f"f$f:f<fRfTfjflffffffffffffggg*g,gBgDgngtggggߙgߙgߙhߙhh8 hL hԏh֏i܏i؏iڏiX iiiiiijjj0j< jFjJjVjbjjjnjrjjpppp pppq יqP qrqvqqqqqq qqqqqqrrt r r rrrrrrss s*s.s:sFsNsRsVs| s ssssssssssttt&t(t>t@tVtXtntptttttttttttuuuu.u0uFuHu^u`uvuxuuuuuuuuuuvvvv v6v8vNvPvfvhv~vvvvvvvvvvvwww&w(w:w@wVwXwnwpwwwww w xRԏxVڏxZ֏x^؏xj܏x֏x x؏x֏yy(yByFyRy\yfyjԏyvyz܏yy yyyyyyyyyyz@zXzvzzԏz܏z zzz יz֏z؏{֏{( {2؏{B֏{R{V{b{l{v{zԏ{{܏{{ {{{{{{{{ԏ|@ |L |f֏|t |~؏|֏||||||ԏ||܏|} } }}}&}.}2}6}Jԏ}` }l } } ~ԏ~ ֏~ڏ~6؏~R܏~ ~~~~~~~~  ".26ZxЏ  26BLVf , 8 h fzЏ ˙"*.ЏP l"!o!( JNZdn~   2BFRVЏt !o!Џ :JNVZЏx  $ ԏڏ֏؏܏֏  ؏֏*.:DNRԏ^b܏ 2:ԏ>FNЏR܏Z| ֏؏֏ ؏֏ԏ܏4@ JNZfrvԏ  ؏ f2v6@ N\ fjԏЏ܏ ֏؏˙ԏ"*Џ.܏6X b֏x"֏؏֏ ؏֏ԏ"&܏DP Z^jvԏ  0>@!nzԏ~Џ܏ ֏ԏЏ܏"H R֏fx fv  fԏЏ܏ , 6֏L˙rzԏЏ܏ ֏ԏЏ܏$ .֏BJԏRVbЏf܏j ֏ԏЏ܏ ֏D\  ԏ&֏*܏.؏6ڏ|  *.2L^fnvzЏ  8D NR^jvz   f6:vFvJvVvpƙ  f˙ *4>Nht ~  "ЏD jz~Џ Џ ",ƙ>NRZ^Џ   rԏv֏؏ڏ܏ ؏֏d~ >H  &<Vl@Rh<Nd~ 8Ph fv"BHƙԏЏ܏ *֏.؏J֏X b؏r֏ԏ܏  *ԏ  ƙԏ Џ܏"D Zd v fԏЏ܏ ˙ ؏֏*֏8 B؏R֏bfr|ԏ܏ ԏ$ 0 JRԏZ^bЏf܏n ԏЏ܏    &:NbvFjZƙԏЏ܏8 TԏЏ܏  ߙ <ԏ܏ ™ phLߙx  ԏ܏ ™H pRhߙ  ԏ܏ ™*.6 phߙߙ$h ߙ ߙ ߙ0BT lߙ ߙ$ <Tߙhz ߙ  $ߙ8J\ tߙ ߙ $ߙ8J\ pߙ  *4>BԏNR܏p|   ~ԏ֏؏܏ڏ   4BJNXfn  u , 4 T bjnx 0 8 X fnr| ԏ֏ڏ؏܏"֏0 8 B؏^֏l ԏ*.܏LX bfr~ԏ܏ ߙ T ulߙ uԏ܏  ".XbTzTߙߙT ~؏"֏>֏L T ^؏z֏ ԏ܏ "&:ԏVZt~ԏ܏ ֏؏֏ ( 2؏N֏\ fjvԏ܏ ԏ"ԏ&֏*؏.ڏ2܏ $ .2>JRVZx :¬ ( 26BNVZk  L` :rĖĨ <ľ >\"ix @ŒŠŪŮŲ  f u4 :PtƒƞƮƲЏ @JL VbnvnjǮǼ  @ @T vzȆȌȖȢȦ ( 4 `!oxɊɒɚɢЏ  fЏ8 JNVlvzʊʨʴ ʾ uT"i|˜˸ u  ̖ԏ̢֏̦ڏ̪܏̺؏֏ ؏*֏:>JT^bԏjn܏͐͜ ͦͪͶ :֏؏"֏0 :؏J֏Z^jt~΂ԏΎΒ܏ΰμ ԏl x Ϝ ::P <bЀ >Ж @&*4>@ X fpѐ Ѽ : @؏֏֏ &؏6֏FJV\jԏv܏ҐҚҜ ҦҪҶԏ   BFԏNV^Џb܏ӈ Ӥ!oԏ".Џ2܏P h f~ԊԎԏԚԞЏԦ܏  ԏ܏<H R^jrՄը  ԏ֏؏ڏ܏b֏p ׆֏פ׮ײ׾ԏ &2:>B` :r֏v؏؜ ئ؏ض֏ԏ܏( 26BNVZnԏ  $ :B$ښڶԏھ܏  X <۰ ߙ܈ > @ @֏؏8 B؏R֏bfr|݆݊ԏݖݚ܏ݸ  ԏ , FJ`jnވޔ ޞު޶޾ "- F*ߤ߲߮߶ߺ ԏЏ܏,  > ߙ *< RVԏZbjЏ Pdv$$  ԏ֏ڏ؏܏$ .؏>֏\fjvԏ܏  :.֏2؏N֏\ f؏v֏ԏ܏ .ԏ   :$2ԏ6܏L ^zԏ~܏   <` < l >  ".6JNZt~  @ @֏؏֏ ؏*֏:>JT^bԏnr܏ ԏ  "8BF`l v "- Flvz~ ԏЏ܏ d >&@JL Vnr~  *DNP Znԏvz~Џ܏ $ 4N$z$  zԏ~֏؏܏ڏ *4>Bht ~v f&(!o>\!o~   fЏ < ^bnx X d ˙Џ ˙$ FJV`jz   "26>BЏ` zЏ Џ 8PpzЏ *:>BFЏh   ֏ ڏ؏"܏2ԏb֏p z؏֏ԏ܏( 26BNZ^b|v f>Zvx   fԏЏ܏ ֏*؏:֏H R؏b֏rvԏ܏  ԏh t ؏˙ԏЏ܏ ֏˙&؏*֏F֏T ^؏n֏~ԏ܏ .ԏL X rzԏЏ܏ ֏ԏЏ܏$ .֏BNԏRVbЏf܏j ֏ԏЏ܏ &֏:BԏJNVЏZ܏b ֏؏  fԏj֏ڏ܏؏ HXrv $ lZ$^bx $$$$$$$$$4 H!RnJ  ™       & 6 P \  f j v        T  v z              ,  8  \     $   6$ Fv Xƙ n z ~Џ      Џ   h$4 pz$ $vƙЏ ( @ frvЏ~  h$ $.$H Vvdƙ Џ Џ*D pz$ vƙ  Џ0 ^jnЏz $,6$T fh $ P$$  JvXƙnz~Џ  Џ X $ $( :< ^$t V$  vƙ*Џ:P | Џ $ $$ >$Nv\ƙr~Џ   Џ, \ hn$ $$ 6$FvTƙjvzЏ   Џ, d hz$  $ jv0ƙFRVЏ^|  Џ ZfjЏv h $ $ $8 B$` j$   $   ڏ ֏ ؏ ܏ ԏ ֏  ؏!֏!$!.!2!>!H!R!Vԏ!b!f܏!! !!!!!!!!$! l!$"$" ",!"6"RJ""""ԏ"܏" ™""#@ #d # # # # $ $< $V$h $$ $ h% %ҏ%% %&& &>$&f&h &$& &&& ' ',':'< 'h 'x'' ' ''' ( ((( (L (\(j(l ( ((( ( ()) )0 )@)N)P )| ))) ) ))) *v* ƙ*6*:ԏ*>*F*NЏ*R܏*Z*x *֏*؏*֏* *؏*֏*****+ԏ++܏+0+< +F+J+V+b+j+n+r+ԏ+ + + ,֏,؏,.֏,< ,F؏,V֏,f,j,v,,,ԏ,,܏,, ,,,,,,,-ԏ-( -4 -R-Vԏ-^-b-nЏ-r܏-v- - - .$ .\ . . / /< /t / / 0 0B0X 0| h000 0 0 h110 1l 1 1 2 2T 2 2 h23 3(36֏3R3Zԏ3b3f3nЏ3r܏3v3 3h33 33 3 3 4ԏ4ڏ4֏4؏4܏5֏5 5؏5*֏5:5>5J5T5^5bԏ5n5r܏55 55555555555ҏ66 66686֏6d6֏6؏6֏6 6؏6֏77777&7*ԏ767:܏7X7d 7n7r7~77777ԏ8 8, 8F8J8V8d8n8r88 88888֏8؏8֏9 9؏9֏9.929>9H9R9Vԏ9b9f܏99 99999999ԏ9 9 :::&:4:>:B:`:l :v:::::;;;;&;H;R;T ;f;;;ԏ;܏; ;;;;;;< << <4>>8>B>D >Z>d>nԏ>r܏> >>>???$?.ԏ?2܏?H ?X?p??????@ @(@2@4 @F@J@V@\@j@@@ @@@AA,APAtAAABB(BLBpBBBCC"(C8CtC~؏CCCDD"D*D0D>DXDbDd DrDDDDDDD D D EڏE֏E؏E܏EԏE֏E E؏F֏FFF"F,F6F:ԏFBFF܏FhFt F~FFFFFFFFFԏFFFЏF܏FG G&֏G6؏GF֏GT G^؏Gn֏G~GGGGGԏGG܏GG GGGHHHH&ԏHt H H؏HH fHԏHHHII fI6I:ԏIBIJINЏIR܏I^I I֏I؏I˙I؏I֏I֏I I؏J ֏JJJ*J4J>JBԏJNJR܏JpJ| JJJJJJJJԏJ J KK ԏKKKЏK܏K&KH KR֏KfKpK~܏K KKKLL!oL.L0!oLFLH!oLVL L LM^ԏMb֏MfڏMj؏Mr܏M M؏MMNNNN&N*܏NHNT N^NbNnNzNNNN.N0NOOЏO܏O0"O| O O O!P6P:0PFhPx PPP P 7QQQ"Q&Q*Q6Q؏QQ2R fRBR nR؏S؏S:2S>ST fS2S˙S؏S T TTT&THTT TbTfTrTTTTTT TTTUU DUz؏UlUUUUUV VVVV"V&VP VV W$ lW8WZW^WtW WWWWWW WWWWXX X&X0X:X>XXXd XvXzXXX X2X؏Y Y؏Y*Y.Y:YDYNY^Yb܏Y|Y YYYYYYYZ<_Z@ ZL Z~0Z ?ZZ ZZ[[ [.[4[>[`[l [v[z[~[[[[[ [[[[\\ \&\*\6\B\Z\`\j\\ \\\\\\\ \ ]]]"]@]L ]V]Z]^]b]z]~]^ ^ N^.^8 ^x"-^!)^^^_ _ _R_T_^_b__ ___`2`<`F`J`t` `````````` a aaab0af2avaЏaaaa܏a"b؏b( b2؏bZb`bjbzb~܏bb bbbb b c&c8 cT chcvcx c0c 7d0d 7dBhd~dddddddd e eeerexeeee eeeeefЏf ܏f"f, fVfZf^fjЏfn܏ff ffffffg gggg.hgNg\ gzhg0g 7g0hh 2h:0hBhJhRЏhVhZhn܏h| hhhhhh hhhii"i&i6iHiT ibifiriiiiii iijjj j jL pjf0jrjzj~jЏjj܏j jЏjjjj0j܏jk k2k"2k.k@ kh kvkx kk؏kkkkkll l$ l>lDlNlRltl lllll lllmm( mt m؏mmmmm mmn nnnD nnnnn nnnoo(o:oHoT ofojonoooooo0o܏oop pppp*p2p6pX pt 7pppppppp܏qq q"q*q:q>0qJhqx qqq q 7rr*r.r:Џr>܏rBr\ rjrzr܏rr r r r sFԏsJ֏sNڏs܏s؏s s t t"t&t2t<tFtVtZ܏ttt ttttttttttttuuuXuFuLu^up uuuuvv.v@ vTvdvtvvvw w$w4wDwTwwww xxx$x4xj$xtxxxx xy ytyyy yyyzzz z0zzzz z{{{${{{{ {{|||(|8|H|X|h|x||$|}$}H}Z}l }}}}}}}}~~~ ~n$~~~FFD F (4 >BRZ^z|  ܏4@ JNZ   ܏  "&2>FJ   ܏ ".6:r܏ $ , X nt܏ ԏ֏ڏ؏*܏Z֏h p z؏֏ ԏ܏ *6>BFnz~XF֏ ,<F֏v$֏  ,6֏f$p֏  &֏V$`֏  &֏V$`֏  ,6֏f$p֏  ,6֏f$p֏  ,<L\l|֏$<J֏dv  ,<J֏$F*F` F  *.BFbd  >RXfԏr܏ ֏؏֏  ؏֏, BHVԏb܏| ԏ֏   ؏֏( >DRԏ^܏x ԏvԏ܏ ֏؏"֏0 8 B؏^֏l ԏ܏ ԏԏ֏ڏ&܏*؏d l    "*.2Zbjrz~$FX X&X0:XDNXXbXlvXXXX XX<N` t~XXXXXXXX6XXfXXX X6XFXPZXdnXxXXX X.X8BX`r XXXXX X2XTbXXX XX"X,6X@JXTbXXXXX"4 HRX\fXpzXXXXXX&XJXT^X| XXXXX"X,6X@JXT^XhrX|XXX"X,6XTfx XXXXXXX"X,6X@JXT^XXXXXFNXzX XX2XfXXXF$4 F\h rv XX XRXX H P p  0 8 X nt &X^XXXX28ht ~   @L VZnvznԏrڏv֏z؏܏֏ ؏֏",6:ԏFJ܏ht ~XF֏8F$L\f$$$$8LV$x֏$$Tb֏$$DN$h~$֏$,֏$<h$$$֏f$$֏(6$<P|$$ ,:$DZ֏$֏$4B$HV֏$֏&$,:֏f$֏ ֏֏$ L֏֏$2֏€Ž֏¬֏$0@N֏lÌÖ֏$FFFĀ  Ů֏Ų؏֏ ؏֏&ԏ2܏6P\ fjvƂƊƎƢԏ  :RXfԏr܏vǔǠ ǪǮǺF ( :P\ fjnɂɊɎɢɤ ԏ܏( 26Bʄʰ0HdˀˠH`x̬̔Dp͒FͮF4Lh΀ΠδFF`tϔϬDfFІF ֏؏2֏@ J؏Z֏v|ъԏі܏њѴ ԏ ( B֏P Z؏j֏҆ҌҚԏҦ܏Ҫ ԏ, 8 Tvӈ ӜӬ ( <`xԔ԰ *< PrՄ ՘պ 0Hdր֚֬ (D`z׌ נ$@Zl ؀ؤ $8 L پԏ֏ڏ܏"؏\ ~ڂڎژڢڲ  &ҏ~ۆۊێۖ$ۚۦ۪ۮ۲FXHVXbXx܂X܌ܖXܠܪXܸXXXX$.XhrX|݊XݤݾXXX X*X8FX^XhrXޘޢXެ޶XXXXX6X@JXVFߞXߴ X$ RX < H XXX"XVXXXF $0 FJV` nX~  @ nt   , Z`   "4 Ht X( <h t ԏ֏ڏ>܏B؏|  &*.BNRVbfnvFXXX$X@T^$XXX$X$$.$P^XvXXXX$.X8BXF$nX$X$X$0DN$p~X$XX$&X2XbXXXXX&X0:X>$HRXX$XX XFRXd XX *0\h rv $ ^XvXF    .X>D Rfl X XD rx   4 bh   2D XXXX(8FX lXX , @T ` ԏ֏ڏ܏"؏\ ~܏  &26:F$JRZbfFvXXXX .X@JXTbXtXX X"X,:XNXpXX$LZXrXXX X *X4>XnXxXXXX$2XDNXXfXxXX X"X,:XNXpXXX0:XxXXXX X.XPdXXXX<JXbXXXX X0:XDNXXbXlvXXXXXX&X0:X`jXt~XXXXXXX"XHRX\fXXXXF"X8 rX ܏ ".:BF   X >X nX X X F    & < H  Z b f r |  X      ܏      " . h    ܏         0  <  `    ܏         (  4  b t       @NX`pX  .X@PdrX  0LhvXXX ,<Tdt   "ԏ&֏BڏF؏^܏֏ ؏֏ ԏ܏8D NR^jrvz  D N֏؏֏ ؏֏  *.ԏ:>܏\h rvԏ  *4 &*6:LVZԏfj܏ ֏؏֏ ؏"֏26BLVZԏfj܏ ԏ  ֏, 6؏F֏VZfpz~ԏ܏ ԏ ( < H ԏ֏ڏ؏܏4 < h rv Xd WNHXp(8HXx   8 H h x     !!(!8!X!h!!!!!!"" "H "nF" "F" "F" #F#( #NF#` # # $ $8 $l $ $ % %< %p % % & &H &| & & ' 'X '|' b''''(( d( \(,(:d(L(p W(N( ) )>d)H )t )~))))))) ))))** **6*>*F*J*`*j*n** ********++,+8 +B+R+V+b+f+x++++ +++++,, , ,,",.,6,d ,l , ,,,,,,,, -- --"-*-.-2-| - - ------.. .."...:.B.F.J/ԏ/"ڏ/&֏/*؏/6܏/֏/ / /؏/֏/ //////ԏ0 0܏0,08 0B0F0R0^0f0j0n0֏0X0֏00d1X118 W1TN1fF1j1X11X11X11X12X22X2 26X2<2FX2T2jX2p2zX22X22X22X22X22X22X3X33"X3,36X3JX3T3^X3h3rX3|3X3X33X33X3X33X33X44X4&X404:X4D4NX4X4bX4vX44X44X44X4X44X44X5 52X5H 5jX5 5X5 5X5 6X6( 6JX6` 6X6 6X6 7X7 7:X7P 7rX7 7X7 7X7 8X80 8ZX8p 8X88 b8X88X88X8֏99 X9909H \9X9t9 W9N9X: :֏:؏::֏:H :h :r؏:֏: ::::::ԏ::܏:; ;;;";.;6;:;>;Rԏ;j;r;z;~;;;ԏ;;܏;; ;;<< <<<,<6<:ԏ؏=Z֏=h =r=v====ԏ==܏== ====>>> >ԏ>6֏>:؏>V֏>d >l >v؏>֏> >>>>>>ԏ>>܏?? ???&?2?:?>?B?Vԏ?ԏ?֏@ڏ@"؏@2܏@| @@@@@@@@ AAAAA*A.A2ArXAAdAAA B"FB@ BpBBBBBCC C4CDCt CCCCCCCC CCD DD"D&D*D D D E, ENERE^EhErEEE EEEEEEEF F F6F>FFFJF`FjFnFF FFFFF G$ GFFGT G G GG bHHH,H@HVdHlHzdH \HH WHNHHdIIII"I8IBID INIZI| I IIIIIJJ(J4 J>JBJNJZJfJjJnJ J J WJNK K KԏKڏK֏K؏K܏K֏K K؏L֏LL"L.L8LBLFԏLRLV܏LtL LLLLLLLL֏LXM֏MMdM*XM8MJFMNMbXM| MXM MXNNXNN&XN0N:XNDNNXNbXN~XNNXNNXNNXNN֏N؏N֏O O؏O"֏O2O6OBOLOVOZԏOfOj܏OO OOOOOOOOԏP4 P@ P P֏P؏P֏P P؏P֏QQQQQ&Q*ԏQ6Q:܏QXQd QnQrQ~QQQQQԏQ Q QQRR R R*R.ԏR:R>܏R`Rl RvRRRR R SXS SBXST SrXS|S bSSS֏SSXSTT0 \THTl WTNTTTTTTTT TTUXU$ UB֏UF؏Ub֏Up Uz؏U֏UUUUUUԏUU܏UU VV VV"V.V2V6VJԏVh Vt V WVNV V W:ԏW>֏WBڏWn؏W܏W WWWWXXX0X< XFXJXVXbXnXrXvXXXXdXXY YbFY YYYYYZ$Z4ZLZ\ZtZ ZZZZZZ[[ [*[.[:[F[R[V[Z[ [ [F\ \\ \ \\\\\\]] ]]"].]:]F]J]N]| ] ]]]]]]]^^ ^^&^2^>^\ ^ ^ ^^ b__(_<_P_x_ \__ W_N_```"`&`<`F`H `R`^` ` ````aaa,a8 aBaFaRa^ajanara a a WaNb b bzԏb~ڏb֏b؏b܏b֏b b؏c ֏ccc*c4c>cBԏcNcR܏cpc| cccccccc֏cXc֏dddd"Xd0dBFdFdZXdt dXd֏d dXeeXe$e6Xe@eJXeTe^XeherXeXeeXeeXeeXeeXef֏f ؏f&֏f4 f>؏fN֏f^fbfnfxffԏff܏ff fffffffgԏg\ gh g gXg h֏h ؏h&֏h4 h>؏hN֏h^hbhnhxhhԏhh܏hh hhhhhhhiԏi, i8 iRiZibifi|iiԏii܏ii iiiij j>XjP jnXj jXjj bjjj֏kkXkk2dkHkVdkd \k|k WkNkkdkkkklll l*l6lJXl\ lv֏lz؏l֏l l؏l֏llllllԏmm܏m$m0 m:m>mJmVmbmfmjm~ԏm m m WmNn n nzԏn~֏nڏn؏n܏o o"o&o2o<oFoVopo| ooooooooXppdp(p:pd pFp qqq(q8qHqqqqqqqr$ rFrJrVr`rjrzrr rrrrrrrsL sX szFs s t t:t>tJtTt^tntt tttttttt u u"u*u2u6uLuVuZuu uuuuu v v:FvD vp vv bvvvww(w@ \wXw| WwNwwwwwwww xxx0 xl xxxxxxxx xxyyyyy"yP y\ y WyNy y zBԏzFڏzJ֏zN؏zZ܏z֏z z؏z֏zzzz{{ԏ{{܏{4{@ {J{N{Z{f{r{v{~{֏{X{֏{{d{X||F||*X|D |X|֏| |X||X|}X}}"X},}6X}@}JX}T}^X}h}rX}X}X}}X}}X}}X}}X~~X~~2X~8~F֏~J؏~f֏~t ~~؏~֏~~~~~~ԏ~~܏~  &.26Jԏ   X, F֏J؏f֏t ~؏֏ԏ܏  &.26Jԏ` l ԏ܏ "< p X X X X(@ b\lz֏Xdd \ W<NLZdjnz~ X ֏؏֏$ .؏>֏NR^hrvԏ܏ ԏ  @ W\Nx  ԏ֏ڏ.؏B܏   ".26rXd F8 l|0`    F  \ ~  @ L fnvz  T   b8P \h WN @ |  *.2` l  WN  :ԏ>ڏB֏F؏R܏֏ ؏֏ԏ܏0< FJVbnrvҏ֏X֏d X*F.BX\ X֏ XX(:XDVX`jXt~XXXXXXXX.X8BXLZXdnXxXXXXXX XX(>XDR֏V؏r֏ ؏֏ԏ܏ &2>BFZԏ   XD ^֏b؏~֏ ؏֏ԏ܏  "&2>JNRfԏ  ԏ܏ *6BNl  X X X0 NX` ~X X X b,:֏DRX\rdd \ WN d*.:>T^` jvX ֏؏֏ ؏֏(26ԏBF܏dp z~ԏ   W(NP \ ԏ֏ڏ؏܏@ bfr| :XHRdl~ F DTl(8L\t  *.:FRVZ  F d   &*6BNRV    ".:Fd   F  @X bt \( WDNTnr~   :>JT^n   , WHNh t  ڏ֏؏܏*ԏ^֏l v؏֏ԏ܏ *.6JXN֏XbdrXX֏dX֏FHl0Pt֏X X X0H bZXdnXxX֏Xd \ W8NXn֏X X, F֏J؏f֏t ~؏֏ԏ܏  &.26Jԏ  ֏؏֏ ؏֏&*6@JNԏZ^܏| ԏ  "8BFԏRV܏x X X 2XH bXx X֏ X X(2X<ZXdnXxXXXXXXX2XRXrXXXXXX*X4FXPZXdnXxXXXXXXXX$.X8FXPZXdnXxXXXXXX XX(6X@VX\fXp~XXX4Lx @`X :>JN`jnԏz~܏ X X &X< VXl X X X X, FX\ vX X bXX X֏&X4Jddnd€ \˜¼ WNd,68 BRXh Â֏Æ؏â֏ð ú؏֏ԏ܏0< FJVbjnrĆԏĜ Ĩ @XpŔŬ0H`xƐƴ 8Phǀǘǰd~ȂXȰ ԏ܏8D NZjXɀ ɚXɰ X X *X.֏P rXʈ ʢXʸ X X 2XH bXx ˒X˨ X X "X8 RXh ̂X̞̔X̨XXXX X *X4>XH^X~X͞X;XXXX>X^XrX|ΖXΠβXμXXXXX$2X<FXPZXdrX|φXϐϚXϤϲXϼXXXXX(2X<JXT^XhvXЀЊXДТXЬXXXXX$@XpшѠѸ0Tl҄Ҩ,D\tӌӤ4Ld|ԔԬ W N8 WTNh | ԏڏ֏؏܏J֏X b؏r֏ւֆ֦֪֒֜ԏֶֺ܏  ">֏fXj֏xׂdל׮ ֏F< p؀ؘبظ(8P^֏b؏~֏ٌ ٖ؏٦֏ٶٺԏ܏  "&2>FJNbԏڰ ڼ F H b֏f؏ۂ֏ې ۚ؏۪֏ۺ۾ԏ܏ &*6BJNRfԏ| ܈ ܢܦܲܶԏ܏ *6>X ݐ ݼ   $ b@P^֏h|ޤ޼ \ WN$>BNRhrt ~ߊ߬ ֏؏֏ ؏֏".8BFԏRV܏t ԏ   W,NH \ ԏ֏ڏ؏܏@ bfr| :XHRdbXpFX X :XLVX`rX|XXXXXXX"X,6X@VX\  ".6:>   X@ |  &*.T ` z~ ( ` ~X X X b,@NXXndd \ WNd&*6:PZ\ frX  *DP Z^jv~   WN ( ԏڏ֏؏܏ ֏ "؏2֏BFR\fjԏvz܏ ֏&X*֏8Bd\n ֏F 0@Xhx֏"؏>֏L V؏f֏vzԏ܏  "ԏp | F  "֏&؏B֏P Z؏j֏z~ԏ܏  &ԏ< H bfrvԏ܏  P |   b֏(<d| \ WN(24 >Jl ֏؏֏ ؏֏ԏ܏4@ JNZfnrvԏ   WN  zԏ~֏ڏ؏܏ "&2<FVp| X d&X4FFJ^Xx X X"X,>XHRX\fXpzXXXXXXX X .X8BXLbXh  ".:BFJ   &XL   *26:` l  4 h X X X X 8 bTdxXdd \ W0N@Nd^bnr X  .2>HRb|    W0NL ` ԏڏ֏؏܏*֏8 B؏R֏bfr|ԏ܏ ֏NXR֏`jd  ֏F0 dt  $ < L ` p    ֏ ؏ ֏  ؏ ֏   " , 6 :ԏ F J܏ h t  ~       ԏ    >F X   ֏ ؏ ֏  ؏ ֏   & 0 : >ԏ J N܏ l x         ԏ       $ . 2ԏ > B܏ d p  z      @ fFp   b֏0Xp \ WN&( 2>` z֏~؏֏ ؏֏ԏ ܏(4 >BNZbfj~ԏ   WN  zԏ~֏ڏ؏܏ "&2<FVp| X d&X4FFJ^Xx X X"X,>XHRX\fXpzXXXXXXX X .X8BXLbXh  ".:BFJ   &XL   *26:` l  4 h X X X X 8 bTdxXdd \ W0N@Nd^bnr X  .2>HRb|    W0NL ` ԏ֏ڏ؏܏D fjv  NX \ fd vX  F  X !X!D !jX!|!X!!X!!X!!X!!X!!X""X"""X"6X"JX"^X"rX"X""X""X""X""X""X##X##&X#0#>X#H#RX#\#jX#t#~X##X##X##X##X##X#$, $N$R$^$h$r$$$ $$$$$$$%L %X % %X% &, &N&R&^&h&r&&& &&&&&&&' ' '*'.':'>'P'Z'^'' ''''' ( (8 (VX(h (X( (X( (X( )X)( )FX)X )vX)) b))))X)**0 \*H*l W*N******** **+X+$ +` ++++++++ +++,, ,,,8 ,D ,h W,N, , -"ԏ-&ڏ-*֏-.؏-:܏-֏- -؏-֏------ԏ--܏.. .*...:.F.R.V.^.v֏.X.֏..d.//, /֏/F/ //00,0<0L0\0l00111,1<1P1`1p1111111222$2<2J֏2N؏2j֏2x 2؏2֏222222ԏ22܏23 3333*32363:3Nԏ3 3 3F3 48 4R֏4V؏4r֏4 4؏4֏444444ԏ44܏55 555&525:5>5B5Vԏ5l 5x 5555555ԏ55܏56 666&6.6H 6 6F6 6 7 70 7\ 7 7F7 7 88 b8<8L8Z֏8d8x8d88d8 \88 W9N9(96d9F9J9V9Z9p9z9| 999 9֏9؏9֏9 :؏:֏:&:*:6:@:J:Nԏ:Z:^܏:|: ::::::::ԏ: : ; W;4N;P ;d ;ԏ;֏;ڏ;؏<܏"X>H >nX>>X>>X>>X>>X>>X>>X??X??&X?0?:X?NX?bX?vX?X??X??X??X??X?@X@ @X@ @.X@8@BX@L@ZX@d@nX@x@X@@X@@X@@ AAA"A,A6AFA`Al AvAzAAAAAB B Bd BXB B CCC"C,C6CFC`Cl CvCzCCCCCC C CCCDDDD"DLDX DbDnDzDD D D EXE, EJXE\ EzXE EXE EXE F XF F:XFDF\ bFxFFFXFFF \G G0 WGLNG\GvGzGGGGG GGGXG H$ HFHJHVH`HjHzHH HHHHHHHH I I, WIHNId Ix IԏIڏI֏I؏I܏JF֏JT J^؏Jn֏J~JJJJJԏJJ܏JJ JJJKKKKK:֏KrXKv֏KKdKKK L2֏L>FL\ LLLLLLMMMhMxMMMMMMMN N N0NHNV֏NZ؏Nv֏N N؏N֏NNNNNNԏNN܏OO OOO*O6O>OBOFOZԏO O OFO PH Pb֏Pf؏P֏P P؏P֏PPPPPPԏPP܏QQ Q&Q*Q6QBQJQNQRQfԏQ| Q QQQQQQQԏQQ܏RR RR*R6R>RX R RFR R S S6FSD Sp S SS bSTT֏TT0TFdT\TjdTx \TT WTNTTdTUUUU(U2U4 U>UJUl U֏U؏U֏U U؏U֏UUUUVVԏVV܏V4V@ VJVNVZVfVnVrVvVԏV V V WVNW W WzԏW~֏WڏW؏W܏X X&X*X6X@XJXZXtX XXXXXXXYXYY&dY6XYDYVFYZYnXY YXY Z"XZ4Z>XZHZZXZdZvXZZXZZXZZXZZXZZXZX[X[X[2X[<[FX[P[ZX[d[vX[[X[[X[[X[[X[[X[[X\\X\\&X\0\:X\D\ZX\`\ \\\\\\]] ]]]&]2]:]>]B] ] ^ ^.X^T ^ ^^^^^^__ ___&_2_:_>_B_h _t _________ ````"`< `t ` `X` `X` aXa, aJXa\ azXa aXaa baab bXb$bLbd \b|b WbNbbbbbccc c&c2cFXcX c ccccccdd ddd*d6d>dBdFdl dx d WdNd d ebԏefڏej֏en؏ez܏e֏e e؏e֏effff"f&ԏf2f6܏fTf` fjfnfzfffff֏fXf֏ggdg(g:gd g֏gFg hh(h@hXhhhxhhiii i8iHiXili|iiiiiiij j$j2֏j6؏jR֏j` jj؏jz֏jjjjjjԏjj܏jj jjkkkkk"k6ԏk k kFk l$ l>֏lB؏l^֏ll lv؏l֏llllllԏll܏ll mmmmm&m*m.mBԏmX md m~mmmmmmԏmm܏mm mnnnn4 nl nFn n n o oH onFox o oo bop p֏p$p8pNdpdprdp \pp WpNppdqq qqq0q:q< qFqRqt q֏q؏q֏q q؏q֏qqqrr rԏrr܏r<rH rRrVrbrnrvrzr~rԏr r r WrNs s$ sԏsڏs֏s؏s܏t֏t t t"؏t>֏tL tVtZtftptzt~ԏtt܏tt tttttttu֏uvXuuduu WuNuvv4vLvdv|vvvvvw w8wPwhwwwwwwx8xHxXxxxxxxyy y0yHyXypyyyyyyzzz,zHzXzhzzzzzzz{ {{,{D{T{d{t{ {F{ {F| |2F|D |p|||||F|F|F} }:F}L } }F} }F} ~$ ~P~h~~~~~ 8Ph  "F4 VFh F F  2FD vF F F ( Ld b֏d \d D W`N ֏؏֏  d ؏:֏H RVblvzԏ܏ ԏ&*@JNԏZ^܏ ԏ܏$ .>BNRhrt ~֏؏֏  ؏֏ ".8BFԏRV܏t ԏ֏؏֏  "؏>֏L VZfpz~ԏ܏ ԏԏ֏؏܏ڏ< D p z~  XdX WN F6XD^XpX,XpXXXX(2X<RXfXpzXXXXXXXX(>XDNXXnXt~XXXXXXX 6X<FXTl~XX X(6XFXL\rXXXXX&X0FXPfXlvXXXXXXX&X0:XDZX`jXt~XXX X "X8 ZXhXX :XH`vX|X X X( JX` X X X*X8PhX(@XXX X0 RXh X X X :XP rX X X bX(2X<FXT^Xld \d WN2X\  d   &@L VZfrz~  ".>BNRdn~  "P X   h p    &.26"ԏ&ڏ*֏.؏:܏֏ ؏֏ԏ܏ &*6BJNRn֏FFF$ L2FZFjF   <ԏF܏ F"(>XB֏LVdp <x  "֏&؏B֏P Z؏j֏z~ԏ܏  &ԏ  ֏؏֏ ؏֏"&ԏ26܏T` jnzԏ  ԏ*.܏P\ fr~ F F$ JF$`(\D Tx Z^jnԏ܏ F &F8 VFh F   b,:֏DX| \ WN"&<FH Rt F F   8Ph:֏>؏Z֏h r؏֏ԏ܏ "&*>ԏT ` ~F  F "F8 XpFFF F 2FD t0Hdt$8H\l(@Xh,<P`t(@Xp WN D\x F   .F8 FFd p ԏ֏ڏF܏J؏   &.26F$ LfŒ0BPl ~ÄÚXäîdþXX @XpĂXČĶX X4 t X X XFXvXƄƠX fjvznjǖǦ $ FJV`jzȔȠ ȪȮȺX d ~Xɔ ɾXX NXd ~Xʔ ʮXʼ bXXX *X8Nddndˀ \˘˼ WNd 0:< FVXl ̆X̜ ̶X X 4ͰX(@XpΚX 6:FPZjτϐ ϚϞϪ϶Ͼ  XP Ќ Юво ".6:>d p Ѭ $0 :FVXl ҆XҜ ҶX X X, FX\ ӆXӘӢXӬӶXXXXX&X0:XDZXnXxԊXԔԦX԰ԾXXX XX$6X@JXT^XhvXՀՊXՔդղXռXXXX&X0>XH^XdnXxֆX֐֚Xָ֤ $<d W׀Nל ׸ "&<FH R^jr؀ ؔ ب   يԏَڏْ֏ٖ؏٢܏֏ ؏֏"&2<FJԏVZ܏xڄ ڎڒڞڪڲڶں֏F2FBFFR$` RrFۚFۦFFFݲ *,>Ljl~ތުެ޾ *,>Ljl~ߌߪ߬߾ *,>Ljl~ *,>Ljl~ *,>Ljl~ *,>Ljl~ *,>Ljl~ *,>Ljl~ԏ܏ "F24NXR֏\fd$Dd F Fnb^lt  Lp$Hl Dh@d<`֏؏֏ ؏֏ "ԏ.2܏P\ fjvԏ $ >֏B؏^֏l v؏֏ԏ܏ &*.BԏX d  4$` F  2d ~֏؏֏ ؏֏ԏ܏$.0 :>JNZbfzԏ   ԏ܏"&HRT ^bnr~F F F "F4 N$4LVҏf$P`p(8H\p 0Dhx0@Pd|ԏ܏ 0:< FJVZnF F F , Ph b֏d \, WHN\zd  F Bҏd |ҏ  <T0Hp WN "<Z\n|.<Z\n|.<Z\n|   . < Z \ n |           . < Z \ n |           . < Z \ n |           . < Z \ n |           . < Z \ n |        .<FԏN܏Rdr F $Lbx(>Tj0F\r "8Ndz*@Vl2H^t F $ 8 BFL VFt  ԏ֏ڏ؏܏\ ~  ^XlvdXFX .XP vXXXXXXXX$.X8BXLbXhrX|XXXXXXX .X8BXL|  *.2   8 Z^jt~  ( BJRVlvz  0 NX` ~X X X X >XP nXx bXd  "d 0 \ H l W N  d        !!X!( !d !!!!!!!! !!!"""""H "T "x W"N" " #"ԏ#&ڏ#*֏#.؏#:܏#֏# #؏#֏######ԏ##܏$$ $*$.$:$F$R$V$Z$v֏$X$֏$$d$$% %rF% %%%%&&0&H&X&h&&&&&&&''',':֏'>؏'Z֏'h 'r؏'֏''''''ԏ''܏'' '((((&(*(.(Bԏ( ( ( )֏) ؏)&֏)4 )>؏)N֏)^)b)n)x))ԏ))܏)) )))))))*ԏ*, *8 *R*Z*b*f*|**ԏ**܏** ****+ +H +t +F+ +F+ +F, ,*F,4 ,` ,, b,,,֏,,--4 \-L-p W-N-------- -..$ .>֏.B؏.^֏.l .v؏.֏......ԏ..܏.. /////*/./2/Fԏ/d /p / W/N/ / 0Fԏ0J֏0Nڏ0܏0؏0 11111&161P1\ 1f1j1v11111F11$20 L2$2$22 2 3 33 3P3333344 4*404FX4P4Zd4jX4x4X4 5FX5\ 5 55555566 6*6.6:6F6N6R6V6 6 6X7 7>X7h 7 77777788 8*8.8:8F8N8R8V8| 8 888888899 99&929:9FX9\ 9X9 9X9 9X9 :X:( :BX:X :rX:: b:X::X::X::X:;;d;, \;D;h W;N;;d;d;;;;;;; ;< <X<0 >>@ >X> >>X>>X?*X?h ???????? ???@ @@@@@ @L @p W@N@@ @@A A*A.A:A>ATA^A` AjAvAAA A A A A BbԏBfڏBj֏Bn؏Bz܏B֏B B؏B֏BCCCC"C&ԏC2C6܏CTC` CjCnCzCCCCC֏CXDDdD,DXD DFE E2֏E6؏ER֏E` Ej؏Ez֏EEEEEEԏEE܏EE EEFFFF"F&F:ԏF F F FG G2֏G6؏GR֏G` Gj؏Gz֏GGGGGGԏGG܏GG GGHHHH"H&H:ԏHX Hd H~HHHHHHԏHH܏HH HI II"I@ InFI| IFI I JFJ J6FJ@ Jl JJ bJJJ֏JJKK, \KDKh WKNKKKKKKKK KLL$ L>֏LB؏L^֏Ll Lv؏L֏LLLLLLԏLL܏LL MMMMM*M.M2MFԏMd Mp MMMMMN N$N<NTNdN|NNNNNNOOO, WOHNOd Op OԏO֏O؏P܏PڏPT PvPzPPPPPP PPPPQQQ QBFQFQ^XQx QXQ QXQRXRRXR$R.XR8RNXRTR^XRhRzXRRXRR RRRSSSS8SD SNSRS^SjSvSzS~S S T@ T| TTTTTTTT UUUUU*U.U2U` Ul UUUUUUUUU UV VV"V@ Vt VXV VXV W W>WBWNWXWbWrWW WWWWWWWX X X8 XD XԏXڏX֏X؏X܏X֏Y Y؏Y&֏Y6Y:YFYPYZY^ԏYjYn܏YY YYYYYYYY֏ZXZZHZ ZFZ [ ֏[؏[*֏[8 [B؏[R֏[b[f[r[|[[ԏ[[܏[[ [[[[[[[\ԏ\\ \h \ \ ]֏] ؏]&֏]4 ]>؏]N֏]^]b]n]x]]ԏ]]܏]] ]]]]]]]^ԏ^, ^8 ^R^Z^b^f^|^^ԏ^^܏^^ ^^^^_ _BF_L _x _F_ _ _֏_؏`֏`$ `.؏`>֏`N`R`^`h`r`vԏ``܏`` ````````ԏa a( aPa`ataaaab bb4bDb\bpbbbb b c:ԏc>֏cBڏcZ؏cb܏c cccccd d$d0 d:d>dJdVdbdfdjdFdXdeXe eZXe| e eeeff ff4f@ fJfNfZfffrfvfzf f g gFgx g gggggh h$h0 h:h>hJhVhbhfhjh h hhhhhhhi i, i6iBiNiZi| iXi iXi jXj j6XjH j jjjjjjjk k kkk&k2k6k:kh kt kXkkXkkXkkXkkXlXll*Xl0l:XlDlNXlzXllXllXllXllXllXlmXm mm2Xm8mT m` mڏm֏m؏m܏mԏn*֏n8 nB؏nR֏nbnfnrn|nnԏnn܏nn nnnnnnoo֏oNXo\oj֏opozdoooop pB֏pZFpx pppppq q$q4qDqTqlq|qqqq֏q؏q֏q q؏r֏rr"r.r8rBrFԏrRrV܏rtr rrrrrrrrԏs s sHs`s~Fs s t֏t؏t"֏t0 t:؏tJ֏tZt^tjttt~tԏtt܏tt tttttttuԏu u( uBuFuRuVuhuruvԏuu܏uu uuuuu v, vX v vv bvvv֏www.dwDwRdw` \wxw WwNwwdwwwwxxx x&x2xT x x֏x؏x֏x x؏x֏xxyy yyԏy&y*܏yHyT y^ybynyzyyyyԏy y yz Wz0NzL z` zԏzڏz֏z؏z܏{֏{( {2؏{B֏{R{V{b{l{v{zԏ{{܏{{ {{{{{{{| ֏|:X|X||||}}}(}8}H}p }F} }֏~؏~֏~, ~6؏~F֏~V~Z~f~p~z~~ԏ~~܏~~ ~~~~~~~ԏ@ L   ֏؏֏ &؏6֏FJV`jnԏz~܏ ԏ( 4 NR^bt~ԏ܏  6FD p  F  ֏؏2֏@ J؏Z֏jnzԏ܏ ԏL X x  zԏ~֏ڏ؏܏ &*6@JZt Xd*X8JFNbX| X  X&X0BXLVX`jXt~XXXXXXXX$2X<FXPfXl   "&2>FJN   T vz , 8 RVbfx  4 RXd X X X X4 bP`tX \ W$N4NR^bx X  ".8BRlx    W N< P ԏڏ֏؏܏:֏H P Z؏v֏ ԏ܏  "&F֏X֏d WN8H`p8HXp &F8 ^Fp F F  P  F  F0 VFh F   b4DR֏\p \ W NT n֏r؏֏  ؏֏  "ԏ.2܏P\ fjvԏԏ܏(4 >JZ^jnԏ܏  &2>FR֏V؏r֏  ؏֏ ԏ܏( 26BNVZ^rԏ֏؏֏  ؏֏ "&ԏ26܏T` jnzԏ^ԏbڏf֏j؏v܏֏  ؏֏ ",6:ԏFJ܏ht ~֏X֏(2dLh WN(@P`p0@P`p F( NF` ֏  F *F< bFt    FFX  F F 8 \t b֏ \ (L WhN ֏؏֏  "؏>֏L VZfpz~ԏ܏ ԏ"*.DNRԏ^b܏ ԏ܏( 2BFRVlvx ֏؏֏  ؏ ֏ "&2<FJԏVZ܏x ԏ֏؏֏  &؏B֏P Z^jt~ԏ܏ ԏԏ֏ڏ܏؏0 8 d nr~ ZXhrdX WNFX X *X4>XHRX\fXzXXXXXXX "X(2X<FXPZXdzXXXXX  X BXX zX X X "X8 bXx X X X( JX` X X bX XX,6XD\fdx \d WN X4 p d  $ .2>JRVZ &*<FVt  ( 0 \ fjv @ H t ~  ԏ֏ڏ"܏&؏` h   &*.JXT^dnX| WNFX hXXXX&X,6XDZX`jXxXXXXXX XX,DVXjXt~Xˆ’Xœ²X¸XXXXXX2X<FXPZXdnX|ÔæXúXXXX XX2X<FXPZXnXxĂXČĖXĪXĴľXXXXX *X4JXPZXhvXńŔŞXŲXżXXXX X 6X@RXfXpzXƄƚXư X  X BXX zXǐ DzX X "X8 ZXp ȒXȨ X X >XTlX X FX\ ~Xʔ ʶX X &X< ^Xt ˖Xˬ X X FX\ vX̜̄ b̮X̼XXX0 \@\̀ W͜Nͺ;X ( H t ~΂ΎΘ΢β  6>FJ`jnϘϤ ϮϺ (4 >NR^bxЂЄ ЎКЦЮ   *4>Nht ~тюњѢѦѪ  ( 26BLVfҀҌ ҖҚҦҲҺҾӶԏӺڏӾ֏؏܏֏( 0 :؏V֏d nr~ԈԒԖԏԢԦ܏ *֏ՊXՎ֏՜զd WN<Ldt֌ָ֠ ,<Ll|׌פ$DTt؄ؤش$4D\lلٰ٘ H nFڀ ڦFڸ ֏ F( NF` ۔ ۺF F *F< p ܬ  F FFX ~Fݐ ݶF  0 VFh ގFޠ F  8P bl|ߊ֏ߔߨd \d 0 WLN ֏؏֏ d  ؏&֏4 >BNXbfԏrv܏ ԏ ,6:ԏFJ܏lx ԏ܏ *.:>T^` jv֏؏֏  ؏֏  $.2ԏ>B܏`l vzԏ֏؏֏  ؏*֏8 BFR\fjԏvz܏ ԏԏ֏ڏ؏܏4 < h rv jXxdX WNF X&X0FXLVX`vX|XXXXXXX(2X<FXPZXdnXXXXXXXX X *X>XHRX\fXpzXXXX X 2XH jX X X X( RXh X X X :XP rX X X bX(2X<FXT^Xl \ WN*XT     4@ JNZfnrv "26BFXbr  D L x   \ d   "&*ԏڏ֏؏܏V֏d l v؏֏ ԏ܏ &2:>Bb֏X֏d WN"Td| ,L\|,<d ֏FF F $ JF\    .F@ t    L p b֏d \$2dDh WN ֏؏֏ .d8 B؏^֏l vzԏ܏  "ԏ:BJNdnrԏ~܏  ԏ܏<H Rbfrv ֏؏֏  ؏*֏8 BFR\fjԏvz܏ ԏ֏ ؏&֏4 < F؏b֏p z~ԏ܏  &ԏԏ֏ڏ؏܏@ bfr| >XLVdfXtFX X( NX`jXtXXXXXXXX$.X8JXT^XhvXXXXX   * . : D N ^ x         0  <          8 D  N R ^ j v z ~          4 @  J V b n   X  X  >X P  nX  X  X  b 0>XHp \ WN 4>@ JVjX|  (4 >BNZfjn   WN  ԏڏ֏؏܏֏ ؏֏"&2<FJԏVZ܏x X֏dHZ֏ F <Ldt֏؏֏$ .؏>֏NR^hrvԏ܏ ԏH T  ֏؏֏ ؏֏",6:ԏFJ܏ht ~ԏ    *.ԏ:>܏`l v   :FD t  b֏d4BdP \h WNd  "D ^֏b؏~֏ ؏֏ԏ܏  "&2>FJNbԏx   WN  ԏڏ֏؏܏֏ ؏֏"&2<FJԏVZ܏x F$ Lԏ  > X b܏ j |          !ԏ! ܏! !*!0!\ !!! " "2֏"6؏"R֏"` "j؏"z֏""""""ԏ""܏"" ""#####"#6ԏ# # #֏#؏#֏# #؏$֏$$$"$,$6$:ԏ$F$J܏$h$t $~$$$$$$$ԏ$ $ $ % % %$%:֏%>؏%Z֏%h %r؏%֏%%%%%%ԏ%%܏%% %&&&&"&&&*&>ԏ&T &` &~& &&&& ' ''''4'>'@ 'J'V'b'j'x ' ' ' ' (*ԏ(.֏(2ڏ(z؏(܏( ((()) ))4)@ )J)N)Z)f)n)r)v)F)F))F)$) R)F*F*F*>*l****F*++$ +2F+:+@+^+d+r+x+ +++F+ +F,<,L , , ,,----*-D-P -Z-^-j-v-~--. . .L .n.r.~..... ......./$ /0 /H /\ /l/ //////00 0*0.0:0F0N0R0V0| 0 0 000 1F111*1.1D1N1P 1Z1f1r1z1 1 1F1 1F1 1 2fԏ2jڏ2n֏2r؏2~܏2֏2 2؏2֏23333"3&ԏ3236܏3T3` 3j3n3z33333F33$3 X4Zԏ44445$565d5r܏5v555 555555566ԏ6܏6( 666<6h 666 7 7B֏7F؏7b֏7p 7z؏7֏777777ԏ77܏77 88 88"8*8.828Fԏ8 8 8֏8؏8֏8 8؏9֏99"9.989B9Fԏ9R9V܏9t9 99999999ԏ9 9 : :: :0:F֏:J؏:f֏:t :~؏:֏::::::ԏ::܏:; ; ;;;&;.;2;6;Jԏ;` ;l ;; ; ;;;;<<< <<&<2<: > >">&>2>>>F>J>N>bF>rF>>F>$> Z>F>F>F???@?JF?R?d? ?F???????@ @"@(@>F@X @bF@@ A AT AvAzAAAAAA AAAAABBB| B B BBBCC CC4C@ CJCNCZCfCnCrCvC C C C CD D>DBDNDXDbDrDD DDDDDDDD E E( ED E^FEjEnEzE~EEE EEEEE E EFF FFF$ F0 FԏFڏF֏F؏F܏G֏G, G6؏GF֏GVGZGfGpGzG~ԏGG܏GG GGGGGGGHFHH"$H4 \HHԏHH܏HHII I*I0IFInIrI|IIIIԏI܏I III JJJ\Jl J J֏J؏J֏K K ؏K֏K*K.K:KDKNKRԏK^Kb܏KK KKKKKKKKԏL( L4 LN֏LR؏Ln֏L| L؏L֏LLLLLLԏLL܏LM MMM"M.M6M:M>MRԏMh Mt M MM MM֏M؏M֏M N؏N֏N&N*N6N@NJNNԏNZN^܏N|N NNNNNNNNԏN N OO$ O@ ObOfOrOvOOO OOOOO O O P P PԏP֏PڏP؏P܏Q Q>QBQNQXQbQrQQ QQQQQQQQFQFRRFR$R ^R2FRZFRjFRRRRFRRS SFSS S6SbShSvS|S SSSSSSS TT TT T.T4TP T^TdTzFT TFUU UL U UUUUUUVV V&V*V6VBVJVNVRV V W W2W6WBWLWVWfWW WWWWWWWW W XX$X< XP X`X XXXXXXYY YY"Y.Y:YBYFYJYp Y| Y Y YFYYYYZZZ Z&Z2Z>ZFZT Zh ZrFZ ZFZ Z [6֏[:ԏ[>؏[Bڏ[J܏[֏[ [ [؏[֏[ [[[[\ \ԏ\\܏\<\H \V\^\b\f\j\\\\\\\\\\\\ԏ\܏]] ].؏]6֏]^֏]t ]| ]؏]֏] ]]]ԏ]܏^^ ^^^Bԏ_j֏_r؏_؏_ԏ_֏_܏_ޏ_؏_֏` `ޏ```,`6`:ԏ`F`J܏`t``````ޏ``aa a*ҏaJaL ϙaVa֏a֏abj֏bbbbbޏbbbbbbhc c֏c؏cN؏c^֏cncrޏc~cccԏcc܏cccccdԏddddޏdd deee.e@ Jevleee Je Feeeeeeef֏ffޏff,f: fPfZfbfrf~fޏfffffff Ff0f2gg8 fgJgNg^gbggh.hh fh˙h0h"hiԏi iiЏii܏iVԏiZibifijЏin0iri܏iiԏiiiЏi0ii܏jjjjjjjkk"kFޏkLkbЏkfk~ԏk܏kkkkkkkkkkklޏlll" l8lBlJlRlnjl~llll֏lmm$m.m>mJmjmnmrmmmmޏmmmmm mmmnnnnn.lnFnH Jn^hnxn ٙnnnޏnooo"o.o:oZo^ojޏonooooooooޏoopp pp"pBpFpRޏpVplpvp~pppppޏpppppq q*q.q:ޏq>qTq^qfqrq~qqqޏqqqqqqrr*hr:rBr r!rޏs(s2֏s6s:s^ sxssssssss ssssssttt  tH"-ttttttttt ttuuuuu&u.u2 uDuZu^ubufunuuuԏuuuЏu܏uuvB vvv֏w ҏw|ߙwߙwߙwߙwvx x xߙxߙxߙxߙyvy y y&y6y y y y zfzlz|zzvz zvzޏz{0{{ƙ{{| ƙ|$ߙ|@ߙ|\ߙ|xߙ||ƙ|ƙ}}ƙ}&}0ƙ}>v}Jv}X }nv}rޏ}v}~"~,ƙ~f~r~ƙ~ߙ~ߙ~ߙ~ߙN\ƙpƙƙƙv !F~ޏޏ"- ԏЏ܏nԏrޏ֏؏܏26ޏ>BPZjҏ:ҏbҏޏ*6BFJޏ".26:ޏ` rvzޏ ޏ $.:ҏ\!`jҏ!`ҏޏޏޏ ޏ(FޏJNTpzޏ ޏ&ҏZҏnrvzޏ !`!`ҏ,:ޏPZޏlvޏޏޏޏޏ$.RޏZ^dޏޏޏ".2T fhޏ ҏh h(:ҏFvZޏfxЏ ޏ. <FNR^rҏl Jҏhޏҏv"ޏ.@JR^n~Џhҏbfrnrvޏ(D!әR`jv 0!ә>LVjrvޏZԏ^ޏ֏܏؏ޏ *.ԏ:>܏`rvҏh$2FJNrvޏޏ "ԏ.܏HRZ^jnzԏ26ޏT^nrޏޏԏ܏ޏ, FJNfjnrҏޏ 2ޏT^!`!`ޏޏޏ*ޏ0NޏTjޏpޏޏ"NޏTrzޏ !`!` ޏ0:ޏLVޏhrޏޏޏޏ6ޏ>BHdnޏޏޏޏ*0B PZhhvޏ&.ԏ6:FЏJ܏zޏޏޏޏޏ Z^ޏfjxԏ܏ ԏޏԏ܏ԏ2hVޏ^bt~ޏv.2ԏ:BJЏN܏~ޏޏޏ*Tbnr~ޏޏ &26Fhnrvޏ "&ޏ.2@Rޏdnz~ޏzԏ~֏؏ޏ܏NRZ^bfvzޏ "ޏ.8Jޏ\fr~ޏ".:ޏ6ޏBL^ޏpzޏ,6BNޏ*.ޏLVbt ޏ&h*jޏrv|ޏ!`!`ҏ:ޏ@Vޏ\rޏxޏޏޏޏޏޏ&*0PZ~ޏޏ ޏ& 8Bl!`!`ҏޏޏޏ ޏ6ޏ<RޏXnޏvzޏ2ޏ8NޏTjޏvzޏ ҏ8Pbҏnvޏޏ$PZЏޏޏ 2ޏ<NޏXnޏxޏޏޏ .ޏ6:LVޏޏޏ *ޏ26HR~ޏҏvޏ".ЏRVޏ^dvޏޏ .ޏ2LVbnޏhޏ 8NZbfԏ֏؏&܏6ޏj֏~؏֏ԏ܏ "*.2J֏Z֏^؏z֏؏֏ԏ܏&2:>BZԏ ҏ"6>DNRV hr~!`!`4Ldz~ ,6BFRpˆœ ²֏¶؏֏؏֏ &*ԏ26܏:\frvÂÚԏh*.:fvvzĆĊĜĦĮIJľ֏؏֏ ؏֏*.:@JNԏVZ܏^ŀŊŖŚŦžԏԏЏ܏FNT^bf xƂƒƤ!`Ƹ!` $<Tlǂhԏ֏f؏nޏȚ܏؏֏ 26NV^ bɎɮҏɲ ֏* h!| ʎ֏ʒ؏ʲ֏؏֏ ԏ܏8JNfnrˊԏh*֏>Bfǹ̸̖!`!`ߙ@ߙxͦͲͼ6BLVpΆΊΎήκ*4>B`rvώϬϾ  ".T!`h!`~ЌЬ(:FPZtъѦѲѼ0HZ^nҀҚҪҺ  &FhPbhlӆvӖӚӪӼ֏؏ .֏B؏R֏bnxԂԆԏԒԖ܏Դԏ.6ԏ>BNЏR܏VՄ՜մ*.րּ֤JZlׂ׆׊מעײ 8N v ، آ֏ئ؏ت ֏؏֏&*ԏ6:܏Xjnنٞԏh" 6:HVh~ڨ*<Vfےۖۨ۾"6:Pf܀ܬ "&*Ph݀ݘݰ(JvZ^nހޒޖޢ޲޺ԏЏ܏ 0F`!`t!`ߊߘ߲ߺBJTbt>JT^b| $6:b  >֏Z^pz"<`!o&*<RVl(X|.P PnHx8x TrDbHf`~$\X >,:@  @HjhXz< ` z ~       !o ֏ * 6 H b v h      ԏ  ܏    " . : > B ԏ ֏ B؏ ^܏ ޏ   " *ޏ @!o Z b f v  v 2$fޏvޏ|6:^fj~ޏ!`!`ҏHߙߙ,@pޏzޏ~ޏ>ޏBH^ h!`!`ҏޏޏ0:ޏLVޏhޏޏޏ.ޏ6<R`~ޏޏޏ *.:Zvޏ~ ҏhh 2ҏVZޏ^p؏؏ޏ ԏ"&܏HZ^jv~ԏ.6ԏ>BNЏR܏Vޏޏ ؏&؏JޏRXfԏrv܏ԏh2ޏ8NޏTjޏpޏޏޏ&*ޏ.@^bnz ؏؏ޏԏ"܏Dbfr~ԏԏhޏ"0BFRnޏtޏ ҏ  ( Fޏ N T t      !!8!Vޏ!^!d!z!!!!ޏ!!""""""&"ޏ"""""""#"ޏ#.#8#N#\#n#r#v##ߙ$N$^ޏ$f$t$ԏ$ޏ$$܏$$$$$%ߙ%`ߙ%ޏ%%ޏ%%ޏ%%ޏ&&ޏ& &6ޏ&<&Rޏ&X&nޏ&t&ޏ&&ޏ&&ޏ&&'''''.'>ޏ'F'L'l'~''''ҏ''ޏ''''((ԏ(("(*Џ(.܏(2(Z(^((((ޏ(((!`)!`)&ҏ)4)ޏ))ޏ))***&***.*N*bޏ**ޏ*****+ +8+Vޏ+^+p++++++++ҏ+,ҏ, ,2ҏ,Bޏ,H,X!,t!, ,!`,ҏ,ߙ,ޏ,,ޏ,,ޏ,-ޏ--6ޏ-<-l-~ޏ-!o-!----ޏ..ޏ.$.Jޏ.P.|!. .!`.ҏ.$/6ޏ/Fޏ/L/h//ҏ//ҏ/ޏ//!0 !0 0$!`06ҏ0<ߙ0Rޏ0X0rޏ0x0ޏ00ޏ00ޏ011ޏ1!o14!1H1l11ޏ11ޏ11ޏ11!2 2!`2"ҏ2V$2ޏ2233"ޏ303:ҏ3`3rҏ33ޏ333!3!3 3!`4ҏ4 ߙ4"ޏ4(4Bޏ4H4Rޏ4d4nޏ44ޏ444ޏ4!o5!55<5T5fޏ5l5ޏ55ޏ55!5 5!`5ҏ666Vޏ6^6d6666666677:7D7p777777888.ޏ868<8\8r8v8ޏ8888ޏ8!o99,9P9bޏ9h!o9ޏ9!o9h999ޏ99:ԏ: :܏:,:6:>:B:N:Z:b:f:j;J؏;N܏;Rޏ;bԏ;f֏;֏;؏;֏;;;;;;ԏ<<܏<(<:<>>>& >*>.>2>Z֏>? ߙ?^?b?n?t?~???????@ @$@<@T@l@~@@@@@@@@@@@@@A A*֏A.؏AJ֏A^؏An֏A~AAAAAԏAA܏AAAAAABB BB&ԏB BhBCC C֏C"؏C>֏CR؏Cb֏CrCvCCCCԏCC܏CCCCCCCCDԏDH DZhDvDDDEE EEE&E*E6ELEVElEEEEEEEEEEEEFFFFF0F:FFFJFlFߙFߙFߙFߙFߙFߙGߙG$ߙGDߙGXߙGxߙGߙGߙGߙGGHHH,H@H\HtHHHHHHHHI I I*I2I6I:IpI!`IҏIvIIIIIIIIJJJ֏J؏J:֏JN؏J^֏JnJrJ~JJJԏJJ܏JJJJJJJJKԏKBKJԏKRKVK^ЏKb܏KfKKKKKKKKL L$L.LPLlLLL!LLM!M M*hMԏMޏN*֏N6؏N:܏N NޏNNNNNNNNOޏO$O:ޏODOfޏOnOrOxOOOOOOO!`OҏPޏP,PPߙPdߙPߙP uQbQfޏQnQtQQQQQ R2ޏR:R>RDRZRtR~RRRRS\ SnhSޏSSS T ޏTTTT2TLTVTbT ThTTTޏUUUU,U6UFUJޏURUXUfU|UUUޏUUޏUUUUVVVV VVFޏVPVfޏVpVޏVV!VVޏW WޏW(W>ޏWDWX uWx!`WҏWvWޏWWWWWWXBޏXJXNXTXjXXXXXXYЏY Y2ޏY:Y>YDYRYtY~YY YhYYޏYYYYZZ(Z:Z>ZJZVZbZfZj[nԏ[r܏[vޏ[֏[؏[֏[؏[֏\\\\"\,\6\:\F\d\n\v\\\\\\\\\]]]]"]&]2]H]R]f]v]֏]] W]^ "^Џ^"^8!^J^V^Z^֏^؏^֏^؏^֏^^_ __"_&_D_N_b_r` "`6֏`:؏`V֏`j؏`z֏`````````aaX"al"aa Pa֏bƙb"֏b4˙bFbRbVbfЏbbbbbbcҏccc,c:cBcFcXcfc c љcc fcdd*d8 zdndvdzdddd fd љd dddee ҏee"e4eBeJeNe`eje~eeeeeeeeef֏f֏f؏f֏g؏g"֏g2g6gHgRg^gbgggghhh&h*h2hHhRhjhvh"hhhhh h hii* i<ip hii i iij jjDjp hjjjj k k kk> kPk hkkkkll(l@"lJ؏lZ֏ljlllvllllllm@ߙmRmXߙmjmpߙmmߙmmn nn&n8nHnpnn!onnnooo0oDƙoVofojovЏooooЏp Pp8 PpNp^pbprЏp!ppppЏq q6qFqJqqqqq֏qr!or r0r:֏rDrTrlrrrrrs4sB؏sZ֏s^sbޏsvs~ssssssssssttttttttttuu"u&ufujޏunuruuuuuuuҏuuuhvv؏v<vnw֏w؏wޏw"܏w2ԏwv؏wwޏwwwwwԏwwޏw܏wwwxxx"x*x.xNxXxfxnxrޏx~xxxxxxxy؏y6؏yRyVޏybylyzԏy܏yyyyyyyԏzvޏz|zԏzzzzЏz܏z؏{؏{2{6ޏ{B{L{Zԏ{b܏{f{{{{{{ԏ|||0|>|T|b|j| f|||ޏ|$}0 f}X}f}}}˙}؏}؏~~ ޏ~~ ~.ԏ~6܏~:~X~b~n~z~~ԏ~~~ޏ".:BZbԏjnrЏv܏ޏ"$.:DRZpzޏ!`ޏҏ(BޏHRޏdnޏޏޏҏ*$z fޏ .ޏ2@JVt!`ޏޏޏޏޏ:ޏ@^bfjz؏ޏ"4BJhҏh֏ ޏ&,:Bhz~ ":>BF؏*؏B֏NRVޏZv~"Hlv~xޏ ҏ"h@Xb؏r֏ޏ"jޏzޏt؏֏ޏ"&2:NRVZz~ޏ"4BJhҏh؏ޏ "@Z^bҏfrvh؏֏ޏ@VZ^bfnTT؏֏ޏ@RVbfrz "HZ^ޏҏh@J؏hTfjޏnvҏh 4>؏B֏fޏjnrBޏZޏ؏֏ޏ$2:`rvnrvzBFޏJN`nvҏh؏J؏֏"ޏ&>DRZbrvz~BFޏJN`nvҏh؏J؏֏"ޏ&>DRZvJNޏRVhv~ҏh؏ Rޏ"8BFl~ҏh؏֏ޏ"0:>l~ޏ,>JVbjҏnh؏֏ޏ,>BNZfjrޏޏ8RVZҏ^jnh؏֏ޏ<VZ^bf~ޏޏ4FJޏNVhv~ҏh؏"֏FޏJNR`nv؏֏ޏ@RVbfrzޏ‚ޏ"26:>Z^ޏfjxÂÆôޏޏ"&L^jrҏvh~ĠĪ؏ҏhŴ؏֏ޏ@RVbfrzƎǎǞǢǦǪ*.bfޏjnȀȎȖȴҏh؏8j"؏:֏>BޏF^drzʠʲʶ˶@RV̆̊ޏ̤̲̺̎̒ҏ h4>؏\͎4F؏V֏fjޏrv΄ΎΒFVZ^b~ЂޏЊЎМЦЪޏ&*<FJpтюіҏњhѢ؏ҏh؏ޏ"*Hbfjҏvz~hӸ֏ޏ "HZ^vzԈԖԞ":Fն؏֌֚؏ֶֺޏ־"&*ҏ6:>hxאע֏צתޏ׮ײ6:HV^؄ؚؖئتضؾ^؏rٌ,:؏VZޏ^btڂڊڨҏh0B֏FJޏNRlzۂۨۺ۾$6:FJV^vz~܂ܚܦ؏( ޏ(6>\vz~ҏނގޒh؏֏ޏ  .6\rvz~߂ߚ؏ޏ"&*ҏ6:>hx֏ޏ6:HV^؏؏ޏ"&*ҏ6:>hx֏ޏ6:HV^r؏L^bޏfjҏh,6؏F֏Z^ޏfjxޏޏ&2>JRҏVht؏֏ޏ&*6BNRVvޏ,:؏VZޏ^btҏh0B֏FJޏNflz$6:FJV^vz~ޏ^؏r,:؏VZޏ^btҏh0B֏FJޏNRlz$6:FJV^vz~؏(؏ޏ"*Hbfjҏvz~h֏ޏ "HZ^vz":F؏lz؏ޏ   ҏ   h X p ֏  ޏ           ( 6 > d v z           R؏ f  , :؏ V Zޏ ^ b t      ҏ   h  0 B֏ F Jޏ N f l z          $ 6 : F J V ^ v z ~  ؏  (   ؏ 6 :ޏ > B T b j    ҏ   h   "֏ & *ޏ . F L Z b            & * 6 > V Z ^ b ؏   t ؏ ֏  ޏ         " & 2 :        ( 6 > d v z  ޏ       & * .ҏ : > Bh h r؏   l z؏  ޏ          ҏ   h X p ֏  ޏ           ( 6 > d v z           2؏ F `   ؏ 6 :ޏ > B T b j    ҏ   h   "֏ & *ޏ . 2 L Z b            & * 6 > V Z ^ b z  ؏      N X r |       ԏ ֏ ؏ ޏ ܏ ֏ ؏  ֏   * 4 > Bԏ N R܏ p          N R V d r z ~       $  ҏ ֏ ֏ ֏               f֏      *֏ B F J \ f n֏ r؏ ֏ ؏ ֏      ԏ ܏ ! ! !" !& !2 !> !F !J !N !fԏ " "  "$ "R "l " # #& #4 # # $  $ $V $h $ $ $ $ $ $ $ % &:ԏ &>֏ &Bޏ &F؏ &N܏ & &ޏ & & & & &ԏ & &܏ ' '& '* '6 'B 'J 'N 'R ' ' ' ' ' ' ' 'ޏ ( ( ( (" (&ޏ (8 (B (J (Rޏ ( ) ) )&ޏ )Rҏ )bҏ )rҏ )ҏ )ޏ ) ) ) ) ) * * *Z *^ޏ *f *j *t *ԏ * *܏ *ޏ * * * * * * * * * +ԏ +p_ + +ޏ + ,"- ,*ҏ ,> ,ҏ ,ҏ ,ҏ -ҏ -6ޏ -jҏ -ޏ - - - - - -$ . ҏ . .^ҏ .b .~ҏ .ޏ . . . . . /" /&ޏ /h /"- /ҏ 0Rҏ 0bҏ 0ҏ 0ҏ 0ҏ 0ҏ 0ҏ 1 1 ޏ 1` 1r 1v 1 1 1$ 1ҏ 1 1ҏ 2 2ҏ 2Fޏ 2L 2Z 2^ 2h 2r 2ޏ 2ޏ 2 2ޏ 3  3H"- 3 3 3 3 3 3 3 3ޏ 3 4 4 4 4ޏ 4( 42 4: 4Fޏ 5ԏ 5֏ 5؏ 5ޏ 5&܏ 5n֏ 5؏ 5֏ 5 5 5 5 5 5 5܏ 5 6 6  6 6" 6. 62 66 6 6 6 6 6 6 6 6 7 7" 7* 70 7: 7T 7^ 7n 7z 7 7 7 7 7 7 7 7 7 8 8 8֏ 8؏ 8֏ 8؏ 8֏ 8 8 9 9 9 9"܏ 9< 9F 9V 9b 9n : :8 :B :F :J :X :b ;  ;$ ;. ;2 ;6 ;D ;N ; ; ; ; ; ; ; < < < < < < < =: =< =F =J =N =\ =f = = = = = = = > > >& >* >. >< >F >f > > > > > > > > > > > ?  ? ?6 ?P ?Z ?^ ?b ?p ?z ? ? ? ? ? ? ? ? ? @ @ @ @" @* @< @F @R @f @n @t @~ @ @ @ @ @ @ @ @ Aԏ A֏ A܏ A؏ Aޏ A؏ B ֏ B Bޏ B& B* B@ BJ BNԏ BV BZ܏ B| B B B B B Bޏ Bƙ B B Bޏ C ƙ Cޏ C ƙ C2ޏ Erޏ E Eޏ Fƙ Fޏ Fƙ F F Fޏ Fƙ Gޏ Gƙ Gޏ GZޏ G Gޏ Hƙ Hޏ Hƙ H I Iޏ I(ƙ I6ޏ I<ƙ IFޏ Iv Izԏ I I IЏ I܏ I I֏ I؏ I؏ I؏ J Jޏ J* J8 JB JFԏ JR JV܏ Jt J J J J Jԏ KP  Kb֏ Kf؏ K؏ K֏ K Kޏ K K K Kԏ K K܏ L  L L. L: LF LJ Lbԏ L Lԏ L L LЏ L܏ L L֏ L؏ M M6ޏ Nƙ Nbޏ Nh Nzޏ N Nޏ N Nޏ N Nޏ Nƙ N Nޏ Nƙ Oޏ O ƙ Oޏ O ƙ O. O:ޏ OPƙ O^ޏ Odƙ Oz P֏ Pԏ P"؏ P*܏ P.ޏ Pf֏ P~؏ P֏ P P P P P Pԏ P P܏ P Q  Q Q Q Q Q" QN QR QZ Q Q Q Q Q Q Qƙ Rƙ R\ƙ Rƙ SDƙ Sƙ UPƙ Uƙ V<ƙ Vƙ Wƙ Xdƙ Y ƙ YHƙ Yxƙ Yƙ Z  Z֏ Z"؏ Z:֏ ZV؏ Zf֏ Zz Z Z Z Z Zԏ Z Z܏ Z Z Z Z Z Z Z ["ԏ [ԏ [ [Џ [ [ [܏ [ [ԏ \ \Џ \ \ \܏ \ ^"ԏ ^&ޏ ^.֏ ^2؏ ^j܏ ^ ^ޏ ^ ^ ^ ^ ^ԏ ^ ^܏ _ _ _ _" _. _: _> _B _` R _ _ _ԏ _܏ `  ` `ޏ ` ` ` ` `ԏ ` `܏ ` ` ` a a a a a6ԏ a a h a aߙ a b b bԏ b"܏ bH b  b bޏ b b c c cԏ c c܏ c"ޏ cD cV cZ cf cr c~ c cԏ c dԏ d֏ d؏ dޏ d܏ e: eB eJ eT e^ efԏ ej en܏ e e e e e e e e e eҏ f"* f6* fF fJޏ fR fV fh fr fv f f f f f fޏ f f g g g* g~ޏ g g gԏ g܏ g g g g g g g hԏ hޏ hҏ i i i" i&ޏ i* iH iR iZ i^ if ir i iޏ j j  j j" j.ԏ j2 j6܏ j\ jn jr j~ j j j j jԏ j jޏ k  k6 k: kB kFޏ kJ k\ kf knԏ kr kv܏ kzޏ k k k k k k k k l f l" l. l: l> lF lN lV lZ l l m m f m" m0  mVޏ mf mn mz m m mԏ m m܏ m m m n n  n n n* nBޏ nP n^ nj n| nޏ n n n n n n o o  o o o" o& o* o: o> oB oF oJ o oޏ o oޏ o o o o p p p* p6 p@ p q q2ޏ q@ qN q` q qߙ q u q q q q q q q rn rx r r f r r s  s sޏ s s s t  t tߙ t0 u tԏ t֏ uޏ u&؏ uB܏ u uޏ u u u u uԏ u u܏ uޏ u u u v  v v v" v& v>0 vL" v^Џ vb vv v~ԏ v v v܏ v v v v" v vޏ v v w w w wj wnޏ wv wz w wԏ w܏ w w w w w w w w w xԏ xޏ x x xԏ x x xЏ x܏ y y  y y( P y: y> yB yRޏ y`ƙ yt˙ y yԏ y y yЏ y܏ y y y y yޏ y z ޏ z$  zR zZ zb zfޏ zj z| z zԏ z z܏ zޏ z z z z z z z { {4 f {F {R {b {f {n {r {~ { { | | f |2 |@  |r |v |z | |ޏ | | | | | | | | } }"ޏ }. }4 }B }F }J }` }j }v } } } } } } } }" }Џ } ~" ~&ޏ ~. ~2 ~@ ~J ~Nԏ ~Z ~^܏ ~| ~ ~ ~ ~ ~ ~ ~ԏ   ԏ   "܏ & n rޏ v     ޏ          * 6 @ V    * .ޏ 6 @ J ` j   !o   !o        n x  f     *   ޏ        $!o 8!o  ԏ   Џ ܏     ԏ ֏ ؏ ޏ ܏ ֏ ؏ &֏ 6 : F P Z ^ԏ j n܏         0 " Џ   "ԏ & * :܏ Z ^ h" r v      ֏ ؏ ֏ ؏ ֏  " . 4 > Bԏ J N܏ R t ~       ԏ \ n vԏ z  Џ ܏   P   ƙ ˙ * 2ԏ 6 : FЏ N܏ r v      ؏ ֏ & . 6 > L V bԏ f j܏         f   . 2 6 B  F ~؏ ֏ ֏    f   F؏ J N b֏ f ~              4 > J V ^ b r v z " Џ  ֏ ؏ ֏ ؏ ֏     * .ԏ : >܏ \ n r ~    ԏ  ԏ   ܏  *؏ :֏ J N Z p z              * 2 |  ؏  ؏   * . D N l!o !o ؏        ؏ ֏ >֏ ^ h  f       v؏  ؏        !o ,!o >؏   ԏ   Џ ܏    ԏ ޏ ֏ ؏ ܏ & *ޏ 2 6 H R Vԏ Z ^ޏ b܏ f            & *ޏ 6 @ N h r     0 " Џ   ԏ   *܏ T" j nޏ r      ޏ   ԏ &܏ * H R f v ԏ *ޏ 0 B Jԏ N V ^Џ b܏ P ޏ ƙ ˙  ԏ   Џ ܏ N Vޏ d vޏ     ޏ  ԏ ܏   ޏ 0 : J Z ~ f     > H j x f    ޏ      4 > J V n rޏ ~          " Џ  f jޏ v  ԏ ܏       ԏ > Fԏ N R ^܏  ޏ      ޏ     " 8 B N Z f r |    B ^ bޏ j t ~     !o   !o ޏ !o R Z b f      f * 4 N     ޏ  ( 2 : P Z z !o !o ޏ !o  &ԏ . 2 >Џ B܏ ~     ԏ ֏ ؏ ܏ ޏ 6֏ N R V ^ b r !) ޏ  ޏ & 0 > N Z ^ޏ h v ~ޏ      ޏ   ԏ   "Џ &܏ ^ޏ j p ~     ֏ ؏ ؏ ֏ ޏ " & , :ԏ B F܏ d n v z     ԏ V f ޏ ҏ   8 Nޏ R z  $  8  L  `  t         ߙ 4ߙ Hߙ \ߙ |ߙ ߙ ߙ ߙ  ߙ ߙ (ߙ <ߙ dߙ xߙ  ߙ ߙ ߙ ߙ ߙ ߙ 0ߙ Dߙ X lߙ ߙ ߙ ߙ ߙ ߙ  ߙ 4 vޏ   u v f  ԏ   Џ ܏  ˙   F؏ J֏ ~؏ ֏ ޏ    ԏ  ܏       :ԏ ~؏ ֏ ޏ    ԏ  ܏       :ԏ n | ԏ ܏          ( > H ^ h ~           ( > H ^ h ~           ( > H ^ h ~           ( > H ^ l     ҏ  ޏ     8 B J R zޏ         ޏ     ޏ , 6 > F ^ fԏ n r vЏ z܏ ª ¸ ~֏ âޏ è üߙ ޏ  ֏ fޏ l Ěޏ Ġ ޏ  u "ޏ * . 4 B Vޏ l v ~ ł ņ žޏ  ޏ  ޏ  ޏ  .ޏ 4 Jޏ P fޏ n r x Ɔ ƚޏ ư ƺ ޏ  Bԏ F܏ f Ȉ Ȥ Ⱦޏ  P u fޏ t u Rޏ X ̊ޏ ̐ ޏ  ޏ  :ޏ @ nޏ t  P Ϊޏ β ζ μ     , < ` ϐ ϴ      ޏ , :ޏ B F L Z f | І   ԏ ܏ 8 X b h!o іޏ Ѱ z ߙ ߙ  4 D Ҕ Ңޏ Ү Ҷ Һ  ԏ ܏    . 6 D N t ӌ Ӝ Ӭ Ӽ u   u . 8 P  Jޏ P rޏ x ծޏ մ ޏ  "ޏ ( Rޏ X ւޏ ֈ ֶޏ ּ ޏ  :ޏ @ fޏ l צޏ ׬ ޏ  "ޏ ( ^ޏ d ؖޏ ؜ ޏ  ޏ  Jޏ P نޏ ٌ ޏ  ޏ  Rޏ X ښޏ ڠ ޏ  "ޏ ( bޏ h ۢޏ ۨ ޏ  ޏ $ ^ޏ d ܖޏ ܜ ޏ  &ޏ , bޏ h ݲޏ ݸ ޏ  Bޏ H ޒޏ ޘ ޏ  "ޏ ( jޏ p ߲ޏ ߸ ޏ  Fޏ L ^ޏ d zޏ  ޏ   ޏ  "ޏ ( ^ޏ d zޏ        ޏ $ P u l          4 H \ nޏ v ~   ԏ ܏        ( < P d x  ޏ         & 4 > J Nޏ \ j      ޏ  ޏ 8 F Nԏ V Z ^Џ b܏  ޏ  ޏ   ԏ  ܏    " . 2 > F J R  jԏ n֏ ޏ ܏ ؏ :؏ f x  ҏ ޏ    ԏ  Џ ܏   ޏ   ( 2 6 P b f r v   ؏ ؏ ԏ hY rޏ z ~  ԏ ܏         fޏ j              2 8 J P b h z              " ( : @ R X j p      f ޏ         ޏ   . b    * 0!o B H!o Z ^ޏ d!o v  f   ˙   R Vޏ ^ b p z ~         ޏ      4 F J V Z  ޏ               2  h ؏ ؏ ԏ . 2ޏ : > L V Zԏ f j܏           6؏ b؏ ԏ  ޏ     ԏ  ܏     " . : > N  ޏ              > Z h ~ ޏ     ޏ    6 "  :    " ( 2ԏ 6܏ R h  ޏ !o u $    u ޏ T  !o    .ޏ > D ^ޏ n t ~" ޏ  !o u & ޏ   > n   ޏ z    v ޏ   z  ԏ ܏  & j  "ޏ . D z  ԏ ܏  $  u 0 P  u ~ 2ޏ D u ` u  ԏ ܏     @ u h |       u 0 P l   \   \  L rԏ v܏  ޏ   ԏ ܏  " & 2 R V h      ԏ ܏  $ 2ԏ 6܏ X         ԏ "܏ D ޏ   ޏ    ޏ *ޏ 6 < Nޏ d v z  ԏ ܏     *ԏ .܏ L x ԏ ܏  ޏ       0 n rޏ  z  ԏ ܏    \  \ $ \ Dߙ Xߙ l u t  u   \ ޏ   ԏ ܏  F L Zԏ ^܏ z   ޏ  z   ԏ ܏ < N  \ 4 \ P \ pߙ ߙ  u   u   \ ޏ  ޏ $ Jޏ P vޏ | ޏ   ԏ ܏  ޏ  &ޏ , Jޏ P nޏ t  ޏ  z "ԏ &܏ @ |   ޏ  !ޏ !  !:ޏ !@ !^ޏ !d !ޏ ! !ޏ ! !ޏ ! !ޏ "VT " \ # #Rԏ #V܏ #p # # $Bޏ $L $jޏ $p $ޏ $ %H \ %d \ %ߙ %ߙ % u % % u % % \ &ޏ &$ &Nޏ &T &~ޏ & &ޏ & &ޏ & & ' ԏ '܏ ', '>ޏ 'D 'Zޏ '` 'vޏ '| 'ޏ ' 'ޏ ' (B. (R (ޏ ( )ޏ )*  ): )ޏ )$ )ԏ )܏ * *$ *6 *:ޏ *d z *ޏ * *ޏ * * H + ޏ +!o +\ +p + + +ԏ +܏ + + ,  ,  ,6ޏ ,@ ,Vޏ ,\ , ,ԏ ,܏ , , , ,  -  -" -2 -B -R -h -zޏ - -P - -ޏ - -ޏ - - . . .( .T .r .vޏ .|!o . u .$ . . u .ޏ .T . .!o . .  .ޏ /ޏ /ޏ /"ޏ /2ޏ /B /H /V /X /jޏ /zޏ /ޏ /ޏ / / /. /ޏ / /!o / u /0 /ޏ 0ޏ 0ޏ 0&ޏ 06 0:ޏ 0P z 0nޏ 0t 0 0ԏ 0܏ 02 0 0 0 h 1 ޏ 1 1 1.ޏ 1L 1b 1f 1 1ޏ 1 1 1ޏ 1 1 1ޏ 1 2  2 h 2Fޏ 2N 2T 2jޏ 2n 2 2 2 2 2ޏ 2 2 2ޏ 2 3, 3:ԏ 3>܏ 3V 3` 3nޏ 3t 3 3 h 3ޏ 3 3 3ޏ 3 4 4* 4. 4J 4Nޏ 4R 4\ 4nޏ 4 4 4ԏ 4܏ 4 4 4ޏ 5 5Nޏ 5T 5rޏ 5x 5ޏ 5 62ޏ 6: 6@ 6` 6r 6v 6 6 6 6 6ޏ 6 6 7  7 7" 7. 7B 7F 7R 7d 7ޏ 7 7ޏ 7 7ޏ 7 8Bޏ 8H 8zޏ 8 8ޏ 8 8 9ޏ 9  9Bޏ 9H 9^ޏ 9d 9zޏ 9 9ޏ 9 9ޏ 9 9ޏ 9 9ޏ : :"ޏ :( :Fޏ :L :bޏ :h :~ޏ : :ޏ : :ޏ : :ޏ : :ޏ ; ;ޏ ; ;>ޏ ;D ;Zޏ ;` ;vޏ ;| ;ޏ ; ;ޏ ; ;ޏ ; ;ޏ < <"ޏ <( <>ޏ  >2ޏ >8 >bޏ >h >ޏ > >ޏ > >ޏ > ?( ?H ?ޏ ? ? @6 @: @Nޏ @X @nޏ @~ޏ @ @ @ @ Aޏ A  Aޏ A@ Ab Aޏ A A B BD Bp B B B Cޏ C C6ޏ C< Cޏ C C Cޏ C D D  D D:ޏ D@ DVޏ D\ D~ޏ D Dޏ D Dޏ D Eޏ E E6ޏ E< Ejޏ Ep Eޏ E Eޏ E EP E F \ F  F.ԏ F2܏ FJ FT F^P Fh h Fޏ F F Fޏ F F F G Gޏ G G$ G6ޏ GL Gޏ G G Gޏ G G Hޏ H& H, H>ޏ H\ Hn Hr Hޏ H z H H H Hޏ H Iޏ I I8 I^ޏ If Il Iޏ I I I I Iޏ I I Iޏ J J:ޏ J@ JZޏ Jb Jh Jzޏ J J J Kޏ K K K*ޏ KH K^ Kb K~ Kޏ K K Kޏ K Kޏ K K Lޏ L LT Lt L L Mޏ M M  MD MZޏ M` Mޏ M M Mޏ M Nޏ N N Nޏ N N N N Onޏ Ov O| Oޏ O O O O P P"ԏ P&܏ PD PZޏ Pb Ph P~ޏ P P P P Q Q  Qޏ Q" Q, Q>ޏ Q\ Qr Qv Q Q Q Qޏ Q Q Qޏ Q R R R( Rh Rޏ R Rޏ R Rޏ R Rޏ S S  S, SB SF SV S| Sޏ S S Sޏ S S S T Tޏ T" T, TBޏ TT Tޏ T T Tޏ T T Uޏ U U6ޏ U> UD UZޏ Ut U U U U U Uޏ U V Vޏ V8 VN VR Vf Vj Vv Vޏ V V Vޏ V V V Vޏ V Wޏ W  W< W^ޏ Wd Wzޏ W Wޏ W Wޏ W Wޏ W X X< Xbޏ Xj Xp Xޏ X X X X Xޏ X X Yޏ Y YBޏ YJ YP Yfޏ Yx Y Yޏ Y Y Y Zޏ Zޏ Z4 ZJ ZN Z^ Zޏ Zޏ Z Zޏ Z Zޏ Zޏ [ [ޏ [.ޏ [@ [bޏ [| [ [ [ޏ [ [ޏ [ޏ [ \ޏ \*ޏ \4 \Jޏ \Zޏ \l \ޏ \ \ \ԏ \܏ \ ]ޏ ]& ], ]>ޏ ]B ]X ]j ]n ] ] ]ޏ ] ] ]ޏ ^ ^. ^2 ^N ^Rޏ ^V ^` ^vޏ ^ ^ ^ޏ ^ ^ _ ޏ _ _L _l _ޏ _ _ _ _ _ _ _ _ ` `6ޏ `< `ޏ ` ` ` ` ` `ޏ ` ` ` a a. a2 aH ah avԏ az܏ a a aԏ a܏ a aޏ a bޏ b b*ޏ b0 bP b^ԏ bb܏ b bޏ b bޏ b bޏ b bޏ b cޏ c c c.ޏ cH cZ c^ cj c~ c c cޏ c cޏ c cޏ c cޏ d d  dޏ d"$ d8 d\ dvޏ d d dޏ d d d dޏ d dޏ e eޏ e  e6ޏ e< eRޏ eX erޏ ex eޏ e eޏ e eޏ e eޏ e fޏ f fޏ f$ f>ޏ fD fNޏ fd fޏ f fޏ f fޏ f f g  g g" g6ޏ g< gVޏ g\ gvޏ g| gޏ g gޏ g gޏ g gޏ g hޏ h h"ޏ h( hޏ h h h h h i iޏ i  i i4 iޏ i i i i i i j4 jRޏ jZ j` j j j jޏ j kޏ k k  k8 kNޏ kT k| k k kޏ k l l  l2 l6 lNޏ lZ l` l l l lޏ l lޏ l l lޏ m mޏ m m4 mL mbޏ mh mޏ m m mޏ m m m mޏ m n  n"ޏ n( n>ޏ nD n\ nt nޏ n nޏ n n n n n o ޏ o o&ޏ o, oBޏ oH obޏ oh o~ޏ o oޏ o oޏ o oޏ o oޏ o p ޏ p p*ޏ p0 pRޏ pX pnޏ pt pޏ p pޏ p pޏ p pޏ p pޏ q qޏ q q2ޏ q8 qNޏ qT qjޏ qp qޏ q qޏ q qޏ q qޏ q rޏ r  r r"ޏ r8 rh rޏ r r rޏ r r r r sޏ s  s s"ޏ s8 sh sޏ s s sޏ s s s sޏ s t tޏ t, t\ t~ޏ t t tޏ t t t u uޏ u8 z ud urԏ uv܏ u u v \ v \ v \ vߙ vߙ w \ wޏ w$ w@ wNԏ wR܏ wp w wޏ w z xh x xԏ x܏ x xޏ x y` yrԏ yv܏ y y zߙ z z"ޏ z0 z zP z^ԏ zb܏ z z { { ޏ { z {8 {F {Jޏ {h z { | |&ԏ |*܏ |` |j | |ԏ |܏ } }" } \ ~ \ ~ \ ~0ߙ ~Dߙ ~X u ~` ~p u ~x ~ \ ~ޏ ~ ~ޏ ~  ޏ  6ޏ < ^ޏ d  ԏ ܏  ߙ  ߙ  ߙ * 0ߙ F j ޏ          . < h    2   :    B H Vԏ Z܏ v  ޏ   \  \  `    R    "ԏ &܏ B \ jޏ t  \  \  p  fޏ r x    ޏ      2 b     ޏ & , P f j z    :ޏ F L p   ޏ        ԏ ܏ : T bޏ l  \  \  @    ԏ ܏ 4  \   >ԏ B܏ f6 ޏ        &ԏ *܏ B8 F `  \ ߙ   u   \ P  \  ޏ  ޏ   T f j v    ߙ  ԏ ܏  0 u  \ ޏ   < N R b  ޏ   ޏ        * 2ޏ : D d v z       ޏ     ԏ  ܏  . 2 > J V Z n .ԏ 6؏ :܏ >ޏ F֏ ~֏ ؏ ֏          " . : > B Z !)  !) 8 H ZЏ ^ r֏ v؏ ֏ ؏ ֏        & * 6 B N R V           * 8 X b n z ֏ ؏ ֏ ؏ ֏     * 2 > B N Z  f & ( 6 Z p z        " ( f F N Z ^ bЏ       ˙ ˙     Џ & * . 2 6 : H" Z f n v zЏ       :     Џ " & * . 2 6 B R V ^ bЏ           Џ        " & 2 6Џ Z ^ b f j n ~      Џ           " & H Z f r ~       Џ        . 2 : >Џ f j n r v z ԏ ֏ bޏ n؏ ܏ ؏ ֏      P!) fޏ      ޏ           Fޏ P b jԏ n v ~Џ ܏ ޏ         "֏ &؏ V؏ f֏ zޏ    ԏ ܏          ԏ  f ޏ    ޏ W  ޏ  W   6ޏ z z     4  H  \  p          $ߙ 8ߙ Lߙ `ߙ ߙ ߙ ߙ ߙ  ߙ ߙ ,ߙ @ߙ hߙ |ߙ  ߙ ߙ ߙ ߙ ߙ ߙ 4ߙ Hߙ \ pߙ ߙ ߙ ߙ ߙ ߙ  $ߙ bޏ p   ޏ  ԏ ܏ D X fޏ t ޏ  ޏ  ޏ  ޏ  :ޏ @ rޏ x ޏ  ޏ  ޏ  Nޏ T ޏ  ޏ  ޏ  :ޏ @ nޏ t ޏ  ޏ  ޏ  Rޏ X ޏ  ޏ  ޏ  6ޏ < nޏ t ޏ  ޏ  *ޏ 0  j p!o ޏ z  ߙ ߙ ߙ 0ߙ T ` p   ޏ    ԏ ܏  , 6 > Z ^ l v  f  ԏ   Џ ܏  ˙ 6֏ :؏ f؏ v֏ ޏ    ԏ ܏         &ԏ Z֏ ^؏ ؏ ֏ ޏ    ԏ ܏        * Jԏ    ҏ  ޏ    ޏ     2 6ޏ D R l v     ԏ   Џ ܏   !o ( < H X h x ޏ  ޏ  ޏ  ޏ  ޏ  >ޏ D Zޏ ` zޏ  ޏ  ޏ  ޏ  ޏ  ޏ  *ޏ 0 Fޏ L fޏ l ‚ޏ ˆ žޏ ¤ ºޏ  ޏ  ޏ  ޏ  , @ T h ~ޏ Ê Î Ø êԏ î܏ ú       " 4 H \ p Ċޏ Ė Ĝ IJ Ķ         & 2 :ԏ B F JЏ N܏ ~ Ŋޏ Ů Ųޏ Ŷ  ԏ ܏        " . 6 : B ƨݙ Bԏ F֏ J܏ N R؏ zޏ Ȣ؏ Ȳ֏  ޏ    ԏ  ܏  & . 2 > J R V Z rҏ ɒ$ ɢ !) ޏ  ҏ 2$ 6ޏ D Vҏ zҏ    ֏ ޏ      ˮ ֏ *ޏ 8 Fҏ  f &ޏ * 8 J Nޏ T f ͢ ͤ Ͷ ͺޏ z ޏ  Vޏ \ Άޏ Ό ξޏ  ޏ  *ޏ 0 Zޏ ` ςޏ ψ Ϻޏ  ޏ  ޏ  bޏ h zҏ ҏ ҏ ֏ 2ҏ B֏ d t u Ҷҏ  ޏ  P zޏ ӄ Ө ҏ ֏ 2ҏ ~֏ Ԯ Ը f ˙ ҏ ղҏ Bޏ L p ҏ ֏ .ҏ J֏ ҏ  ޏ    ( > B R zҏ ؞֏ خҏ ֏ ؏ ؏ &֏ >ޏ F L Zԏ f܏ ـ ْ ٞ ٮ ԏ 8M Z֏ ^؏ ڊ؏ ښ֏ ڲޏ ں  ԏ ܏    " >ԏ zҏ ێ֏ ے؏ ۾؏ ֏ ޏ   ԏ ܏ ( : F V rԏ ܮޏ ܶ ܼ       &ҏ >ޏ F L ^  l ݂ ݆ ݞޏ ݦ ݬ ݺ      &ޏ . 4 ` v z ޒ ޾ ޏ " ` j l vޏ z ߈   ҏ    6ޏ F L ^ h   ޏ      ޏ    2 6ޏ @ Rޏ Z ` v     ҏ  ޏ   Dߙ X t  ޏ  ޏ , L ߙ    Rҏ rޏ  ޏ   ֏ ҏ ޏ  2ޏ D jҏ zh  ҏ ޏ  ޏ $   6h < Fҏ bޏ p ޏ $   ޏ  ޏ $  >ޏ L bޏ t ޏ     ֏ ؏ 2؏ B֏ Zޏ b h vԏ ܏       ԏ &ޏ 4 Jޏ \ ޏ  ޏ  ֏ ؏ ؏ ֏ 2ޏ : @ Nԏ Z܏ t    ԏ ޏ  ޏ , Vޏ d vޏ   ޏ  ޏ   "ޏ 4 Fޏ X  ҏ 6ҏ T   Џ  ԏ "܏ & > B F J N b f rЏ ߙ ߙ ߙ zޏ  ҏ ֏ ҏ ޏ  ҏ ֏ >ҏ ҏ ֏ ~ޏ   ޏ  , l ޏ  @ j֏ ޏ    ޏ   u  ҏ *ޏ 0 J֏ d f  ҏ ֏ ҏ ޏ       2ҏ Jҏ X bҏ ֏ ҏ u H x     ԏ ܏ ( 8 vҏ ޏ  ҏ ֏ 2ҏ ҏ ֏ @ vҏ ֏ ޏ    l f  ҏ u   ҏ :ޏ @ R֏ ޏ  ֏  ϙ 6ҏ Fҏ Zޏ ` x $   ߙ u $  ߙ ߙ  u &< 6ޏ < T f2 x $  ֏ ޏ  ޏ  ޏ  ޏ  2ޏ 8 Nޏ T jޏ p ޏ  $ ޏ   ޏ  "$ *ޏ @ ` ޏ    &ޏ 4 Fޏ J$ `  ޏ  ޏ  $ ޏ $ B h   ԏ ܏ 2    Џ &֏ T     ԏ ܏  * 4 Bԏ J܏ l  u ֏ ޏ  @    u  ҏ B Fԏ R܏ x    ԏ ܏  $ \ @ T l  ҏ    " &ԏ .܏ T x  ޏ  ԏ  ܏   6 H bԏ j܏ n   ޏ   . 8 Fԏ N܏ p  u ޏ  ҏ ޏ ޏ $ 4 rҏ ޏ $ ޏ    6ޏ H V$ l   2ޏ @ t ޏ   ޏ  ( T ֏ J Nԏ Z܏ |    ԏ ܏  6 @ Nԏ V܏ l v֏     :$ zԏ ~܏  ޏ  ֏  ޏ $ 2֏ J֏ ^ l zԏ ܏  $  ܏ ޏ   $ $ p   ԏ ܏   \ , @ X t     ԏ ܏ $ J V Zԏ f܏   ޏ  ҏ ޏ   ` ҏ ֏ 0 \ Bҏ T \ t \ ҏ ߙ ߙ  u   u  ҏ  \ ҏ .ޏ 4 J T bԏ j܏  ߙ ߙ ߙ ߙ ߙ ߙ (ߙ <ߙ P ` p ߙ ߙ ߙ ߙ ߙ  ߙ   0 @ P u    u ҏ 8 \ n rԏ ܏ ҏ  ԏ ܏ ҏ  ԏ &܏   ߙ h    ^ҏ zޏ    !  !Fҏ ! "H " #$ #Bޏ #X #h # # # #ޏ # #ޏ $ $ޏ $ $2ޏ $8 $Nޏ $T $jޏ $p $ޏ $ $ޏ $ $ޏ $ $ޏ $ $ޏ $ %ޏ % %.ޏ %4 %Jޏ %P %fޏ %l % %ޏ % % % & &>ޏ &F &L &bޏ &t & & & &ޏ & & &ޏ ' ' ' '6 '^ޏ 'f 'l 'ޏ ' ' ' ' ' (Џ (" (Fޏ (T (x ( ( ( (ԏ ( )ߙ )0 )l ) ) )ҏ *ޏ * *"ޏ *, *>ޏ *H *Zޏ *d *vޏ * *ޏ * * + +" +2ޏ +6Џ +Rޏ ,֏ ,؏ ,܏ ,ޏ ,ԏ ,V֏ ,j؏ ,z֏ , , , , , ,ԏ , ,܏ , , , - - - - -" -: -t!) - -!) . .( .:Џ .> .R֏ .V؏ .r֏ .؏ .֏ . . . . . .ԏ . .܏ . / / / /* /6 /: /> /Vԏ / /ԏ / / / /܏ / / / 0 0 0  0 0$ 0D 0N 0Z 0f 0v֏ 0z؏ 0֏ 0؏ 0֏ 0 0 0 0ԏ 0܏ 1 1 1& 12 16 1B 1N 1bԏ 1 1 f 2 2 2& 2J 2| z 2 2 2 2 2 3  30 3H 3V 3`  3v 3| f 3 3ԏ 3 3 3Џ 3܏ 3 3 3 3 3 3 3 4 ˙ 4(˙ 4: 4Bԏ 4F 4N 4VЏ 4Z܏ 4b 4 4 4 4 4 4 4" 4 4ԏ 4 4 4Џ 4܏ 4 5 5 5 5 5 5" 54: 5F 5Nԏ 5R 5Z 5bЏ 5f܏ 5n 5 5 5 5 5 5 5 5ԏ 5 5 5Џ 5܏ 5 6 6  6 6 6 6 6& 62ԏ 66 6: 6FЏ 6J܏ 6N 6v 6z 6~ 6 6 6 6 6ԏ 6 6 6Џ 6܏ 6 6 6 6 6 6 6 7  7  7 7*ԏ 7. 72 7>Џ 7B܏ 7F 7n 7r 7v 7z 7~ 7 7 7 7 7 7 7 7 7 7 8 8 8" 84 8J 8Rԏ 8Z 8^ 8fЏ 8j܏ 8r 8 8 8 8 8 8 8 8ԏ 8 8 8Џ 8܏ 8 9  9 9 9 9 9 :ԏ : ֏ :؏ :܏ :ޏ :n؏ :~֏ : : : : : ;!) ;ޏ ;0 ;> ;B ;L ;Z ;b ;fޏ ;n ;r ;| ; ; ; ; ; ; ; ;ޏ < < <" <* <6Џ R >x f >ޏ > > @F @\ @rޏ @v @ z @ A  A,  A@  AT  Ah  A|  A  A A  A  A  A Bߙ Bߙ B0ߙ BDߙ Bdߙ Bxߙ Bߙ Bߙ B Bߙ Bߙ Cߙ C$ߙ CLߙ C`ߙ Ct Cߙ Cߙ Cߙ Cߙ Cߙ Cߙ Dߙ D,ߙ D@ DTߙ Dhߙ Dߙ Dߙ Dߙ Dߙ D Eߙ EFޏ ET Ed Ex F, F@ FNޏ F\ Fjޏ Fx F F f F F F FЏ G  G˙ G:֏ G>؏ Gj؏ Gz֏ G Gޏ G G G G G G G G G G H HV֏ HZ؏ H؏ H֏ H Hޏ H H H H H H H I I  I I" Iv I I I Iޏ I I I I Iޏ I I I I J J* J. J6Џ J^ Jl J| J J Jޏ J Kޏ K  KBޏ KH Kzޏ K Kޏ K Kޏ K Lޏ L L>ޏ LD Lrޏ Lx Lޏ L Lޏ L M2ޏ M8 Mnޏ Mt Mޏ M Mޏ M Nޏ N  NNޏ NT Nޏ N Nޏ N Nޏ O O:ޏ O@ Ozޏ O Oޏ O P Pޏ P Pޏ Q Qޏ Q Q.ޏ Q4 QJޏ QP Qޏ Q Qޏ Q Qޏ Q Qޏ Q Qޏ Q Rޏ R R.ޏ R4 RRޏ RX Rnޏ Rt Rޏ R Rޏ R Rޏ R Rޏ R Sޏ S  S&ޏ S, SBޏ SH S^ޏ Sd S S S S S S Sޏ S Tޏ T T0 TD TX Tj Tnޏ Tv Tz T T T T T T T U U  U U0 UD UX Ul U U Uޏ U U U U U U U V V V V" V0 V: VF VV VZ VbЏ V Vޏ V Vޏ V V V V W W W W W& W* W6 W> WB WJ Wԏ W֏ X>؏ XBޏ Xf܏ X؏ X֏ X X X X X Y!) Y.ޏ YH YV YZ Yd Yr Y~ޏ Y Y Y Y Y Y Y Y Y Y Y Y Z ޏ Z Z& Z.ԏ Z2 Z: ZBЏ ZF܏ Z~ޏ Z Z Z Z Z Z Z Z Z֏ Z؏ [؏ [*֏ [>ޏ [F [J [P [^ԏ [f܏ [j [ [ [ [ [ [ [ [ [ԏ \r \ f \ \ \ \ \ \ \ ] ]ޏ ]P z ]d ]  ]  ]  ]  ]  ]  ]  ^ ^$  ^8  ^L  ^` ^tߙ ^ߙ ^ߙ ^ߙ ^ߙ ^ߙ _ߙ _ߙ _, _@ߙ _Tߙ _|ߙ _ߙ _ߙ _ߙ _ _ߙ `ߙ `ߙ `0ߙ `Pߙ `dߙ `ߙ `ߙ ` `ߙ `ߙ `ߙ aߙ a8ߙ aLߙ a` atߙ a a a aޏ a b b b&ԏ b*܏ bF b\ bp b~ޏ b bޏ b b b b f b bԏ b c cЏ c ܏ c> cL˙ cr֏ cv؏ c؏ c֏ cޏ c c c cԏ c܏ c c d d d* d. d: dRԏ d֏ d؏ d؏ d֏ dޏ d d d dԏ e܏ e e  e( e2 e> eB eN efԏ e e e eޏ e e e e eޏ f f f f f> fFԏ fN fR fVЏ fZ܏ f f f fޏ f f f fԏ f܏ g g g* g2 g< gF gZޏ gf gl g g g g g g g g g g g h h h h6 hL h^ hbޏ h z h h  h  h  i  i$  i8  iL  i` it  i  i  i iߙ iߙ iߙ jߙ j ߙ j4ߙ jTߙ jhߙ j| jߙ jߙ jߙ jߙ kߙ kߙ k0 kDߙ kXߙ klߙ kߙ kߙ kߙ kߙ kߙ k lߙ l$ߙ lLߙ l`ߙ lߙ lߙ l lߙ l l m m.ޏ m< mL m` mԏ m܏ m m mޏ m mޏ n n n n( f nVޏ n^ nb nl n~ԏ n܏ n n n n n n n n oԏ o  o oЏ o܏ oF oRޏ ov ozޏ o~ o oԏ o܏ o o o o o o o o o o p p  pԏ pޏ q֏ q؏ q܏ qV؏ qf֏ q~ q q q q q!) qޏ r r r r$ r2 r>ޏ rF rJ rP r^ rt r~ r r r r r r rޏ r r r r sЏ s6ޏ sB sH sV sZ sp sz s s s֏ s؏ s؏ s֏ sޏ s t t t t8 tB tJ tN tZ t^ tj tr u u< f uV uZ ub uj u u u uޏ u z v v0  vD  vX  vl  v  v  v  v v  v  v  w  w ߙ w4ߙ wHߙ w\ߙ w|ߙ wߙ wߙ wߙ w wߙ xߙ x(ߙ x<ߙ xdߙ xxߙ x xߙ xߙ xߙ xߙ xߙ yߙ y0ߙ yDߙ yX ylߙ yߙ yߙ yߙ yߙ yߙ z  z ߙ z4 zH z\ zޏ z z z z {  {ޏ {( {6ޏ {D {X {j {t f { { { {Џ { {˙ |֏ |؏ |>؏ |N֏ |bޏ |j |n |t | | | | | | | }֏ }؏ }F؏ }V֏ }jޏ }r }v }| } } } } } } } ~" ~0 ~: ~Fޏ ~N ~R ~X ~f ~rޏ ~ ~ ~ ~ ~ ~ ~ ~Џ   Nޏ Z ^ h        ޏ    " 8 B N Z n v          ޏ H z `          4  H  \ pߙ ߙ ߙ ߙ ߙ ߙ ߙ ߙ ( <ߙ Pߙ xߙ ߙ ߙ ߙ  ߙ ߙ ߙ ,ߙ Lߙ `ߙ ߙ ߙ  ߙ ߙ ߙ ߙ 4ߙ Hߙ \ pߙ    ޏ    X l zޏ  ޏ    f  &ޏ 2 6 @ Z t ~        Џ  ޏ > Bޏ F P b f           rԏ v֏ ޏ ؏ ܏ ؏ *֏ B F N R b !) ޏ      ޏ    " 8 B J N Z ^ j r ޏ   ԏ   Џ ܏ ޏ   " & < F R b j֏ n؏ ؏ ֏ ޏ    ԏ ܏     " . 2 > F bԏ   f . 2 :ҏ B f | ޏ   z  @  T  h  |           0ߙ Dߙ Xߙ lߙ ߙ ߙ ߙ ߙ  ߙ ߙ 8ߙ Lߙ tߙ ߙ  ߙ ߙ ߙ ߙ ߙ ߙ @ߙ Tߙ h |ߙ ߙ ߙ ߙ ߙ ߙ  0ߙ D X l ޏ    ԏ ܏   4 Bޏ P ^ޏ l   f  ԏ   Џ ܏  (˙ N֏ R؏ ~؏ ֏ ޏ    ԏ ܏        .ԏ b֏ f؏ ؏ ֏ ޏ    ԏ ܏       * Bԏ z   ޏ     ޏ      "ԏ * . 2Џ 6܏ f vޏ | ޏ     u   ԏ "܏ @ P b ~ޏ  ޏ  ޏ   ޏ    &ԏ *܏ . 6 T ^ z    ޏ         " * 8 B N R Zҏ b n   ޏ  ( z @ `  t           (  < Pߙ dߙ xߙ ߙ ߙ ߙ ߙ ߙ  ߙ 0ߙ Xߙ lߙ ߙ ߙ  ߙ ߙ ߙ ߙ ,ߙ @ߙ `ߙ tߙ  ߙ ߙ ߙ ߙ ߙ (ߙ < Pߙ d x  ޏ    ԏ ܏ H \ jޏ x ޏ    f ޏ  ޏ  8 L \ l u  ԏ ܏   ޏ  *ޏ 0 Jޏ P jޏ v z  ԏ ܏         ԏ & * .Џ 2܏ b nޏ  ޏ   ԏ ܏            & *ԏ .ޏ 2؏ 6܏ >֏ ֏ ؏ ֏          & 2 : > B l    Џ  ֏ ؏ 6֏ J؏ Z֏ j n z                     $ 6 : J Z x f           z 4 Pߙ dߙ |       f : B N V ZЏ          ˙ & :֏ >؏ Z֏ n؏ ~֏               b p      Џ      , > B R d | h W     h ( W < u ` |              8 B T p               2 6 : > T ^ 6֏ :؏ Fԏ Jޏ V܏  ޏ     ԏ  ܏  & * 6 B J N R j nޏ | Џ   ޏ     ԏ  ܏ "ޏ D V Z f r z ~  ԏ .ԏ 6܏ : > B F n rޏ ~          f " & * . 2 6 B J N܏ f  ޏ  z ޏ  ߙ ߙ "ޏ ( h   f  ԏ  ܏  Џ   ޏ  ( 2 6 P b f v ˙   ޏ  " 0 : >ԏ J N܏ l ~       ԏ   ԏ ܏ 0 B Jԏ R V܏ Z ^Џ f  ޏ         ޏ  W , h B H Zޏ `   h ޏ W ޏ W   . 8 Vޏ d z ޏ    ԏ        "ޏ ( Bޏ J N T f                 & H ^ bޏ x z ޏ  ߙ ߙ ޏ  $ 6ޏ D W \ h r x ޏ   f  h ޏ  W ޏ ( W Fޏ P W jޏ x ޏ    ԏ  ܏      " 2ޏ 8 ԏ ܏ ؏ "ޏ *֏ b֏ v؏ Æ֏ Ö Ú æ ð ú         " B H Z ` p Ć Ċ Ė Ğ ĢЏ           & 2 :֏ >؏ ^֏ r؏ ł֏ Ŗ Ţ Ť Ů ž        ƶ f    > dž  f   ˙ * 2 B֏ F؏ b֏ v؏ Ȇ֏ Ȗ Ț Ȧ Ȱ Ⱥ         " ɖ ɜ z ɰ     T ʚ ʞ ʦ ʼ      " * . 6 : P 6֏ :؏ >ޏ B܏ Jԏ ̪ ̮ޏ ̶ ̺   ԏ  ܏    & 2 : > B ^ޏ f l zޏ ͂ ͈ ͖ޏ ͜ ͮ Ͷ ԏ Џ  ܏        ޏ " ( H R ^ j κޏ    ԏ ܏     " . : Nԏ  f   F Jޏ P bޏ v   f & * H˙ ^ f Ѷ Ѻޏ     ԏ  ܏  " & 2 > F J N fԏ z     , 6܏ :ԏ X j Ӑ Ӫ    ޏ    ԏ  " &܏ L ^ j v ~ Ԋ Ԝ ԏ ؏ &܏ *ޏ J֏ n֏ Ն؏ բ֏ ն պ        & 2 > B F d \ x ֈߙ ֠ \ ִߙ ߙ \ ߙ ؏ ֏ 6֏ N؏ j֏ ~ ׂ ׎ ט ע ײ         B֏ F؏ b֏ z؏ ؖ֏ ت خ غ        & 2 6 : B֏ F܏ J؏ Nޏ Vԏ ڞ؏ ں ھޏ     ԏ  ܏  & * 6 B J N R j r$ !) d ޏ  ޏ 0 p!) ܀ d ܒޏ ܘ ܢ ܦޏ ܾҏ ޏ  Џ  ؏ .؏ J Nޏ V Z h r vԏ ݂ ݆܏ ݤ ݶ ݺ      ԏ ފ ޒԏ ޚ ޞ ަ ު܏ ؏ ؏  ޏ & * 8 B Fԏ R V܏ t ߆ ߊ ߖ ߢ ߪ ߮ ԏ  & 8 f R V ^ b f n v z ~  ޏ   f      ޏ   6ޏ P Z b n z    ޏ       B Fԏ N V ZЏ ^܏ j ˙  ԏ   Џ ܏   " &ޏ . 4 \ f r ~  ޏ   ޏ  ޏ , 6 > J bޏ x         ޏ z ޏ  "ޏ ( >ޏ D bޏ h            T  ` f p! ޏ  ޏ   ޏ 8 V Z  " ޏ   ޏ  @ ^ԏ b܏ j nЏ r v      "ޏ @ J ޏ        8 P h vޏ ~      0 R T  ޏ        0 D h jޏ r x       8 P bޏ p ~          ޏ   f  ޏ z "ޏ ( >ޏ D Zޏ ` ~ޏ           . 0  p  | f ! ޏ  ޏ " ( :ޏ T r v  " ޏ   ޏ 0 \ zԏ ~܏  Џ        6ޏ T ޏ        8 L h rޏ z      , N P  ޏ         , @ h fޏ n t       &ޏ 4 B L \ rޏ | ޏ   ԏ  & * 2Џ 6܏ : >ޏ rԏ v ~  Џ ܏  ޏ nԏ r֏ v܏ zޏ ؏ ֏ ؏ ֏  , BЏ F Zҏ j֏ ֏ ֏ Z ^ j t ~          . 6 F Jԏ N RЏ V܏ Z ^            ֏ "؏ R؏ b֏ ԏ     * .ԏ : >܏ \ n z      ҏ  ܏ ԏ "֏ & . 2 6      * , J \ f n r ~    " $ B T ^ f j v       0 H ` x         8 P h        ( @ X p        0 H ` x  ߙ   8 P h            . : > J V n z |            & 2 6 X p ߙ   0 H ` x   2 > @ Z p z             4 pߙ      8 L |     0 : B F R f v x        0ߙ         <          & 6 8 N ` j v z       4 L d |        $ < T l        , D \ t        4 L d |        $ < T l        , D \ t        4 L d |        $ < T l        , D \ t        4 L d |        $ < T l        , D \ t        4 L d |        $ < T l        , D \ t        4 pߙ   " " " " " " # #  # #2 #> #D #V #l #v #~ # # # # # # # # $ $ $" $& $: $F $H $^ $x $ $ $ $ $ $ $ %  %$ %< %T %l % % % % &ߙ &H & & & & & ' '  ' ' '" '> 'J 'P 'b 'x ' ' ' ' ' ' ' ' ' ' ( (" (6 (B (D (Z (t (~ ( ( ( ( )ߙ )8 ) ) ) ) ) ) ) ) ) ) * *" *( *: *P *Z *b *f *r * * * * * * * * + + + +2 +L +V +^ +b +n + + + + + , ,( ,@ ,X ,p , , , , , - - -0 -H -` -x - - - - - . .  .8 .P .h . . . . . . / /( /@ /X /p / / / / / 0 0 00 0H 0` 0x 0 0 0 0 0 1 1  18 1P 1h 1 1 1 1 1 1 2 2( 2@ 2X 2p 2 H 2 3 3 3 3 3 3 3 3 3 4  4& 42 48 4J 4` 4j 4r 4v 4 4 4 4 4 5 5( 5@ 5X 5p 5 5 5 5 5 6 6 60 6H 6` 6x 6 6 6 6 6 7 7  78 7P 7h 7 7 7 7 7 7 8 8( 8@ 8X 8p 8 8 8 8 8 9 9 90 9H 9` 9x 9 9 9 9 9 : :  :8 :P :h : : : : : : ; ;( ;@ ;X ;p ; ; ; ; ; < < <0  >( >@ >X >p > > > > > ? ? ?0 ?H ? H ? ? @ @ @ A A A& A. A2 A> AZ Af Al A~ A A A A A A A B B, BD B\ Bt B B B B B C C C4 CL Cd C| C C C C C D  D$ D< DT Dl D D D D D D E E, ED E\ Et E E E E E F F F4 FL Fd F| F F F F F G  G$ G< Gߙ G G Hf Hr Ht H H H H H H H H H I I I& I. I2 I> If Ir It I I I I I I I J J  J8 JP Jh J J J J K H KH Kt K K K K K K K K L L L* L0 LB LX Lb Lj Ln Lz L L M H M8 Md M M M M M M M M M M N  N N" N8 NB NJ NN NZ N N N H O OD Ob On Op O O O O O O O O O P P P" P* P. P: Pd P P P P P P Q Q( Q@ QX Qp Q Q Q Q Q R R R0 RH R` Rx R R R R R S S  S8 SP Sh S S S S S S T T( T@ TX Tp T T T T T U U U0 UH U` Ux U U U U U V V  V8 VP Vh V V V H W WD W W W X X X& X. X2 X> XZ Xf Xl X~ X X X X X X X Y Y, YD Y\ Yt Y Y Y Y Y Z Z Z4 ZL Zd Z| Z Z Z Z Z [ [( [@ [X [p [ [ [ [ [ \ \ \0 \H \` \x \ \ \ \ \ ] ]  ]8 ]P ]h ] ] ] ] ] ] ^ ^( ^@ ^X ^p ^ ^ ^ ^ ^ _ _ _0 _H _` _x _ _ _ _ _ ` `  `8 `P `h ` ` ` ` ` ` a a( a@ aX ap a a a a a b b b0 bH b` bx b b b b b c c  c8 cP ch c c c c c c d d( d@ dX dp d d d d d e e e0 eH e` ex e e e e e f f  f8 fP fh f f f f f f g gP H g g h h h h h h i i  i i2 i> iD iV il iv i~ i i i i i j j j4 jL jd j| j j j j j k@ H kx k k k k k l l" l* l. l: lV lb lh lz l l l l l l l m m( m@ mX mp m m m m m n n n0 nH n` nx n n n n n o o  o8 oP oh o o o o o o p p( p@ pߙ p q. q: q< qR ql qv q~ q q q q q q q q q q r r. r: r< rR rl rv r~ r r r r r s s s0 sH s` sx s s s s s t t  t8 tP th t t t t t t u u( u@ uX up u u u u u v v v0 vH v` vx v v v v w H wX w w w w w x x x x x* xF xR xX xj x x x x x x x y0 H yh y y y y y y y z z z z. z: z@ zR zh zr zz z~ z z z z { { {0 {H {` {x { { { { { | |  |8 |P |h | | | | | | } }( }@ }\ } } } } } } } } } ~ ~ ~  ~2 ~H ~R ~Z ~^ ~j ~ ~ ~ ~ ~ ~ ~ ~   $ < X             . D N V Z f       $ < T l     ߙ H            " ( : P Z b f r          $ < T l        , D \ t        4 L d |    ߙ 8 t             * @ J R V b           , D \ t        4 L d |       $ < T l        , D ߙ      . H R Z ^ j             . H R Z ^ j       ( @ X t        4 L h        , H d       0 L h       , H d           . : F R |          . : @ R h r z ~       0 : B F R n z        H X            * 0 B X b j n z          < r ~            ( 2 : > J           & . 6 : P Z ^ |          & H Z f r ~            `ߙ       ( 2 : > J f r x           ( 2 : > J ߙ   * 6 8 N h r z ~           * 6 8 N h r z ~  ֏       0 B N Z f n v z         @ߙ x  $         & B N T f |             & H      & @ J R V b ~          P H         " & 2 N Z ` r       ֏   * 8 B N p              & 2 H      & @ J R V b ~          P H         " & 2 N Z ` r       H X            * 0 B X b j n z  ߙ ( d ~             4 > F J V ~         0ߙ h           : F L ^ t ~             H      & @ J R V b ~          P H         " & 2 N Z ` r        2 > @ R p z             `ߙ  $     ( 2 : > J f r x           ( 2 : > J |          . : @ R h r z ~  H  D b n p            " * . : d H   2 > @ V p z             4 H      & @ J R V b ~          P H ˆ ´       " & 2 N Z ` r È Ò Ú Þ ê  H X Ą Ģ Į İ        * 0 B X b j n z Ť ߙ ( l Ƃ Ǝ Ɛ Ʀ         " 8 B J N Z ǂ ǎ ǐ Ǧ      @ H x Ȥ         " > J P b x ɂ Ɋ Ɏ ɚ   H H t ʒ ʞ ʠ ʶ         2 H R Z ^ j ˔ H  D b n p ̆ ̠ ̪ ̲ ̶       " * . : d Ͱ H   2 > @ V p z ΂ Ά Β ή κ        4 π H ϸ     & @ J R V b ~ Њ А Т и      P H ш Ѵ       " & 2 N Z ` r ҈ Ғ Қ Ҟ Ҫ  0ߙ h Ӭ         & B N T f | Ԇ Ԏ Ԓ Ԟ         & Հ H ո     & @ J R V b ~ ֊ ֐ ֢ ָ      P H ׈ ״       " & 2 N Z ` r ؈ ؒ ؚ ؞ ت  H X ل ٢ ٮ ٰ        * 0 B X b j n z ڤ     & D N V Z f ۂ ێ ۔ ۦ ۼ     8 n z | ܎ ܬ ܶ ܾ       $ . 6 : F x ݮ ݺ ݼ       * 6 < N d n v z ކ H  D b n p ߆ ߠ ߪ ߲ ߶       " * . : d ߙ  , B N P f               B N P f      ߙ 8 t             * @ J R V b          @ߙ x        " & 2 N Z ` r            " & 2 ߙ   " . 0 F ` j r v           " . 0 F ` j r v  ߙ  \ r ~            ( 2 : > J r ~        0 H h           . : @ R h r z ~   H 8 d             " 8 B J N Z  H  4 R ^ ` v              * T H   " . 0 F ` j r v           $ p H       0 : B F R n z         @ H x          " > J P b x       H H t             2 H R Z ^ j  H  D b n p            " * . : d H   2 > @ V p z             4 H      & @ J R V b ~          P H         " & 2 N Z ` r        6 B D V t ~             p H       0 : B F R n z         @ H x           " > J P b x       H H t              2 H R Z ^ j   H  D b n p            " * . : d ߙ  , F R T j               F R T j       & 2 4 F d n v z           0 j v x            * 2 6 B t          * 6 < N d n v z  ֏        , > J V b j r v         @ H x           " > J P b x       : F H Z x              v z              , 6 : X j v         $ 6 B N Z b j n         " & 2 @ J V x             " . : ߙ       6 P Z b f r              6 P Z b f r ߙ 8 |              2 H R Z ^ j          B F R ` j v            $ 6 B N Z ߙ   2 > @ V p z              2 > @ V p z     H ( T r ~          ! ! !( !2 !: !> !J !t ! H ! "$ "B "N "P "f " " " " " " " " " " # #  # # #D #ߙ # $  $" $. $0 $F $` $j $r $v $ $ $ $ $ $ $ $ $ $ %" %. %0 %F %` %j %r %v % % % % & & & &< &N &Z &f &r &z & & & & & & & & & & '8  'P ' ' ' ' ' ' ' ' ' ( ( ( ( (" (8 (B (F (d (v ( ( ( ( ( )  )H )h )  ) ) ) *  * * *D *V *b *n *z * * * * * * * + +. +: +> +P +| + + + + + + + , ,< ,` , ,  - -" -& -2 -@ -J -N -x - - - - - - - - - - .$ .6 .B .d  .| . . . . . . / / / /. /: /@ /R /h /r /z /~ / / / / / / / 0 0 0 0* 06 0> 0F 0J 0` 0j 0n 0 0 0 H 1( 1T 1r 1~ 1 1 1 1 1 1 1 1 1 2 2 2( 22 2: 2> 2J 2t 2 2 2 2 2 2 2 2 30 H 3h 3 3 3 3 3 3 3 4 4 4 4. 4: 4@ 4R 4h 4r 4z 4~ 4 4 5 H 58 5r 5~ 5 5 5 5 5 5 5 5 5 6 6 6( 62 6: 6> 6J 6t 6 H 6 72 7> 7@ 7V 7p 7z 7 7 7 7 7 7 7 7 7 7 7 8  84 8L 8d 8  9 9 9 9, 96 9: 9` 9r 9~ 9 9 9ߙ : :` :v : : : : : : : : : : ; ; ;, ;6 ;> ;B ;N ;r ;v ; ; ; ; ; ; ; ; ; < <, <6 <>  =@ =V =p =z = = = = = = = = = = = >  >4 >p > > > ? ?@  ? ? ? ? ? ? ? ? @ @ @ @0 @L @ @ @ @ @ @ @ A A A A$ AJ AR AV Al Av Az A A A B B0 Bp  B B B B B B B C( C: CF CR C^ Cz C C C C C C C C D@ H Dx D D D D D E E  E E E" E> EJ EP Eb Ex E E E E E F H FH Ft F F F F F F F F F G G G  G2 GH GR GZ G^ Gj G Gߙ H( Hl H H H H H H H H H H I  I I" I8 IB IJ IN IZ I I I I I I I I I J@ H Jx J J J J J K K  K K K" K> KJ KP Kb Kx K K K K K Lߙ LH L L L L L L L L L M M" M. M4 MF M\ Mf Mn Mr M~ M M M M M M M M N N` H N N N N N O O  O* O2 O6 OB O^ Oj Op O O O O O O O P0 H Ph P P P P P P P Q Q Q Q. Q: Q@ QR Qh Qr Qz Q~ Q Q Q R R R  R2 RP RZ Rb Rf Rr R R R R R R R R R S S S S, S6 S: Sd Sv S S S S T T  T* T2 T6 TB T^ Tj Tp T T T T T T U H UH Ut U U U U U U U U U V V V  V2 VH VR VZ V^ Vj V V H W WD Wb Wn Wp W W W W W W W W W X X X" X* X. X: Xd X H X Y Y2 Y> Y@ YV Yp Yz Y Y Y Y Y Y Y Y Y Y Y Z  Z4 Z H Z Z [ [ [ [& [@ [J [R [V [b [~ [ [ [ [ [ [ [ [ \ \P H \ \ \ \ \ \ ] ] ]" ]& ]2 ]N ]Z ]` ]r ] ] ] ] ] ] ^ H ^X ^ ^ ^ ^ ^ ^ ^ ^ ^ _ _ _* _0 _B _X _b _j _n _z _ _ H `( `T `r `~ ` ` ` ` ` ` ` ` ` a a a( a2 a: a> aJ at a H a b$ bB bN bP bf b b b b b b b b b b c c  c c cD c H c c d d d  d6 dP dZ db df dr d d d d d d d d d e e` H e e e e e f f  f* f2 f6 fB f^ fj fp f f f f f f f g0 H gh g g g g g g g h h h h. h: h@ hR hh hr hz h~ h h i  i@ iN ih iҏ j j@  jp j jҏ k6 k`  k k lҏ l H l l m m m m& m@ mJ mR mV mb m~ m m m m m m m m n n, nb nn np n n n n n n n n n o o o" o* o. o: o H o o p p p  p6 pP pZ pb pf pr p p p p p p p p p q q` H q q q q q r r  r* r2 r6 rB r^ rj rp r r r r r r r s0 H sh s s s s s s s t t t t. t: t@ tR th tr tz t~ t t u H u8 ud u u u u u u u u u u v  v v" v8 vB vJ vN vZ v v H w w4 wR w^ w` wv w w w w w w w w w x x x x x* xT x H x y y" y. y0 yF y` yj yr yv y y y y y y y y y y z$ zp H z z z z { { {0 {: {B {F {R {n {z { { { { { { { { |@ H |x | | | | | } }  } } }" }> }J }P }b }x } } } } } ~ H ~H ~t ~ ~ ~ ~ ~ ~ ~ ~ ~     2 H R Z ^ j   H  D b n p            " * . : d H   6 B D Z t ~             8 H      6 P Z b f r           ` H        * 2 6 B ^ j p        0 H h           . : @ R h r z ~   H 8 d             " 8 B J N Z  H  4 R ^ ` v              * T H   " . 0 F ` j r v           $ p H       0 : B F R n z         @ H x          " > J P b x       H H t             2 H R Z ^ j  H  D b n p            " * . : d H   2 > @ V p z             4 \             2 H R Z ^ j ߙ  H b n p            " * . : b n p       ߙ X           2 > D V l v ~            pߙ      & @ J R V b ~            & @ J R V b          * F R X j      ߙ 8 |             2 H R Z ^ j          Pߙ       $ . 6 : F b n t           $ . 6 : F ߙ   2 > @ V p z             2 > @ V p z    ߙ ( |             2 H R Z ^ j            . H R Z ^ j ߙ  @ V b d z             " . R V b p z ~          " . ߙ      6 P Z b f r             6 P Z b f r ߙ  V b d z             " . V b d z      ߙ H            * 0 B X b j n z          `ߙ       0 : B F R n z            0 : B F R ߙ  , B N P f               B N P f      ߙ 8 |             2 H R Z ^ j          P H         " & 2 N Z ` r       H X            * 0 B X b j n z  H ( T r ~            ( 2 : > J t H  $ B N P f               D  H      6 P Z b f r Î Ú à ò       `ߙ Ę     " < F N R ^ z ņ Ō Ş Ŵ ž       " < F N R ^ ưߙ  , B N P f ǀ NJ ǒ ǖ Ǣ Ǿ         B N P f Ȁ Ȋ Ȓ Ȗ Ȣ H 8 d ɂ Ɏ ɐ ɦ         " 8 B J N Z ʄ H  4 R ^ ` v ː ˚ ˢ ˦ ˲         * T ̠ H   " . 0 F ` j r v ͂ ͞ ͪ Ͱ       $ L ΂ Ύ ΐ ΢         " 8 B J N Z ό         " > J P b x Ђ Њ Ў К ߙ ( l т ю ѐ Ѧ         " 8 B J N Z ҂ Ҏ Ґ Ҧ      @ H x Ӥ         " > J P b x Ԃ Ԋ Ԏ Ԛ   & 2 4 F d n v z Ն բ ծ մ       ` H ֘       * 2 6 B ^ j p ׂ ט ע ת ׮ ׺  0 H h ؔ ز ؾ        . : @ R h r z ~ ي ٴ H 8 d ڂ ڎ ڐ ڦ         " 8 B J N Z ۄ H  4 R ^ ` v ܐ ܚ ܢ ܦ ܲ         * T | ݶ         2 > D V l v ~ ނ ގ      8 B J N Z v ߂ ߈ ߚ ߰ ߺ    0ߙ h          " > J P b x             " H      & @ J R V b ~          P H         " & 2 N Z ` r       ߙ X           & 2 8 J ` j r v           ` H        * 2 6 B ^ j p        0 H h  ҏ          2 > D V l v ~     H H t             2 H R Z ^ j       4 > F J V r ~        0 H h           . : @ R h r z ~     " $ 6 T ^ f j v          P H         " & 2 N Z ` r       @ H x          " > J P b x       H H t             2 H R Z ^ j  H  D b n p            " * . : d H   2 > @ V p z             4 H      & @ J R V b ~          Pߙ z     $ . 6 : F b n t           $ . 6 : F |ߙ  ߙ:>@Rhr~ *26Bߙ6BDZt~6BDZt~ H(Tr~(2:>Jt H$BNPf D p   * 2 6 L V Z    H ( T r ~            ( 2 : > J t H  $ B N P f               D ߙ "$:T^fjv"$:T^fjv H4R^`v*T H".0F`jrv$p H0:BFRnz@ Hx ">JPbx HHt 2HRZ^j HDbnp"*.:d H2>@Vpz 4 H&@JRVb~P H"&2NZ`r H X         !!!*!0!B!X!b!j!n!z!! H"("T"r"~"""""""""###(#2#:#>#J#t# H#$$$B$N$P$f$$$$$$$$$$%% %%%D% H%%&&& &6&P&Z&b&f&r&&&&&&&&&''` H'''''(( (*(2(6(B(^(j(p((((((()0ߙ)h)))))** ***"*>*J*P*b*x********++ +++"+ߙ+, ,",.,0,F,`,j,r,v,,,,,,,,,,-"-.-0-F-`-j-r-v--֏-----..(.:.F.R.^.f.n.r......../֏/*/./:/H/R/^///////////0 00*060B0ߙ01 1&12141J1d1n1v1z11111111112&22242J2d2n2v2z22 H33D3b3n3p333333333444"4*4.4:4d4ߙ45,5F5R5T5j555555555566666F6R6T6j666667 H787d77777777778 88"888B8J8N8Z88 H9949R9^9`9v999999999:::::*:T: H:;;";.;0;F;`;j;r;v;;;;;;;;;;<$>>>&>@>J>R>V>b>ߙ??\?v??????????@@@,@6@>@B@N@v@@@@@@@@A0 HAhAAAAAAABBBB.B:B@BRBhBrBzB~BBCߙC8C|CCCCCCCCCDDD D2DHDRDZD^DjDDDDDDDDDEP HEEEEEEFFF"F&F2FNFZF`FrFFFFFFG ߙGXGGGGGGGGHHH*H6H<HNHdHnHvHzHHHHHHHHIII`ߙIIIJJJJ4J>JFJJJVJrJ~JJJJJJJJKKKK4K>KFKJKVKߙKL,LFLRLTLjLLLLLLLLLLMMMMMFMRMTMjMMMMMNߙN8N|NNNNNNNNNOOO$O6OLOVO^ObOnOOOOOOOOOPPߙPPPPPQQ Q*Q2Q6QBQ^QjQpQQQQQQQQQRR R*R2R6RBRߙRSS6SBSDSZStS~SSSSSSSSSSTTT6TBTDTZTtT~TTTTߙU(UlUUUUUUUUUVVVV&V<VFVNVRV^VVVVVVVVVW@ߙWxWWWWWXXX&X*X6XRX^XdXvXXXXXXXXXYYY&Y*Y6Y HYYZZZ Z6ZPZZZbZfZrZZZZZZZZZ[[` H[[[[[\\ \*\2\6\B\^\j\p\\\\\\\]0 H]h]]]]]]]^^^^.^:^@^R^h^r^z^~^^^֏^^_ __"_._P_b_n_z__________```` H`````aa a*a2a6aBa^ajapaaaaaaab0 Hbhbbbbbbbcccc.c:c@cRchcrczc~ccdߙd8d|dddddddddeee e2eHeReZe^ejeeeeeeeeefP Hffffffggg"g&g2gNgZg`grggggggh ߙhXhhhhhhhiiii.i:i@iRihirizi~iiiiiiijjjjp Hjjjjkkk0k:kBkFkRknkzkkkkkkkkl@ߙlxlllllmmm"m&m2mNmZm`mrmmmmmmmmmnnn"n&n2nnnnnnnnnooooo"o8oBoFodovooooߙppJҏpppppppqqqq.q:q@qRqhqrqzq~qqqqqqqҏqrr"r*rBrNrPrfrrrrrsߙs8sjҏsssssttt"t&t2tNtZt`trtttttttttuuu"u&u2uduuuuuuuuuvv&v,v>vTv^vfvjvvvvvvww w*w2w6wBw^wjwpwwwwwwx HxHxtxxxxxxxxxyyy y2yHyRyZy^yjyy HzzDzbznzpzzzzzzzzz{{{"{*{.{:{d{ߙ{|,|B|N|P|f||||||||||}} }}}B}N}P}f}}}}}}~ ~@~d~ҏ 8Xҏ0 `ҏ0T| "&2@JNx$6Bp Pbfr ,6:dv,L $6BNZp0BNRd(Lt "0:>hz&2d@  "8X"4^fjD  8JVbn:>JXbn.:FR"*.DNRpߙ(t .DNVZf@ߙx *26B^jp 0BZfh~ (2>`r~ "p H *26B^jp,D\ p*26LVZߙ\v,6>BNv0 Hh &24Jdnvz(@pߙ(2:>Jߙߙ uVbdz ".Vbdz H 4>B`r~ߙH*2:>T^b.:FR  P<ߙߙ*6Hߙ^bn|ߙH*2:>T^b.:FRߙ$:>JXbf*6BNbfr0ߙh (ߙbfr&*Pbnz 8`&2>JRZ^t~Pߙ&2>Pߙ ߙߙl u 4>B`r~&2Hߙ ".<FJp&2Ld| $<Tl<d  *.Xjv‚Žª²¶"FJRV^bjnà ĀߙĜߙ,6B|ŔŬ $<TlƄƪƮư(@XpnjǨ$`ȄȬ @RVbpz~ɨɺ&*Tfrʘ ".<FJtˆ˒˞˪ߙ(l̠̪̮̂̆̒ 4>B`r~͖͊ͪͮͺ&2T pΈΰ u,\ϐϬ&2>JRZ^t~ЂРво 8PbfnръюѴ *2p \Ҡ0 l pӐ ߙ"&2@JNtԆԒԞԪԾ".:JRV^b|ՆՎ՚՞ծղվ*26LVZքְ֖ 8Jtט Pbfr؀؊؎ظ ,6:dvقٰ@ ڐڢڦڲ ".JRVlvzۤ۶ nr~܌ܖܚ$Z^jx݂݆ݬݾJNZhrvޜޮ޺ߙHߌߢߦ߲*2:>T^b.:FRߙ "&2@JNt*6JNZhrvߙH*2:>T^b.:FRߙ "&2@JNt*6JNZhrvߙH*2:>T^b.:FRߙ "&2@JNt*6JNZhrvߙH*2:>T^b.:FRߙ26BPZ^".:FZ^jx ߙX".:BJNdnr,>JVbߙ26BPZ^".:FZ^jx ߙX".:BJNdnr,>JVbߙ26BPZ^".:FZ^jx ߙX".:BJNdnr,>JVb ,6:dvP &2>Zbf|0 ~ 2:bp $@BJV\fn $<Tlߙ  8 P h        4 \ x       ( < \ t       8 P h        @ T x      8Ph(H\p2:>DNVpz "DVbnzFJVdnz (:FR^*2:>T^b H8nr~  *.L^jv H(^bn|<NZfr \ ".BFR`jn<NZ^nr~,6Bdv&T` H 2>JV^fj  , H    ! !!!@!R!^!j!v!~!!!!!!!!!"""4"L""""""""####"#*#.#D#N#R#p#######$$ $$8$J$V$b$n$v$~$$$$$$$$$%6%:%F%T%^%j%%%%%%%%%%%&&*&6&B&N&&&&&&&&&' '''&'*'@'J'N'l'~''''''(( ((8(J(V(b(n(v(~((((((((():)>)J)X)b)n)))))))))))**.*:*F*R*ߙ*++2+6+B+P+Z+^+++++++++++,,",.,:,F,Z,^,j,x,,,,,,,--@ߙ-x--֏--. ..".&.L.^.j.v..........///"/&/2/@/J/N/t/////0 0^0b0n0|000000011P 11111112222*2ߙ33`3v3z3333333334444(42464T4f4r4~444444445555&545>5B5h5z5555 p56 u6<6l667772767B7P7Z7^7777777777788"8.8:8F8`8x8888888889$969B9N9^9f9j9r9v9999 p9:$ u:@:p::;; ;6;:;F;T;^;b;;;;;;;;;;;<<&<2<>>>>&>*>P>b>n>z>>>>>>>>>>???,?pߙ???@@@@&@*@P@b@n@z@@@@@@@@@@AAA&A*A6ADANARAxAAAAAAAB BB"BDBVBbBnBzBBBBBBBBBBCCFCJCVCdCnCzCCCCCCCCCDD D(D:DFDRD^DDDDDDDEEEE*E2E:E>ETE^EbEEEEEEEFFFF*FLF^FjFvFFFFFFFFFFGGGNGRG^GlGvGGGGGGGGGHHHH0HBHNHZHfHHHHHHHIII&I2I:IBIFI\IfIjIIIIIIJJJJ&J2JTJfJrJ~JJJJJJJJJJK KKVKZKfKtK~KKKKKKKKKL LLL8LJLVLbLnLLLLLLMMM"M.M:MBMJMNMdMnMrMMMMMNN NN$N.N:N\NnNzNNNNNNNNNNOOOOZO^OjOxOOOOOOOOOOPPPP<PNPZPfPrPPPPPPQQQ"Q.Q:QBQJQNQdQnQrQQQQQRRRR R*R6RXRjRvRRRRRRRRRRSSSSVSZSfStS~SSSSSSSSST TTT8TJTVTbTnT HTUU"U.U<UFUJUpUUUUUUUUUUUVVV&V2VLVVVVVVVVWWWW"W*W.WDWNWRWpWWWWWWWXX XX8XJXVXbXnXvX~XXXXXXXXXY6Y:YFYTY^YjYYYYYYYYYYYZZ*Z6ZBZNZpZZZZZZ[[([:[F[R[^[f[n[r[[[[[[[[[\\\\&\*\P\b\n\z\\\\\\\\\]]]] ]*].]L]^]j]n]z]]]^ ^^^(^2^6^\^n^z^^^^^^^^^^____2_6_B_P_Z_^_______````"`@`R`t`````aaa,a>aJaVabajaravaaaaaaaabbbb b*b.bTbfbrb~bbbbbbbbbcc cc$c.c2cPcbcncccccdddd8dJdVdbdndvd~dddddddddeeee,e6e:e\enezeeeefffffDfVfbfnfzffffffffffgggg*g8gBgFghgzgggggggggghh<hrhvhhhhhhhhhii ii$i.i2iPibiniziiiiiiiiijj$jDjzj~jjjjjjjjkk kkk,k6k:kXkjkvkkkkkkkkklll,lfljlvllllllllllmmm"m&mDmVmbmnmzm Hmn.n2n>nLnVnZnnnnnnnnnnno oo*o6oBo\o Hopp"p.p<pFpJpppppppppppppqqq&q2qLqdq \qߙqqqrrrr8rJrVrbrnrrrrrrrrrs0 Hspsssssssttt&t2t:tBtFt\tftjttttttu.u2u>uLuVubuuuuuuuuuuuvv"v.v:vFv Hvw www(w2w6w\wnwzwwwwwwwwwwxxxx8xTxߙxyy6y:yFyTy^ybyyyyyyyyyyyzz&z2z>zJz^zbzrzzzzzzzz{0ߙ{p{{{{{{{| |2|>|J|V|^|f|j||||||||||} }}"}&}L}^}j}v}}ߙ~~D~^~b~n~|~~~~~~~~~~<NZfrPߙ @R^jv~*8BFl~ߙ \vz(26Tfr~*pߙ,6:`r~ "6:JXbfߙP*6>FJ`jn,>JVbߙ,FJVdnr$6BNZnr@ߙ,>JVbjrv$.2Xjv H Pߙh&2>FNRhrv0ߙp "2@JNt@R^jv~BFR`jv$6BNZ&.6:PZ^|"0:>dv&:>JXbf.T &*@JNl~&2>FNRhrv@R^jv~BFR`jv$6BNZ H*8BFl~ ".H H*8BFl~ ".Hd HJNZhrv (:FR^x <Xt HJNZhrv (:FR^x <X H*.:HRV|&2>Xt H Z^jx 8JVbn0Lh&2>FNRhrv (2>`r~ "bfr"&DVbnz".:FNVZpz~"0:Fhz*d!o0!oP!ofjr"DVx!o"&<FJl~ 2>JV^fj(JNVhrv!o!o!o*.6HRVx!o*6L 4>B`r~ H@z~ ,6:Xjv H "&L^jv(D`|˜´$@\xÔð <Vҏİ H*.:HRV|ŎŚŦŲź&2>XtƐƬ8TpnjǨ(:Jh W~@ȚȤȾ@8Br|ɨ˙ɾ ֏؏2؏B֏fԏ~ʂʎʜʦʪԏʶʺ܏fjv˄ˎ˚˞˼zޏ~֏͂؏͒ԏ͖܏؏ޏ"ԏ*.܏Pbfr~ΆΊΎΪ ξԏ܏ H^ޏhϨϺԏϾޏޏ,:܏`jޏЀЎޏМд؏ޏޏ"&4>BԏNR܏pтцђўѦѪѮ؏ԏfޏtҒޏҘҴ \ \ޏ,NޏTpӖޏӜӼޏ ޏ,6:XjvԂԊԖ؏Ծ؏ޏԏ܏4FJVbjnrՊԏޏ"rx֦֪ޏֲֶޏ$6:ޏBFXbfrޏ׈ךRԏV֏Z؏^ޏf܏ض؏֏ޏ,>BNZfjnنٲ6P ڦ$ھޏҏ <Xۈ۸֏؏B؏R֏bfޏnr܀܊ܚܴ$ >D ޞުP h ߈ ߨ    ( H h  ֏؏؏֏ޏ8JNZfrvz @ `       @ \ n֏r؏؏֏ޏ"&2>FJNzޏ~֏؏܏ԏ֏؏֏ޏ &*ԏ26܏\nr~ޏЏҏ> ֏؏؏֏ޏԏ܏4FJVbjnrԏԏ܏"&ޏ2@JNhz֏؏֏؏֏ޏ ԏ&܏@JR^bnzԏ"֏&؏B֏V؏f֏vzޏԏ܏ &ԏb$f ~ޏ$ޏҏ` ޏ@ ~Pޏޏ.@Jrޏx Pޏ &<F^ޏntޏTޏ8NޏTtޏ ޏ8T vޏޏ"R$Vޏ`rޏ| ޏ&>ޏNTf|$ޏޏ&ޏ,JޏPnޏtޏޏޏޏ"ޏ(FޏLjޏpޏޏޏ &ޏ28Nhrޏ uޏRޏ\|ޏ ޏ *ޏ6<Rlv~ޏޏP rޏ|ޏ ޏ 2HRvޏ ޏ֏ޏ 6PZb~ޏޏ( P h  hޏ"<FNޏ"*FޏV\nޏ֏ޏ,6>ޏޏ&<F ޏ">ޏNTf| ޏ &@JRnޏ~ .ޏ:@Vpzޏ*ޏ6<Rlv~ޏ$$ޏޏ&,>T^rޏ~$$4 d     $  8  l  H  ޏ !o    $ D \ v      H B Fޏ T!o j        ( D d˙  ޏ    " *ޏ @ J R V r ޏ     ޏ     ԏ&*2Џ6܏bޏޏjޏn֏r؏v܏ԏ֏֏ޏԏ܏@RVbnvz~ޏЏҏ.֏J֏j֏z~ޏԏ܏ *ԏ~ԏ܏ޏ&2:>֏^֏~֏ޏԏ܏&ԏ֏֏֏ޏ *.ԏ:>܏\nr~ԏҏP^ :ޏ@`| ޏޏ.4FXbn˙ԏЏ܏nԏr܏~ޏ ޙ  ޙ X ޙx k  ޙ z֏؏ ֏*֏:>JT^n"&2Џ6` kr~Џ ޙ k"Џ&p ޙ ޙ ޙ, k>JR^Џb ޙ kЏ " N ^ b nЏ r   ޙ!!!!!!؏!֏!!!!ޏ!!ޏ!ޏ!!ޏ"2"6"@"`"j""###$#.#^ޏ#b؏#j֏#r#v#z#~#######$$$$$$%%%%%%ޏ%%%%%%%؏&֏&&&$&D&N&V&f&p&&&&''''*؏'Fޏ'J؏'R֏'Z'^'b'f'j''''''(Z(~(((()J)N)R)Z)b)n)zޏ)))))؏)֏** * *,*6*>*N*X*******+؏+Nޏ+R؏+Z֏+b+f+j+n+r+++,,,0,,,,,,------؏-֏---.ޏ.. ޏ..ޏ.ޏ.:.B.^.f.h...//4/>/Vޏ/Z؏/b֏/j/n/r/v/z/~//////00$0001V1Z1^1b1n1z؏1֏1111ޏ11ޏ11ޏ1ޏ111222(222L2222ޏ2؏3֏3 333333J3V3r3v3x333484X4b444555؏5.֏525:5>5Bޏ5F5Jޏ5Nޏ5R5Vޏ5555556Z6b6d666ޏ6؏6֏6666667"7&707P7Z7|8888(82888999؏9.֏929:9>9Bޏ9F9Jޏ9N9Rޏ9Vޏ9z9999999:T:t:~:ޏ:؏:֏::::::::;;;;8;B;d;;<<<<<<<ޏ<<<<<<<؏=֏===$=D=N=V=f=p====>>>>*؏>Fޏ>J؏>R֏>Z>^>b>f>j>>>>>>?Z?~????@j@n@r@z@@ޏ@@@@@@@؏@֏@@AA$A.A6AFAPAAAAAAAB ؏B&ޏB*؏B2֏B:B>BBBFBJBBBBBBC:C^CbCdCCDVDZD^DbDnDz؏D֏DDDDޏDDޏDDޏDޏDDDEEE(E2ELEEEEޏE؏F֏F FFFFFFJFVFrFvFxFFFG8GXGbGGGGHHޏH&H*H.H2H6HB֏HF؏H^H~HHHHHHHI"I2I6I8IXIbIjI~ޏI؏I֏IIIIIIIIJJJ0JJJJJJKvKzK~KKK؏K֏KKKKޏKKޏKKޏKޏKLLL&L(LHLRLlLLLMޏM؏M"֏M*M.M2M6M:M>MjMvMMMMMMNXNxNO OOOO"O.ޏOFOJONOROVOb֏Of؏O~OOOOOOOOPBPRPVPXPxPPPޏP؏P֏PPPPPPQQQ$Q.QPQQQQQRRRRRRR؏R֏RRRRޏRRޏRRޏRޏSS"S>SFSHShSrSSTTT6ޏT:؏TB֏TJTNTRTVTZT^TTTTTTTUUxUUV6V:V>VBVNVZ؏Vn֏VrVzV~VޏVVޏVVޏVޏVVVVVWWW,WWWWޏW؏W֏WWWWWWX*X6XRXVXXXxXXYY8YBYYYYYY؏Z֏ZZZZ"ޏZ&Z*ޏZ.ޏZ2Z6ޏZZZZZZ[j[r[t[[\ޏ\؏\&֏\.\2\6\:\>\B\\\\\] ]]]]]^^^^^^؏^֏^^^_ޏ__ ޏ__ޏ_ޏ_:_B_^_f_h___``4`>`Vޏ`Z؏`b֏`j`n`r`v`z`~``````aa$aaabVbZb^bbbnbz؏b֏bbbbޏbbޏbbޏbޏbbbccc(c2cLccccޏc؏d֏d ddddddJdVdrdvdxddde8eXebeeefff؏f.֏f2f:f>fBޏfFfJޏfNfRޏfVޏfzfffffffgTgtg~gޏg؏g֏gggggggghhhh8hBhdhhiiiiiii؏i֏iiiiޏiiޏiޏiiޏj2j6j@j`jjjjkkk$k.k^ޏkb؏kj֏krkvkzk~kkkkkkkllllllmmmmmm؏m֏mmmmޏmmޏmޏmmޏn2n6n@n`njnnooo$o.o^ޏob؏oj֏orovozo~oooooooppppppqqqqqq؏q֏qqqqޏqqޏqޏqqޏr2r6r@r`rjrrsss$s.s^ޏsb؏sj֏srsvszs~sssssssttttttuuuuuu؏u֏uuuuޏuuޏuޏuuޏv2v6v@v`vjvvwww$w.w^ޏwb؏wj֏wrwvwzw~wwwwwwwxxxxxxyyyyyy؏y֏yyyyޏyyޏyޏyyޏz2z6z@z`zjzz{{{${.{^ޏ{b؏{j֏{r{v{z{~{{{{{{{||||||}}}}}}؏}֏}}}}ޏ}}ޏ}ޏ}}ޏ~2~6~@~`~j~~$.^ޏb؏j֏rvz~؏֏ޏޏv~fޏj؏r֏z~ @Jtޏ&؏:֏BVZ\|8BJ^؏ޏ؏֏V^`268XbVZ^bnz؏֏ޏޏޏޏ *Dޏ"؏*֏26:>BFbfhVZ^bnz؏֏ޏޏޏޏ *Dޏ"؏*֏26:>BFbfhVZ^bnz؏֏ޏޏޏޏ *Dޏ"؏*֏26:>BFbfhJNRZbޏޏޏޏ؏֏"*:D؏"ޏ&؏.֏6:>BF:^bdNRVZfrޏz؏֏4ޏ؏֏"&*bfpBFHhr*.2:Bbޏfjޏnrޏvz~ޏ؏֏ $z؏ޏ؏֏"&bjl>BDdn&2ޏ:؏J֏NVZ^bnrtޏ؏֏NR\|.24T^ԏ֏؏܏  4 >BNXbr ҏNl Џ  Џ( H ^jnЏz  Џ  6BFЏRl  Џ  Џ*D d zЏ  Џ D ZfjЏv  Џ , NR^bЏ  Џ  6:FJЏh  Џ  ".2ЏP p Џ   Џ8 d l   &2>B   ( 26BNZ^bԏ֏؏܏J֏X ` j؏֏ ԏ"܏@L VZfr~ ԏЏ܏ ֏"؏@ bԏfjvzЏ~܏ ֏ ԏЏ ܏, 6֏P rԏvzЏ܏ ֏  ԏЏ"܏*L V֏x ԏЏ܏ ֏ "ԏ&.6Џ:܏Bd n֏ ԏЏ܏ ֏ ؏֏( 0 :؏N؏j֏x ԏ܏ ":ԏZ֏^؏z֏  ؏֏ ԏ ܏(4 >BNZfjnԏ؏ԏ֏ ܏   $ .2@ NV`rz p    "0 >FPbj ԏ֏܏؏*֏8 N֏^bjn ҏ.ҏFLj֏z ~‚ˆ’–ž¢¦¸  &.26JNbfnrÆÌÚÞä!o!o֏"&0:< JT Wjt WĊĔ WĪĴ W W W  W*4 WJT Wjt WŊŔ WŪŴ W W W  W*4 WJT Wjt WƊƔ Wƪƴ W W W  W*4 WJT Wjt WNJǔ WǪǴ W W W  W*4 WJT Wjt WȊȔ WȰ W֏֏4 DP!brɐɬ ɼ!Џ ֏:֏H ^֏nrz~ʌʖʚ    6<Vd̀ ̤ $ 8Dlz͈͒͘͸ *8BH`lΜ   4 HV\ntϔϰ $6<NTfl~ЄОФжм  BҏR֏ъ ђ ҏ"֏Z bҎҔҦҬҏBH`lӜӪӸ  2ҏ:ҏ>HZ`rxԊԐԢԨԺҏҏҏ"ҏ&0BHZ`rxՊՐժհ$"$*0B֏J֏NXjpւֈֲ֚֠֏֏ 2֏BNTf֏vׂ׈ך֏ת׶׼֏"(:@RXjҏؤ &֏֏$6֏>֏BL^dv|َ֏ٖ֏ٚ٤ٶ֏پ֏֏֏ ֏&֏*4F֏N֏R\ntچ֏ڎ֏ڒڜڮ֏ڶ֏ں֏֏.֏6֏:DV֏^֏bl~֏ۆ֏ۊ۔ۦ۬۾֏֏֏֏",>֏F֏JTf֏n֏r|܎ܔܦ֏ܮ֏ܼܲ֏֏֏֏ ֏&֏*4F֏N֏R\n֏v֏z݄ݖ֏ݞ֏ݢݬݾ֏֏֏֏",>֏F֏JTf֏n֏r|ގ֏ޖ֏ޚޤ޶޼֏֏֏֏$6<NTf֏n֏r|ߎ֏ߖ֏ߚߤ߶֏߾֏֏֏֏֏.֏6֏:DV֏^֏bl~֏֏֏֏֏֏֏֏ $6֏>֏BL^֏f֏jt֏֏֏֏֏֏֏"֏*֏.8J֏R֏V`r֏z֏~֏֏֏֏֏ ֏֏ 28J֏R֏V`r֏z֏~֏֏֏֏֏ ֏*֏2֏6@R֏Z֏^hz֏֏֏֏֏֏֏֏֏"֏&0B֏J֏NXj֏r֏v֏֏֏֏֏֏(:֏B֏FPb֏j֏nx֏֏֏֏ҏҏ֏ ֏*֏2֏6@R֏Z֏^hz֏֏֏֏֏֏ ֏֏ 28J֏R֏V`r֏z֏~֏֏֏֏֏ ֏*֏2֏6@R֏Z֏^hz֏֏֏֏֏֏ ֏֏ 2֏:֏>HZ֏b֏fp֏֏֏֏֏֏֏ ֏&֏*4F֏N֏R\nt֏֏֏֏֏֏.4F֏N֏R\n֏v֏z֏֏ $6<NTfl~֏֏֏֏֏֏ &֏.֏2<N֏V֏Zdv֏~֏֏֏֏֏֏֏֏$6<N֏V֏Zdv֏~֏֏֏֏֏֏֏֏֏",>֏F֏JTf֏n֏r|֏֏֏֏֏֏֏֏.֏6֏:DV֏^֏bl~֏֏֏֏֏֏֏֏"֏&0B֏J֏NXj֏r֏v֏֏֏֏֏֏ ֏֏ 2֏:֏>HZ֏b֏fp֏֏֏֏֏֏֏֏"֏*֏.8J֏R֏V`r֏z֏~֏֏֏֏֏ ֏֏ 2֏:֏>HZ֏b֏fp֏֏֏֏֏֏֏֏"֏&0B֏J֏NXj֏r֏v֏֏֏֏֏֏ ֏֏ 2֏:֏>HZ`r֏z֏~֏֏֏֏֏ ֏*֏2֏6@R֏Z֏^hz֏֏֏֏֏֏ "֏*֏.8J֏R֏V`r֏z֏~֏֏֏֏֏֏*֏2֏6@R֏Z֏^hz֏֏֏֏֏֏ ֏֏ 2֏:֏>HZ֏b֏fp֏֏֏֏֏֏֏֏(:@RXj֏r֏v֏֏֏֏֏֏"(:ҏN֏V\nҏ֏֏֏֏֏"֏&0BHZ`rx֏֏֏֏֏֏֏ ֏*֏2֏6@RXjp֏֏֏֏֏֏֏֏(:@R֏Z֏^hz֏֏֏֏֏֏ "(:֏B֏FPb֏j֏nx֏֏֏֏֏֏֏ ֏*֏2֏6@R֏Z֏^hz֏֏֏֏֏֏ "(:@RXj֏r֏v֏֏֏֏֏֏ ֏֏ 2֏:֏>HZ֏b֏fp֏֏֏֏֏֏֏֏(:֏B֏FPb֏j֏nxҏ֏ҏ֏֏֏ҏ*֏28J֏R֏V`r֏z֏~֏֏֏֏֏ ֏*0BHZ֏b֏fp(֏֏.֏6֏:DV\n֏v֏z֏֏֏֏ ֏ ֏   2֏ :֏ > H Z ` r֏ z֏ ~  ֏ ֏   ֏ ֏     ֏ ֏   *֏ 2֏ 6 @ R X j֏ r֏ v  ֏ ֏   ֏ ֏   ֏ ֏     "֏ *֏ . 8 J֏ R֏ V ` r֏ z֏ ~  ֏ ֏   ֏     ֏ ֏   "֏ *֏ . 8 J P b֏ j֏ n x ҏ ҏ     ֏ ֏   ֏ ֏   ֏ "֏ & 0 B H Z֏ b֏ f p ֏ ֏   ֏   ֏  !&*Џ2P ^dv|$.4FL^dv !Џ  (:@V֏^֏ W*,."ҏ&֏:ҏJ֏Zҏbf0r2  " &.8F\l z6 $@ P\!r~Џ ҏҏ֏֏֏֏.ҏ>֏Z֏h ~֏ "H T pՙ~Џ ʙ  DP Z^jnz  ( 8@ЙT ʙf  "&26@dnp  !!ݙ *B4>D@XRDZ HD  D 6@n֏֏֏֏"# 8 LDbnr "# D"&H Xjҏz֏֏֏ҏD֏֏֏֏֏"֏0BҏF֏N\x  4 DP!frvЏ~  !*6:ЏB` ~ҏ !Џ  $  0  J P     ! ҏ!ҏ!ҏ!4!P !`!l!! !!" "( "8"D"x" """# ## #T#p #### #$$$ $.P$8$P$l $v֏$$$֏$$ $֏%%֏%%\%x %֏%%% %֏%%֏& &*&<!&R&^&bЏ&j& &&֏&' '֏'$'@'J֏'l'v֏''''֏''֏'( (֏( (*֏(4(>֏(P(Z֏(d(n֏((֏(֏(֏(֏) )")4!)J)V)ZЏ)b) ))֏**֏**&֏*0*:֏*D*N֏*X*b֏** *$++ +֏+8+B֏+T+^֏++ +֏+++֏++֏, u,*֏,4 u,>֏,H,R֏,l,v֏,,֏,֏, ,,!,,-Џ- -( -6֏-B֏-L-V֏-p u-z֏- u-֏--֏--֏..֏.D.N֏.. .$...֏/$/.֏/@/J֏/֏/ //!/00 Џ000 0v֏0 00!000Џ01 111֏2@ u2J֏2^֏2 22!222Џ22 3<3F֏3P3f֏3p3z֏33֏33֏33֏33֏33֏4 4֏4 4*֏4D4N֏4X4n֏4x4֏44֏444֏5@5J֏5|5֏55֏55֏686B֏6`6| 6֏666֏7 7*֏7N֏7x 77!777Џ77 8,86֏88 8֏88 u8T99֏9$9@ 9J֏9T99֏99֏:: ֏:4:>֏:l:v֏::֏;; ;&֏;0;D;N֏;h;r֏;;֏;;֏;;֏<<֏<ҏ >( >8>P>l >|>> >>> ???8 ?H?`?| ??? ??@ @@,@H @X@p@ @@@@@@A A A8AT AdA|A AVAAAXAAAB BZB$B<BX BhBB BBB BCC(C6CDC\Cx CCCC CDD4DP D`DlDD DDE EE$EVEEE EEFF$ F4FBFLFVFZFFFFF FGGLG\ GG GGH HH HxH HH HII, I<ILII IIIJ J$J0JdJ JJJJ JKK2K8KXKt KKKKKKL L L,LTLbLpLL LLLLMM M< MPM\MMMMM MMN$ߙN@ߙN\ߙNNNNNNNNO OO"O(ODOT \OOOO OO!OPP ЏPP0 P>PDPVP\PrҏP֏PPPPPPPPPPP QQQ Q"Q0QDQ` QtQ!QQQЏQQ QQQQRҏR"֏RBRNRRRZR^RlRvRzRRR RRRRRR SSSS8 SHSVSrS~SЏSS SSSS֏SSSTT$ T4T@!TVTbTfЏTnT T֏TTTTTTU U U,!UBUNURЏUZUx U֏UUUUUUU VV!V&V2V6ЏV>V\ Vj֏VrV|VV֏VVVV VV!WWWЏW&WD WR֏WZWdWpWWWW WW!WWXЏX X( X6֏X>XHXTXnXtXX XX!XXXЏXY Y֏Y"Y,Y8YJYXYlY YY!YYYЏYY Y֏ZZZZ.Z<ZPZl Z|Z!ZZZЏZZ Z֏ZZ[[[ [4[P [`[l![[[Џ[[ [֏[[[[\\\4 \D\P!\f\r\vЏ\~\ \֏\\\\\\] ](]4!]J]V]ZЏ]b] ]֏]]]]]]] ^ ^!^.^:^>Џ^F^d ^r֏^z^^^^^^ ^^!___"Џ_*_H _V֏_^_h_t____ __!_``Џ``, `:֏`B`L`X`j`x`` ``!```Џ`a aa$a6aBa\aha Waaab bb !b:bFbJЏbRbp bbbbbbb֏bcc cc c*c.c6֏cLcX cbcfcrcc cc dd d"d,d dddҏd dd!ddeeeЏe4 eBbe~eeҏeee e fԏf܏ff؏f֏f f f؏g g*dg8gN֏gX!oglg WgNgҏg!ogXgNggghhhԏh"h&܏hDhP hZh^hjhvhhhhҏhhhiii i8iTihiiiiijjj0jHjXjn֏jx!ojj WjNj!ojXkNkhk>jkBlk^؏kn֏k| kkkkkkkԏkk܏kkk ll ll"l*l.l2lJl`ljll l!=lЏljlllhm ֏m m"؏m< mD mNmRm^mhmrmvԏmm܏mm mmmmmmmmԏnZrn` njnnnnnnnnn nnnnnnnrooo$o.o2ԏo:o>oB܏oFoxoo oooooooo!әp pp"p$ p2p>pVphpvppp ppp؏p֏p p pq q qԏq"܏q&qDqNqP qZqfqjqvqqԏr.ԏr2֏r6؏rB܏rNrrrrrrԏrr܏rr sssss"s*sBvsH sT s`֙szs~sss ssssssԏss܏tt ttt.vt4 t@ tL֙tl tt t~؏t t؏u ԏu֏u؏u܏u&uZ֏uh u~֏uuuuuuuuu uuvvvv"v*vBvLv^Џvbvv֏v֏v v֏vvvvvvvww$ w.w2w>wJwRwVwZw w wwwwwx x֏x6֏xD xZ֏xjxnxvxzxxxxxx xxxxxxy( y4 yX fyyyyЏyyy y֏y˙zzzzЏz&z*zD zN֏zfzpz zz֏z֏z z֏zzz{{{{&{D{P {Z{^{j{v{~{{{ { {|| f|D|` |t }ԏ}"֏}&؏}*}2܏} }؏}}}}}}ԏ}}܏~~ ~~~*~6~>~B~F~b~j ~nԏ~~~~~~ԏԏ\hԏԏ؏ ؏6:FPZ^ԏjn܏ ԏ\ h  ؏ԏ܏ ".2>FJNfԏ|   Џ܏ 6HV܏h x܏ $ :Xh rЏԏ܏ ܏ $NXf܏x    JԏN֏fr؏v܏֏  ֏  &*6T` jnzҏ(< LX!nvzЏ ҏ 0 @L!bjnz~Џ   !"&26ЏX fҏz ( 8D!fjnz~Џ   !.26BFЏd rz !Џ$ 2:>HV`t !Џ  2JTp !Џ Jv !"ЏD RZdr| !Џ $2<X ht!Џ  (4!JRVbfЏ  ! "&ЏH ^dr| !Џ ֏:@NXt !Џ Vv !Џ .֏J֏X ` ֏  *.2^֏z֏  ֏ ( 26BNZ^ԏ؏Z֏^b܏֏ ؏֏.@JT^ht~ҏҏ8 \Tz܏ ֏؏֏ ؏"֏26>BPZ^n܏ T ` n x \&0:DXblz,@Zҏ \ \ҏNXh \:ҏjt \*4BL`l \ \ *4D \Thrҏ \ \ .4@`l \ & \ \ \&0:D` \~ \" Xz ( \B x "@`jҏ \֏ \  \2<J֏`p~ \ \֏FPd  ,^hx \ \ \ҏ >HR\l \ \ \2<JP^dt \< \LZҏjt \4H\l \ \$ W,:>FJXbf  Hd \x (<JPZdrx W H,8p \ \ W \>R (HR\fp \ߙ$ߙLߙߙߙߙ $4 \DXd \ \P$ W8 \` \v Wߙ \(L`ߙߙ \ W0P^l|ߙߙ(6DNXhߙߙߙ \LlߙߙH\l \ \*8HR\fpz,6@JT^h|ˆº, W>L W`ߙxÎ èö W Wߙ " LV`p \ĈĒĜĨĺ  4@\ߙ|ߙŨߙ \( \>P WƐ H \.< WV` WjxDŽǒǤǶǼ&,8FXft WȆȔ Wȼ \ \ \$ߙ8ߙTߙ|ɔɢɨɲɼ0 Hʌʚʠʰʾ$.8LZ`p~˄ˎ˘ˬ˺  0>DNXlz̸̞̤̮̀̐,:@P^dnx͚͌ͪ͠ʹ&,<JPZdvΔΨ \ \ < \ftτϔߙϨߙϼߙ \(:PV`pЀЊДФд 4V`tъѐѨѲѼ ܏4@ JNZfrvzҖҠҮҸ  BԏF֏Ӓ؏ӢӾ܏ ؏֏ DT fЏj~ԆԚҏ֏؏ ؏֏&*6@JNԏZ^܏|Ո ՒՖբծպվԏP \ vԏ~Џֆ֊܏֤ ֺ־ ".>BZ֏^؏׈ ג؏ע֏׶ԏ܏ *6Jԏ` l ؔ ضؾٖҏٴ  !| ڎڒ؏֏ *.:DNRԏ^b܏ۀی ۖۚۦ۲ۺ۾֏؏֏   ( 8!yJNl~Џ܌!ܞܢܮҏܾܲܶ@ ݀ݜ!ݺ!~ 4L ~ԏނ܏ޒި ܏ ԏ< H˙Zԏ^܏zߌ ߪ߶ @T fjЏ~ \ \Xp \ 0:>Xd nvҏ \ \( WJҏbf| ԏ܏0< FJVbnrv  "֏&؏6NԏR܏  ؏ ԏ*.܏LX bfr~NԏЏ܏, :؏\ d n؏ ԏ܏  &.2Jԏ؏  ؏ ԏ*.܏LX bfr~ԏRԏV֏Z؏^f܏  ؏  "ԏ.2܏P\ fjvԏ܏ $@NXfԏj܏| ԏ܏ 8FP^ԏb܏t ԏ܏ ҏԏ܏ ҏԏ܏ ҏxԏ܏ ԏ܏$ 4Xfp~ԏ܏ ԏ܏ 8FP^ԏb܏t ԏ܏ P^ҏ|ҏԏ܏ $2<JԏN܏` pԏ܏  ҏ6pzҏҏԏ܏, <Zҏbҏҏ&DZdrԏv܏ ҏԏ܏ ,\h  LZdrԏv܏ ԏ܏  4DR\jԏn܏ ԏ܏ <LZdrԏv܏ ԏ܏ DTblzԏ~܏  \*4BԏF܏X hx   &BFJNRp ҏ",:ԏ>܏P `jҏzҏԏ܏ (2ҏbҏԏ܏ $4BLZԏ^܏p ԏ܏  .8FԏJ܏\ lԏ܏  .ԏ2܏D T^ҏԏ܏ @dԏ܏ 8`nxԏ܏ ԏ܏  *ҏXfp~ԏ܏ ԏ܏, <Xԏ܏ .8FԏJ܏\ lԏ܏    ^ h vԏ z܏      ԏ ܏   , H ~  ԏ ܏     L Z d rԏ v܏     0 > H Vԏ Z܏ l  | !    $ 2ԏ 6܏ H  X     ԏ ܏  *ԏ.܏@ Pxԏ܏ ԏ܏( 8`p~ԏ܏  ԏ܏ 0Xfp~ԏ܏ ԏ܏ "6pԏ܏ 60LZdrԏv܏ 6 $2ԏ6܏H Xb6ԏ܏ 6Tblzԏ~܏ 6ԏ"܏4 DN6ԏ܏ 6@NXfԏj܏| ԏ܏ 6l6,p~6,BLZԏ^܏p (6@NԏR܏d t",:ԏ>܏P ` "ԏ&܏8 Hxԏ܏  6DR\jԏn܏  ԏ܏0 @\ԏ܏ (6ԏ:܏L \ԏ܏    ԏ "܏ 4  D l z  ԏ ܏     !!ԏ!܏!, !<!d!r!|!ԏ!܏! !!ҏ!"""("6ԏ":܏"L "\"""""ԏ"܏" "##$#2ԏ#6܏#H #X#|####ԏ#܏# #$ $$$$2ԏ$6܏$H $X$|$$$$ԏ$܏$ $%%&%F%P%^ԏ%b܏%t %%%%%ԏ%܏% %&$&2&<&Jԏ&N܏&` &p&&&&&ԏ&܏' ''4'B'L'Zԏ'^܏'p ''ҏ''''(ԏ(܏( (((2(Zҏ(bҏ(((((ԏ(܏( )) ҏ)4)\)j)t)ԏ)܏) )))ҏ)ҏ* *4*B*L*Zԏ*^܏*p *****ԏ*܏* **+"ҏ+D+R+++ԏ+܏+ +++,2,<,Jԏ,N܏,` ,p,,,,ԏ,܏, ,- --$-2ԏ-6܏-H -X----ԏ-܏- --.. .ԏ.܏.0 .@.h.v..ԏ.܏. ..../ԏ/܏/ /(/P/^/h/vԏ/z܏/ /////ԏ/܏0 0080F0P0^ԏ0b܏0t 000001ԏ1 ܏1 1,1:ҏ1Vҏ1ҏ1ҏ11112ԏ2܏2 2"02,2>2T2b2l2zԏ2~܏2 222222ԏ2܏3 33&3<3J3T3bԏ3f܏3x 333333ԏ3܏3 34ҏ4444J4`4n4x4ԏ4܏4 444444ԏ4܏5 5 525H5V5`5nԏ5r܏5 55ҏ5555666ԏ6"܏64 6D6Nҏ6b6|66666ԏ6܏6 66ҏ77,7B7X7f7p7~ԏ7܏7 777777ԏ7܏8 88.8@8N8X8fԏ8j܏8| 88؏8888 8 9؏9( 929B9H9R9Vԏ9b9f܏99 99999999ԏ:6؏:X :` :j؏: ::::::ԏ::܏:: ;; ;;";*;.;Fԏ=J=V=b=f====>>>J֏>N؏>j֏>x >؏>֏>>>>>>>>? ???"?.?:?>?B?? ? ?@@ @0 @@@\ @l@x W@@@@ W@@AA$ WA2ALAXAx WAAAA WAABB WB.BHBTBt WBBBB WBBBC WC*CDCPCp WCCCCCD D DjԏDn֏Dr؏DvD܏DDDDDDԏEE܏E$E0 E:E>EJENEZEbEx E؏EEEEEEԏEE܏FF FF"F.F2F>FFF^ԏFFFFF FFFFFFԏFF܏G G, G6G:GNԏG G G؏G G؏GGGGG HH HH H*H.ԏH:H>܏H\Hh HrHvH H H؏H H؏IԏI֏Iz؏I~I܏I֏I I؏I֏IIJJJJJ"J.JLJX JbJfJrJ~JJJJJJJK KK&K0KBKLK^KhK~KKKKKKKKKLLL&L,LjLzLLLLLLL MMMM"MnM~MMMMMMMMM NN N>NPNNNNNNNNNNO O OObOjOnOzOOOOO OOOOP ҏPzPPPPPPPPPPQ QQQ*Q2Q^QfQjQvQQQQQQ QQQQRR R*RRRRRRRRRRR S SSS"S2S<SFSJSNSRSlSvSx SSSҏSTTT2THTjTpTTTTTU UbUzUUUUUUUVV*VvVWWW6WWX*X0XpXYZYfYrYvY~YYYYZZ$ Z8ZZZ֏Z؏Z֏Z Z؏[ ֏[[[&[*[8[B[R[l[x [[[[[[\0 \< \V֏\Z؏\v֏\ \؏\֏\\\\\\\]] ]]]&]2]:]>]h ]t ]]]]]]]]]]^^^^^<^H ^R^V^~^^^^^^^^^ ^^__ __$_._2_:_P_\ _f_r_~____```` `f`j`t```` ` \``aaa$a.aHaRaT anataaaa aa ab,b>bPbZb\ bnbrb~bbbbbcc$ c8ccccccc d*d.d8dJd\dfdh d \dddddde ee e2e8eJe\efeh ee eeffff f6f@fRf\fnfxffffffffffg g gg"g*g>gDgfgjgrgggggg ggggggh hh"h&h.hHhT h^hjhvh~hhhhhhhhh hi iii:i>iJiXibifinii iiiiiij jjj(j2j6j>j\jh jrj~jjjjjjjjjjkk kk"k.k6kbklk~kkkkkkkkkl llll,l6l:lFl\lh lrlvllllllllllmm$ m.m2mJmNmVmZmlmvmzmmm mmmmm n nn@nL n`n| nnnnnnn noo0o< oPol o|ooooooop&p.p2p6p:pTp^p` pjpnpppppppppqq*q8qJqTqfqpqqqqqqqqqqq qrr.r8rJrTrfrprrrrrrrrrrrss ss(s4 s>sJsVs^sns ssssstt t t*t, t6tBtNtVtftpttttttttttuu u u*u, u6uBuNuVuuuuuuuuuuvvv v.v:vRvVvbvlvzv~vvv vvvvvvvvw ww w&w2wFwLwjwxwwwwwwwwwxxxx&x4x>xBxJxNxhxt x~xxxxxxxxyyyy.y8yJyTyfypyyyyyyyyyy yyzz z*z:zHzZzdzvzzzzzzzzzz zzzz{{{.{8{J{N{Z{h{r{v{~{{{ {{{{{{||(|^|b|n|||||||| ||||}} }}(}:}D}V}`}r}|}}}}}}}~~~~.~8~J~T~f~j~v~~~~~~~ ~~~~&4FPbl~ $0 :FRZjx *6BJZhz &2:Pbp &:@\t >L^hz , 6BNVft  .<N^hz$ u.>D!oX ubfz  *8FTfjnrv 6:BHZbx  ,>H^lz~  Z^fl~ ",>HZdv &*.2:JRV\nv  *2HRT bfz (26P\ fj",>L^hz$ .2\r (26Bdnp z~ 2@V`r| &2:>^bjn| "&4>BNpz|  2<Z`rv~ *.6:LVZf ( 2>JRbl &*:BLZpz|   "0>T^` n~  *:V\ҏ  "*:H^dvz "6BN\nx (26T` jv*4FJRdnr~ ,6:B\h rv *6>^d  *8BFNht ~$0 :>JV^b 2<NXnx "&8BFNht ~$ .2bnz  "&2>FJfp JVjv  "*>BJN\fjv ".PZ\ fjv &0BHbl~ 28V\nx,6:Fdp z~"$ .2>JRVvz  .2>LVZf   zԏ~֏؏܏ ؏֏ $.2ԏ>B܏`l vz.ҏD`xҏҏ,D`~ҏҏҏԏ܏ ҏVZ^bfjrv @X0H`rҏҏ,6Th u|8vz \tҏҏ\t4rҏҏ>BFJNR^bjڙҏ>֏B؏h r؏֏ԏ܏ "&*Bԏ  ֏؏ ؏֏.2>HRVԏbf܏ ԏ  8Ph„œ¼*DNP vÀÒìöø $ .:FNĆ &vzŀŒŤŮŰ  \*0:T^` jƀƒƤƮư ƾԏ܏  VXj|džLj ԏ܏ "VZflvzȂȘȢȤ ȮȲȾ *.:FVXf|ɆɈ ɖɚɦɲ &Z^jpz~ʆʜʦʨ ʲʶ .2>JZ\jˀˊˌ ˚˞˪˶  *.:HRVp| ̞̦̆̒ *BL^t~̀ ͊ͨͺ ,68 B\xΐΨ 8P^ҏzςτϖϰϺϼ  $<TlЄМЮво &.H`xѐѢѦѲ "<Tfjv҄ҎҒҰҼ 0BFR`jnӐӜ ӦӲӾ , 6BNV|ԔԬ $6:BT^bՀՌ Ֆ՚՞,6:Xd nrv֎֒֞֬ ".<FJht ~ׂ׆ר 26>PZ^|؈ ؚؒؖ (26T` jnrيَٚ٨ *8BFdp z~ڂښڨڲԏڶ܏  0>ԏB܏T dۀێۜۦԏ۪܏  $2ԏ6܏H Xt܂ܐܚԏܞ܏ܴ  &ԏ*܏< Lh݈ݼ (24 >BFlބޜ޴ $<Tl߄ߜߴ  "&*Xp  26BLVZ ҏҏ&*.>FLZ &( 6:Ph(P^ҏjnvz~  *68Flvx 0H`x&*6DNRp| ԏ܏  &4BXbd v &<FH Zf 0H`|(:>JXbf 4Ld| 4Xp 4FJVdnr  >ҏNR^lvz  8Pl*.:HRVt  $<Tl~ 0HZ^jx  $6:FT^b 0BFR`jn  (:>JT^b  $<Tl 0H`rv (@X|!o u*ҏ@Pjxԏ܏  $<Tfjv  8Pl *26:Vҏx $<Tl ">ҏ`x 8D NRVvҏ<H RVZzҏ<T,D\t &ҏH`x 4@ JNRrҏ 8Ph ҏ4Xpz~  &ҏ@Xx  ( @ R V b l v z          ҏ   " , 6 : d n p  z ~      ҏ       ( 2 4  > B N Z b f j ҏ      $ < N R ^ l v z           * 8 B F p z |        &*T^` jnr8D NRV~ .6ԏ>܏T  ".6FNԏV܏l  .DNP ^bnv $.0 >BRVbpz~ ԏ܏ JNZhrv  0fҏvz (:>JXbf "&*.2:FV^v  4@ JVbj|  8Ph  "*:>JT^b "&.@JNht ~,D\t  &ҏ>BNXvz ҏ *.HT ^jv~ &6:FPnr ҏ    & * H T  ^ j v ~ ҏ      !!!!0!< !F!J!V!b!j!n!r!!!!"""4"L"h"r"v"""""" """##8#Z#^#f#x#### #####$$$$"$@$L $V$Z$^$$$$$$$$ $$$%4%x%%%%%%%&& &&"&.&:&B&F&J&f&j&v&&&&& &&&&&''','D'V'Z'f't'~''' ''''(($(<(N(R(^(h(r(v((( ((((((()))))&)*)T)^)` )j)n)z)))))ҏ))***0*H*`*x*****++++(+2+6+\+h +r+v++++++++,, ,8,J,N,Z,d,n,r,,, ,,,,,,,,----"-&-P-Z-\ -f-j-v--------..(.H.`.x...../ ///$/./2/\/f/h /r/v///////////0 0*0, 060:0F0R0Z0^0b000000011 1181B1D 1N1R1^1j1r1v1z111112 222<2H 2R2^2j2r2222222233$30 3:3F3R3Z3t33ԏ3܏3 33ԏ3܏4 4( 44 4ԏ4֏45܏5 ؏5B֏5P 5X 5z֏5 5555555555 56666&6*626Rҏ6n6v666666 \6677"7*7.7@7J7V7Z7^7|7 77777888"8&8.828D8N8Z8^8b88 88888֏8֏8 8 9֏9 9.969:9@9l9v9x 99999: $:S:":&:.:2:H:R:\:x :::$:::: ::;$;;(;<;X ;b;l;v$;;;;;;;;< <<(<2֏( >0 >:؏>` >j>n>z>>>ԏ>>܏>> >>>>>?? ?*ҏ?:?\??? \????@@@@8@D @N@Z@rҏ@ҏ@@@@@@@AA A0A< AFARA^Aj؏AnA A A؏A AAAAԏB܏BB&B( B2B>BBBNBZBnԏB$BSBBBBCCԏC܏C$ C4CHCRҏCCCCCCԏC܏C CDDD*ԏD.܏D@ DTD`!DrDzԏD~DDЏD܏DD D؏D D D؏E E&E*E6E@EJENԏEZE^܏E|E EEEEEEEEԏFFJԏFN֏F~F܏F؏F֏F F F֏G GGGG"G0G:G>GJGhGt G~GGGGGGGҏGGHHH8HBHP \HfHxHHHHHHHHHHI IIIRIZIxIIIIIIIIIIIIJ JJJ*J2J6֏JV֏Jd Jl J֏J JJJJJJJ JK KKK&K$KSKKKKKKKK LL LLL"L&LPLdL LLLLLLLLM MMM"M*M.M2MXMlM MMMMMMMMN NN N*N2N6N:N`NtN NNN֏N֏N N O֏O OOO&O*O8OBOROlOx OOOOOOOPJԏPN֏PR؏PVP^܏P P P؏P PPPQQQԏQQ"܏Q@QL QVQZQfQrQ~QQQҏQQRRR \RDRfRjRvRRRRR RRRҏS ҏS8SHSZS^SfSxSSSS SSSS؏ST T T"؏TH TVTbTdTrԏT~܏TTT TTTTTTԏU6$UDSURUbUhUrU|UԏU܏U UUUUUVV VԏV܏V0 V@VZVlVVVVVԏV܏V VVW W&W4WBWLWZԏW^܏Wp WWWWWԏW܏W WXX&X0X>ԏXB܏XT XdXXXXԏX܏X XXYYYԏY"܏Y4 YDYhYvYYԏY܏Y YYYYԏY܏Y Z Z<ZXZd ZrZ|ZԏZ܏Z ZZZZԏZ܏Z [[8[T[` [n[x[ԏ[܏[ [[[[ԏ[܏[ \\4\P\\ \j\t\ԏ\܏\ \\\]]]]&ԏ]*܏]< ]L]Vҏ]]]]]^ ԏ^܏^ ^0^X^t^^^^ԏ^܏^ ^_ _$_2_<_Jԏ_N܏_` _p_____ԏ_܏_ _``(`6`@`Nԏ`R܏`d `t`````ԏ`܏` `aa,a:aDaRԏaV܏ah axaaaaaԏa܏a abb@bNbXbfԏbj܏b| bbbbbbԏb܏c cc8cPc^chcvԏcz܏c ccccccԏc܏d dd8dPd^dhdvԏdz܏d ddddddԏd܏e ee8ePe^ehevԏez܏e eeeeeeԏe܏f ff8fPf^fhfvԏfz܏f ffffffԏf܏g gg<gTgbglgzԏg~܏g ggggggԏh܏h h$h@hXhfhph~ԏh܏h hhhhhhԏi܏i i$i@iXifipi~ԏi܏i iiҏiiijԏj܏j j(jLjZjdjrԏjv܏j jjjjjԏj܏j kk,k:kDkRԏkV܏kh kxk؏k k k؏k kkklllԏll"܏l@lL lVlZlflrlzl~llԏllm*ԏm.֏m^mf܏mj؏m֏m m m֏m mmmnnnnn*nHnT n^nbnnnznnnnҏnnnnnoo&o4 \oJo\o~oooooooooo oop6p>p\pfppppppppppppp pqqqq֏q:֏qH qP qr֏q qqqqqqq qqqqr rj$rxSrrrrrrrr rrr֏s֏s s$ sF֏sT s^sbsjsns|ssss ssssssstԏt֏t؏tt܏t t u؏u( u2u6uBuLuVuZԏufuj܏uu uuuuuuuuҏvv$vPvZvh \vvvvvvvww ww"w:ҏwRҏwwwwwwwwwx x xx"x.؏x2xX x` xj؏x xxxxԏx܏xxx xyyyyy2ԏy~$ySyyyyyyԏy܏y yzz(z<zJԏzN܏z` zpzzzzԏz܏z zz{{${2ԏ{6܏{H {X{r{{{ԏ{܏{ {{{| |ԏ|܏|0 |@|V|\|p|~ԏ|܏| ||||ԏ|܏} }}8}L}Zԏ}^܏}p }}}}ԏ}܏} }~~~4~b~p~~ԏ~܏~ ~~~  .ԏ2܏D Txԏ܏ &ԏ*܏< Ltԏ܏ ԏ ܏ ,DT \ԏ܏  <lԏ܏ 0>ԏB܏T dԏ܏  @|ԏ܏ $Thvԏz܏ ԏ"܏4 Dtԏ܏  DXfԏj܏| ԏ܏ (Xlzԏ~܏ ԏ܏ (<JԏN܏` pԏ܏ "ԏ&܏8 Hpԏ܏ ؏  ؏ *.:DNRԏ^b܏ ԏ.2nԏr֏؏܏֏  ֏&*ҏ~0 0>R֏| ֏ *6:>  8D NR^jvz~  &֏*؏:܏>Nԏ    "ԏ*.LX fjnrv ԏ  @ H t ԏ *ԏԏ֏؏܏$ , 6؏\ jrvԏ܏  $2ҏ\p~܏ԏ ؏  ؏< JRV`nvԏz܏~ ԏz֏~ԏ؏܏֏  ֏$ BFJR`nv  *4P \j֏  ֏ $0 >BFJNbԏ֏"܏&؏^֏l t ֏  &2>BJjz 4Hd t  0 ":RjҏP 0:n֏֏   ֏ "&.2@JNZx ԏ֏؏܏ ؏&*6@JNԏZ^܏|  R؏x ؏ԏ܏  &26:Rԏ  ԏ܏ 4 Hh \ 8Xx(LpP<Jh$ 0 ԏ֏؏܏ "؏BJNXfjԏnr܏ ؏ ؏",:>ԏBF܏ht ~ԏ ( FLZ܏bԏp   >ԏB֏؏܏֏ ֏ *6T` jnz!o֏֏ &֏6:BFT^n @ L  \!yЏ  ֏*֏8 N֏^bjn|  $ H!FF! "D N֏p!~֏֏ ֏,8 BFR^fjn   ֏( 4 ԏ֏܏؏8 @ J؏p ԏ܏ "&*6Bҏ   ,BLZ܏bԏp |؏  ؏  "ԏ&܏*HT ^bfjvԏRԏV֏؏܏$ .؏>֏NRZ^lv  $ W6:  &*.6:BFҏ`֏؏֏ ؏֏"*.<FVp| †Š–¢ª®²8 D ^֏b؏~֏Ì Ö؏æ֏öú ".:BFJt Ā Ě֏Ğ؏ĺ֏ ؏֏*DP Z^jv~łņŰ ż 0~ƆƊƐƞƴƾ 0`| W֏֏:>FJXf|ȆȈ ȺȾ "*0>T^` jnɒɖɞɤɲ ʜڙʸߙ0ߙlߙ˄ߙ˜˲˸*>ҏNRZ^ΎΒ֏Ϊήκξ z֏ϊ֏֏֏"0>BXbd Ѫ֏Ѻ$Ү:BFJRb֏rv~ӄӒӨӲӴ  "&26ԮԴ֏ "$ 2`rՀՊՌ բզժհ 26>DRhrt ֆ֊ּ֦֒֘ (Fx׈פ ״$.0 :>Blؚؖبضغ  4>@ JNnrzـَْ٨ٲٴ پ.8V\ڌ \ڰ  "2<Nz~یۚ۞۴۾ "$ .2VZbhvzܐܚܜ ܦܪܮ2<V`ݔ \ݴ  ֏NR֏jnz~ކތޚޞ޴޾ (24 RV^drvߌߖߘ ߢߦ ":> ߙPߙpߙߙ , ԏ֏؏܏P Z؏j֏ $.2ԏ>B܏`l vzҏ"&26P:Fҏԏ܏ ҏҏ֏؏ ؏֏&*ԏ6:܏Xd nr~ԏ , FJV`jn ,8 BFJf֏x  Wԏ܏  ҏDd \,<Z^jpz~ "&HRT ^ P`pҏ \ W"ҏ&>BLVZt~ ҏ"<FH lҏ \vҏPԏ܏ ҏl Wԏ܏ ҏ$Dd \ >JLZx  Pv~ P ,6ҏd \ Wҏ$.0 :Rnҏ (@Jҏx \  &*6BJNRt  .ԏ2֏FJ؏b܏֏  ֏ 0< FJVbnrv P0B`xP֏֏$ , N֏\ fjrv .֏J֏X ` ֏   ".26֏؏܏ԏ8 B؏nЏx!əЏ  "2؏T ^؏z~ԏ܏ *ԏ` l ԏ܏ ؏ ؏26BLVZԏfj܏ ԏ  , ԏ"*.6Џ:܏>B d rvԏ܏  ( @ ԏ֏؏܏  0 >NTflvz  2ҏZj~ Џ L bnv~Џ      Џ 8  R p      Џ      & 2 : B FЏ h         Џ   " * <  R ^ f n rЏ         Џ $  P  X               " * . ^         ( 26BNVZ^ԏ؏B܏Fz֏   d֏!o , WHNRҏfl!o~XN &*.JҏNpz$>H^h|d.֏8!oL^l WN!oXN֏   *6:`l vz !j Џ< FJVdnr ֏   LX bnr~!G&6:FЏd nr~ hl:֏H P Z^fjx ԏ܏؏֏ ؏>dFҏh֏!o؏֏"ԏ.2܏Xbd nr~ !jjl  T!B؏֏ ԏ ܏8D RVbjnrԏ(4 D RrX bf|  ,68 FRj؏z֏ ԏ܏    *ԏ |  ԏ    Џ ܏     !!!!, !:!>!B!FЏ!N!d!G!r!zԏ!܏! !!!!!!" " """"*"Bh"P"b"jԏ"r܏" ""ԏ"""Џ"܏" """### ## #8!o#JX#XN#h# W#N#####$֏$!o$.ҏ$>$B$N$X$b$fԏ$r$v܏$$ $$$$$$$$!o%X%N%,%H W%dN%p % %ԏ%؏&"܏&&&^֏&l &t & &&d&֏&!o&'' W',N'6ҏ'J'P!o'bX'pN'z'~''''''' ''''( (((.ҏ(2(T(^(h(x((((((((())"),)B)L)`)n)x))))))))*d*֏*!o*0*B*P W*lN**!o*X*N*h*֏* ++ ++++,+6+B+F+l+x +++++++++ ,!,Џ,*h,B,J,Rr,V,b,f,|,,,,,,, ,,,,----*-4-T!ә-b-p-z-| ---------- ...6֏.D .L .V.Z.b.f.p..... ...../Rl/Zj/~֏/ / ///////// 00 00"0*0.020ԏ1܏1 1؏1>֏1L 1T 1d1nd1~֏1!o11 W1N1ҏ1!o2X2N2؏2.֏2< 2F2J2V2`2j2nԏ2z2~܏22 22222223 Џ3r33383B3F3N3d3n3p 3z333333333!ә34 44 4,!4:j4>l4nh4444r4444ԏ444܏4555 5*565B5J5N5f5x555!ә5555 55r5 6666"6&626H6R6T 6^6b6f6v666666666 667؏7&֏74 7< 7J7V7X7b7fԏ7n7r܏7v777 777777ԏ8:֏8H 8R؏8l 8t 8~88888ԏ88܏88 8889 99992ԏ9؏:֏:$ :d:n:x:: :!:֏:;;;;;(;2;6;\;h ;r;v;;;;;;; ;;!j<:v<>>>">$ >2>>>v֏> >>>>>>>> >>>>???p ?~??!t?!t?@@&@*@D @N@h!@~@@@ @@ @A!AЏA"rA.A2A:A>AXAbAnArAvAzAAA AAAAAAABB !әB.B<BFBH BVBbBzBBBBBB BBBhCjC lCFCPCpC֏C CCCCCCCC DD DD"D*D.D2DP DbDfDDhD!DDDDDEEEEE"E&EDENEP EZEfErEzEEEEEEEEEF !tF"F*F:FDFjvFnF|FFFvFFFFFFG GhG6G:GNGVG^GbGfG|GGGGGG GGGGHHH&H4H>HBHNHXHbHfHH HHHHHHHH I I^֏Ib؏I I؏I֏I J^JJJJJJJJJJKK K*K6KBKNKZ؏Kj֏KKKKKKKKKK KLLLL&L*L.LN֏Ln؏L~֏L L L L؏M֏Mn֏M~؏M֏M M MMNN NN N*N.NPN\ NfNjNvNNNNN NNNЏNrNNNO OOO&OHOT O^OjOvOOOOO!әOOO PPP0P>P^PfPnPrPvPPPPP PPPPQQ QQ Q*Q.QPQ\ QfQjQvQQQQQ Q Q RZ֏R^؏R R S> S^Sb S RSSSSSSTT T,T8 TBTNTZTfT TTTTTTTTTU UUU"U.U:U>UBU^ U U U V V VWW WWW$W.W2WTW` WjWnWzWWWWW WWWXXXX"X&XHXT X^XbXnXzXXXX Y Y Y.Y6Y>ЏYBrYNYRYVYtY~YYYY YYYYYZ ZZ<!әZTZ^Z` ZnZzZ RZZZZZZZ[[$[0 [:[F[Z[d[n[r[~[[[[[ [[[[[[[\$ \6 \P \؏\֏\ ] ] ؏]$ ]6]D]N]R]^]h]r]v]] ]]]]]]]] ^&^,^>^F^d!B^nj^rl^^^^Џ^r^^^^^^^^^_$_._0 _:_F_R_^_b_v_z_____!ә____ _` `r`$ `.`2`>`H`R`V`^`x`` ``````؏`֏a aaaa"a&aBaLaVabahavaaa aaaaaab bb b&b*b6bBbFbJbb؏b| b bbbbbbcc ccc4c>c@ cJcVcbcjcncccccccccc ccd؏d֏d, d:dLdVdZdbdfdpdzd~ddddd ddddddd؏e e e؏e֏e f f$ fBfTf^fbfnfxffff fffffffg gg&g*g.g6gLgVgZgfggg gggggggghh&h.h6Џh:rhFhJhlhvhzhhhhh hhhhhii i@!әiNi\ifih ivii֏i i iiiijjj j*j6j:jFjRj֏j j jjkkkkk@kL kVkZkfkrk~kkl֏l"؏l| l؏l֏l mmXmbmmmmmmmmmn n nn"n.n:؏nJ֏nbntn~nnnnnnn nnnnoo oo.֏oN؏o^֏ol o o o؏o֏pN֏p^؏pn֏p| p pppppqq qq0q< qFqJqVqbqnqrqvq qqqЏqrqqqrr rrr<rH rRr^rjrvrzrrr!әrrr rss"rs.s6s>ЏsTsbssssssssss sttt$t.t2t>tHtRtVtxt tttttttt t u uz֏u~؏u v v^ v~v v Rvvwww w w*w.wPw\ wfwrw~ww wwwwwwwwx x, x6x:xFxRx^xbxfx x y y y z zz$z.z2z>zHzRzVzxz zzzzzzzz {{{"{&{2{<{F{J{l{x {{{{{{{{ |8 |D |R|Z|bЏ|fr|r|v|z|||||| ||}}}}.}@}`!ә}x}} }}} R}}}}~~~"~&~H~T ~^~j~~~~~~~~~~~ ~~"H Z t ؏֏ ( 2؏L j| . JNRZbt~  Џ&r*26T^bfjn  4!әBPZ\ jv؏֏ 0:< FRVbn؏  ؏ ֏ &8BFR\fj ؏  ԏ؏܏֏֏֏ 4 < R֏bfr|  0< FJVZfn֏ $ , J֏Z^jt~  (4 >BNR^f~֏>ԏB؏F܏Jb֏֏  ֏  4@ RVZ^bj֏ ֏&֏4 < ^֏l z  2֏N֏\ d ֏   &2֏܏؏ԏ  *؏P nrz~ԏ܏  ,>ЏBV^ԏbjrv܏ ؏  ؏  (26ԏBF܏dp z~ԏ؏  *؏P Z^fjxԏ܏ ԏJ؏l t ~؏ ԏ܏ ".:FJNfԏ:>֏B؏RԏV܏ ؏֏ԏ܏ , 6:FR^bf~֏֏؏ ؏֏ ԏ܏<H RVbnz~ԏ $ >d &ԏ.2>ЏB܏d n֏r؏ ؏֏ԏ܏( 26BNZ^b~ԏ  ܏ԏ  L^ԏb܏ ԏ܏ Z`xv Cp C(2>LVX p˙ԏЏ܏  *.2fl    .2>BFJ  >HZdv˙ ԏ"Џ&܏L ^dԏ܏ *BԏFJNVЏZ܏ ԏЏ܏ JJ X  BH  2ԏ6:>JЏN܏p ԏЏ܏  "(JԏNVZfЏj܏  "&.>DRhrt ԏЏ܏ ԏ Џ܏0 >HZd 28x C CP  vz  &HRT ^rx BXh˙~ԏ܏Џ  "&ԏ*܏.26`jl vԏ܏Џ ԏ܏ Џ0 FԏJNR^܏bЏ ԏ܏Џ  (:>ЏZԏ^bfr܏  &,BHZv~ԏ܏Џ &8BFRpz|  &8BFRpz|   "&2DNR^   *6BFJdnp zԏ܏ 0< F ԏЏ܏( :ԏBFJRЏV܏| !`ԏ܏*Pl !`ԏ܏vԏЏ܏ 8 RXnt  ԏ֏؏܏Z֏h p ֏  ".:>F~Џ ֏v&.:ЏX b֏~֏  ֏  4@ JNZfnrvv֏֏  ֏ "*.<FVp| VԏZ܏b´  F֏J؏p ÒÖâìöúԏ܏ &*.FԏĈ Ĕ ĮԏԏЏ܏ "֏&؏L V؏rvłŌŖŚԏŦŪ܏  "ԏ>؏X bԏnԏƈ Ɣ Ơ  ^ԏb܏rǰ C C*2Џ:Bh r؏v֏Ț֏ȞȢȦȪ $ .2>BFJɶɺɾ &*>֏P h p ʬ C C2֏6VԏZ؏b܏˜ ˤ ˮ؏  ԏ܏4@ RVZ^bj̜˙̦؏̶ԏ̺Џ܏ ؏$ , 6؏\ jrv͎͖̀ԏ͚܏͞ͼ ԏH P Z؏΀ ΎΖΚΤβκԏξ܏ &:ԏϮԏ؏܏"֏0 L VZbft~ЂШд оj !B2Џ6rL `!BjrюlѪlѺ  .lVZ^t~҂ҜҨ ҲҾ"$ 2>b֏p x ӂӆӎӒӜ n֏| Ԝ Ԥ ԮԲԺԾ$ <H VZfrvzjԏn؏vz܏ֺ֏  ԏ܏0< FJVbnrzךj׬!׺j׾lԏjЏ܏$ .2>Xd nz؆؎ؒت؏غ֏  ԏ ܏$0 :FJVbvԏj( 2>JRVnڌږژ ڦڲ֏ ؏  &*6@JNԏVZ܏|ۈ ےۖۢۮ۶ۺ۾ԏNԏܒ؏ܖܞ܏֏  <H RVbnz~݆ݦҏݼ Џ .< NZbjnЏސ ޴ Џ *L l ߂ߎߖߞߢЏ   Џ8 X jv~Џ ֏   8D NR^z֏    &.2ԏ֏؏&܏D L V؏| ԏ܏  ".26TfЏ~ԏ܏ ؏  ؏< FJV`jnԏz~܏ ԏ:؏\ d n؏ ԏ܏  &26:Rԏ؏  ؏ ԏ*.܏LX bfr~ԏ.ԏ2֏v~܏؏֏ ֏  "&4>Bht ~ l$NRfЏ ֏֏ ֏"0:Jdp z~ $ Rҏ֏֏֏ ֏ &6P\ fjv    l"*6Lhz ҏ֏4 V^j  ԏ ؏܏2֏^֏l t ֏  *.:FRVZx Џ ֏֏֏$ , N֏\ fjrv R d5vЏ ֏֏  "֏0 :>FJXbfr  < HV֏r֏  ֏  *.:FRVZ֏֏  ֏ *DP Z^jv&֏*؏:܏BVԏ  ؏  ԏ܏8D NR^jvz~ Џԏ܏  ʙ&.JNdnrԏz܏ ԏ ܏( 6؏X ` j؏ ԏ܏  ".26Nԏ ؏ ԏ܏(4 >BNZfjn؏  ԏ6ԏ:؏J܏Nj֏֏  ֏ 8D NR^jvzЏ ֏.ҏ>֏Tjnrҏ֏Џ$ .֏N֏\ d ֏   "*.2^fjЏ ֏֏  ֏  "2LX bnr~֏֏  ֏ &*26DN^x ԏ֏܏؏H R؏x  2ҏޏ ؏ ` j n z   ԏ  ܏          *؏ D  Nԏ     ԏ   Џ ܏ D  N R h r v        ؏   ؏ : F H Vԏ b܏ |        ԏ   (  \  ˙  ԏ   Џ ܏ &*@JNht ~ ԏЏ"܏D NRhrv IԏЏ܏ "<H Rl \ԏЏ܏ ,8 BRVblvzԏ܏  $ ԏ֏܏؏֏ &֏H!yVЏ^r֏֏ ֏ *.:FRVZ   4 >֏Z֏h ~֏ "&P \ !! (2FX b֏!~?Џ 0 :֏N֏j֏x ֏  ".26` l " $26>BPZf   f֏j؏rԏ܏ ؏ԏ"܏DP Z^jv~Џԏ܏ ؏*؏D N؏jnzԏ܏ ԏP \ x!yԏЏ܏ ؏ Џ !  < T l x   Џ Џ ! Џ! !ԏ!!"!&!*܏!P !l!~!؏! !؏!!!!!!ԏ" "܏","8 "B"F"R"^"f"j"n"ԏ" " " "؏""## ##ԏ#&#*܏#H#T #^#b#n#z####ԏ# # ##ԏ###Џ#܏#$ $6$Bԏ$F$J$V$Z܏$x $$$$$Џ% %ԏ%%%*%.܏%L %l%x % &ԏ&؏&܏&&֏&*&b֏&p &֏&&&&&&&&& &''''&'*'2'P'\!y'fЏ'r'~''' '֏'֏' '֏(( ((($(.(>(X(d (n(r(~((() ) )4!)^)d)z))))) )* *`*++<ƙ+X!+v++++ ++!~+֏,֏, ,&֏,6,:,B,F,T,^,n,, ,,,,,,,, - --*-.-:-X -f-v-z-- -!----. .B.V.j.v..... ... . /֏/܏/؏//ԏ0 0؏0֏0.020>0H0R0Vԏ0b0f܏00 00000000001!y11"ԏ1&1*16Џ1:܏1>1` 1j֏1n؏1 1؏1֏111111ԏ11܏22 2*2.2:2F2N2R2V2nԏ2 2 3 Џ3!3*3.363J3R333334 4P 505>܏5Fԏ5T 5d5Џ5!5Џ55ԏ5556܏6( 6<6H!~6^6v֏6z؏6 6؏6֏666666ԏ77܏7$70 7:7>7J7V7^7b7f7~ԏ7 7 7֏7؏7 8؏8֏8"8&828<8F8Jԏ8V8Z܏8x8 88888888ԏ8 8 99ԏ99"9.Џ92܏969X 9h 9z9ԏ99Џ9܏99 9܏9ԏ9 ::.:2:::@:N:R:d:n:p :~:: : ;ԏ;;>֏;F܏;J؏;~֏; ;֏;;;;;;;;<< <<"<.<:>>>8 >H>֏>>>>> ?? ?&?*Џ?j֏?֏? ?֏???????@ @ @"@&@2@>@F@J@ @ @֏@֏A A֏A.A2A:A>ALAVAfAA AAAAAAA A BBB&B<BH BVB\ BԏB֏B؏B܏BC C*؏CJCRCVC`CnCvԏCz܏C~CC CCCCCCCCD D܏DԏD0 D@D؏D D؏DDDDDEԏE ܏EE,E8 EBEFEJENEREZEԏE E E؏F F؏F2F:F>FHFVF^ԏFb܏FfFF FFFFFFFԏF F G G GԏGG؏G܏G֏G֏G G֏HHHHH(H2H:H\Hh HvHzH~HHHHHHHII$ I^֏I I֏IIIIIIIJJ JJJ"J&J*J2J J J֏J J֏K KKKK$K2K:KXKd KrKvKzK~KKK K K K LԏL֏L؏L܏LM M؏M*M.M:MHMRMVԏMbMf܏MM MMMMMMMҏMNLNrNNNN N N!`OO@OH O\OzOOOO O O!`PP, P:PTP^P` P PPP P PPPP Q Q"؏QD QN؏QnQ|QԏQ܏QQQ QQԏR\ Rh R؏R R؏RRSԏS܏S,S6S8 SFSfԏS| S SSSS SSTԏT TTЏT܏T@ TP"(TbTnԏTrTvTЏT܏T TTTTT UU0UHU`UxUUUUU UVV V,V6V8 VTVrVxVVV VVVVV WWW<WFWH WdNWWWWW WWX$X.X0 XRԏXZЏX^XbXjXn܏X X"(XXԏXXXЏX܏X YYY8YBYD Y`YYYYYYZZ"Z$ Z@Z^ZhZZZ ZZZZ[[ [[([H[R[T [r[[[[ [ [ [[[[[\\ \\ \~؏\ԏ\֏\܏\\ \ ] ]]]](]6ԏ]>]B]`]l ]z]~]]]]] _ _ _0 _>_F_J_T_^ԏ_f_n__ _______ԏ`vԏ`z`܏aԏb֏bԏbb؏b܏c֏c cPc^֏cr؏cv֏c c c c֏c؏c֏d d4 d< df֏dv؏dz֏d d d dd֏ee.֏eF֏eX e` eԏee֏e܏e؏f֏f f8fJ֏fN؏ft f f ff֏f؏f֏g g, g4 g^֏gn؏gr֏g g g g֏g h hHhԏh֏h؏h܏hi2֏i@ iJ؏iZ֏ivҏiiii֏i*ijj. jjjjjjjjjjjk kkk$k.k<kJkPk^kdkrkxkkkkkkkkk֏kҏkk$llll*l0l>lDlNlXlflllzllllllllllllmmm"m(m6m<mRҏmbm~֏m؏m֏m m؏m֏mmmmmnnn܏n0n< nFnJnVnbnnnrnvnkn o o.o<oN܏o\ oho~ooooooooooopppp&p0p>ҏp^pnpxpppҏppppppqҏqҏq:֏qNqTq^$qtq~qqqqqqqrrr r4 \rBrPrbrhrrr|rrrrrrrrrrrs sss$s2s8sBsLsZs`sj$stssssssssssssttt"t&t*t2t6t@tPt`tptttttҏu֏u.ҏuJ֏ufuluvuuuuuuuuuuuv$v:vDvRv\vvvvvvvvvvvvwwwwTwjwtwwwwwwwwwwxx0xBxHxRx\xjxpxzxxxxxxxxxyyyy"y,y:y@yJyTy^yhyvy|yyyyyyyyy \yzҏz*ҏzF֏zZz`zpzzzz \zzzzzz{{ {{$ \{<{P{d{r{|{ҏ{ҏ{{{{{{ҏ{|| || |*ҏ|:ҏ|Jҏ|j|p|z$||||||||}} }2}<}P \}^}l}~}}}}}}}}}}}~~~~*~0~:~D~R~X~b~l~z~~~~~~$~~~~~~~&0JP^drx&,:@NT^|ҏҏҏ  .4BHV\jpz8JP^drx(6@hz8NXfp*0:HV\",:@JҏN \ ҏ&ҏ:ҏJX \p~,@Tbp \ \$8JP^dt ҏҏ.8FLVҏlvz$ (BLZdx \(6<FP^dnx$ *:>BFJNjt 8Lt&0BHV\fp~0 \HXҏ$ҏ$.ҏ2HR֏fl \ (FPZdrx \,:DR\p \ \ \$ \4HZ`jt&,<JPZdrx $28PZdt \ "(2<JPZdrx \ .8\ \t \ \ \ \$6<FP^dnx \ \.8P^hv|&,6@P^dn֏~(6<FP^dt \ ",Vfp~$ $6<FP\r *<NT^ht$  0>DN֏^hv|&0>DTbhxҏ"֏8NTdx \ \ \ 6^lzҏ .<P^dr|$"(2<H^lv "(2<JPZdnx$28JP`nx*0:DRXz&4BHTjx \ \ \$<JTblz$&0<R`j~&0>DNXblv&,>DTblzҏ&ҏ>NXfl|$ \&0@R\fp~ \$8L^dt :@Rҏblzҏ ҏ"8FLV`nt~$*@T \lҏҏ֏֏*.BPd \|ҏ֏ҏ$.$8BL\rx( \@Tblz \,@RXbfx֏ \ҏҏ"ҏBHR` \x.4>L \dx \  \0DV\ft \ &,BH^dvҏ$.$6DRXh \"$0:DT \l*0:DRXftҏ .4BHV\fp~$.4P \p \$ .4FP^hr$|֏ "(2<JPZdrx‚Œš ª´ $ \<FPdnxÆÐÞèöü$"(2<JPZdpĆĔĞIJĸ 28BLXj|ŊŐŢŨŸҏ(2$FLV`p~ƄƎƘƦƬƶ$28FLZ`jtǂLjǒǜǦǰǺ"(6<JPZdrxȂȌȚȠȬ $0BTjpɀɒɘɦҏɾ$"(2<LZdrxʆʌʚʠʮʴʾ",6@JTbhv|ˊː˞ˤˮ˸$6<FPlv̀̊ҏ̤ \ҏ֏(6<FP`nt~֏͂ͪ͜Ͱͺ "(2<JPZdrxΌΚΠΰ \$.8FLV`ntτϒϘϨ \$ \@RXhzЀТШжм$ "(2ҏB֏FҏflzрѐўѤѴҏҏҏ֏ 0:ҏbҏr֏ҊҐҚҤҴ ֏(6<FP^dnxӆӌӖӠӮӴӾ&,< \TbhxԆԌԜԪ԰Ժ$4 \L`tՈ՚ՠծմ , \L \\l֊֐ֲָ֠ \$ \<Tt \ךפײ׸$28FLZ`v؀؎ؔؤزظҏҏ.ҏ>֏jҏz֏ْ٘٦٬ٺ  *4DRXb֏xچڌښڠڮڴھ&,6@NThv|ی \ۤ۲۸"(2<JP`nt܄ \ܜܰ&,:@JTbhr|݊ݐݜݲ ",:DZdx \ޠ޲޼ \*4BL` \߀ߒ֏ߢҏ߶ \&ҏFҏfҏ~$  0 \Hbr$vҏ *0:DRXnt "(2<JPZdrx$8BL\ \tҏ *4BHXh \ҏ  6<RXrxҏҏ>DZ`v|*.BPd \|ҏҏ֏*֏:>R`t \֏ҏ  *$4BLZ`jt \ 4FLVZlz֏ \ҏҏҏ6<FT \l"(2@ \Xl~ \ \$8JPZh \ \"(6<LZ`jt&,6@NXfp~ \ \*4BL^$lz6@J$Tbhr|֏ "(2<JPZdrx \(<FP^hv$ "(2<H^lv *0@NTblzҏҏ6$>DRXbҏxҏ&,:@NTbhx&ҏB֏Rҏrxҏ(6<FP\r&0:DNXblz  .4@Vdrx,>DTflzҏ "(6<JP^dnx&,:@NT^hv|ҏ&֏BHZ`jt~֏  *4BHR\jpz  \8FL\jp \0:DRXlvҏ( \H\p \֏ҏ$28HV\lҏҏҏ֏ҏ֏&,6@JTdrx֏(6<FP^dnx \(6<LZ`jt \    $ 8 B L ` t         \  $ 6 < L \ d | \ ҏ           & , : D R \ j p ~          \ ( \ 8 F L ` p             \ < J T b h r |   $    \֏"ҏ2$:DNXl \$ $28BL^$fp~ҏ \4D \Th \ $28HV\fp~&,Hd \ 0 \H\p \ \(6<FP^d \ \,< \LZdnx*8BV\hz",6@JT^hr|$6$>HR\l| \ \4 \BP` \p~",8N\fz(6<FPZdnx$4BH^֏r$  \BLVdrx*0>DNXfl \ $ \<P`x \ \ \     , : @ J֏ Z d r x             !!!!"!,!:!@!P!^!d!x!!! \!!!!!!!""" "*"4"B"H"X"f"l"""""""""""###$#6#H#R#\#f#p#~#############$$$$$$.$8$B$L$^$d$n$x$$$$$$$$$$%% %% %.%4%>%H%V%\%n%x%%%%%%%%%%&&&&*&0&<&R&`&n&t&&&&&&&&&&'''$'2'8'D'R'`'n'x'''''''''''''ҏ($("(((6(<(L(\(nҏ((( \() \))2)L)\)p \)))))))))***"*,*@*R*X*b*l*x*********++4+J+T+b+h+r+|+++++++++++$+,,,,,*,0,@,N,T,^,h,,,,,,,,,,,- \-:-@-N-T-b-h-r-|--- \------...*.0.D \.Z.d.x \...........///2/</J/P/^/h/~ҏ/$///////ҏ0$040D \0j0t0~0000000000001111,1J1P1\1r111111111122 \24 \2B2P2` \2p2~2222222223333&3,363@3N3T3^$3h3v3|333333333334 444$4.484F4L4\4r4|4 \44444445555< \5T5b5h5r5|555555 \556 \66 6*646B6H6R6\6j6p66666666667777&7,767@7N7T7^7h7~ҏ7$7777777ҏ8$848D \8j8t8~8888888888889999 969D9V9d9999999999999::::$:.$:8:F:L:V:`:n:t::::::::::::;;;;8;T \;~;;;;;;;;;; \<<<$<.<8=D=`=v============>> >>">(>2><>J>T>b>h>x>>>>>>>>>>>???&?,?8?J?\?n?t?~???????֏?@@@@"@,@D@R@X@b@l@x@@@@@@@@@@AAA0ADAX \ApAAAAAAAAAAAABBBB$B.B8BBBLBZB`BnBxBBBBBBBBBBBBBCCCC&C0C>CDCNCXCfClCvCCCCCCCCCCDDDD(D6D<DFDPDZ֏Dj֏DzDDDDDDDDDDDDDEEE$E6E<EFEPE^EhE|EEEEE֏E֏EEEEEFF FF"F(F2F<FJFPF\FjFxFҏFFFFFFFҏFGGG$GG6G<GLGZG`GjGtGGGGGGGGGGGGH ҏHH$H2H8HHHXHhHx \H \HHHHHHHHII \I<INITI^IhIvҏIIII$IIIIIJJJJ&J,J:J@JJJTJbJhJxJJJJJJJJJJJKKKKK*K0K@KPK`KjKtKKKKKKKKK \LL4LBLHLRL\LjLpLz$LLLLLLLLLMMMM(M6M@MNMTM^MhMvM|MMMMMMMMM$MMMMNNNN,N:N@NJNTNnNtNNNNNNNNNNO \O2O<OJOPO^OdOrOxOOOOOOOOO \PPP, \PP \PpPPPPPPPPPPPPQQ QQ Q*QLQbQlQ \QQQQ \QQRRҏR4RBRHRR$R\RvR|RRRRRRRRRRRRSSS$S6S@SJSTSbShSrS|SSSSSSSSSSSTTT"T(T2T<TJTPT`TpT \TTTTT$TUUU*U0U:UDURUXUbUlU|UUUUUUUUUUVVVV"V,V:V@VJVTVbVhVr$V|VVVVVVVVVVVW WWW$W2W8WBWLWZW`WvWW \WWWWWXXXXX(X6X<X` \XxXXXXXXXX \Y \Y Y6Y@YRYXYbYlYzYYYYYYYYYZZZ( \Z:ZDZTZh \ZzZZZҏZZZZ$Z[[[6[@[N[T[p[[[[[[[[[[[\ \\\(\:\@\J\T\b\h\x\\ \\\\\\\\] ]]]$]2]8]B]L]Z]`]j$]t]]]]]]]]]]]]]^^ ^.^4^P^j^t^^^^^^^ҏ_^֏_n_x___ҏ_____$___``.`4`X`b`l`vҏ` \``ҏ`֏````a aa a*a4aDaRaXab֏afaaaaaaaaaaaaabb bb b.b4b>bHbVb\bpb~bb \bbbbbbbccccc*c0c:cDcRcXchcvc|c \cccccd \d$d2d<dJdTdbdlddddd \ddddeeee&e0e>eDeNeXefeleveeee$eeeeeeeefff*ҏfFf`fjf~ffffffffffg \g6g<gJgPg^gdgngxgggg \ggghhhh&ҏh@ \hRhhhzҏh֏hhhhhhhhhiiii"֏i&i@iNiTi^ihivi|iiiiiiiiiiiiijjjj,j:j@jJjX \jpj~jjjjjjjjjjjjkkkk,k:k@kP \khk|kkkkk \kll ll l*l4lBlHlRl\ljlplzlllllllllllmmm0 \mT \mjmtm \mmmmmmmmmmn nn,nBnLnZndn|nnnnnnnnnnooooo$ooooooooo֏pppp$p.p8pFpLpVp`pnptp~ppppppppppppq qq q.q8qFqLqZqdqrqxqqqqqqqqqqrr rr r*r4r>$rRrXrbrlr|rrrrrrrssss(s4sJsXsnssssssssstt"t(t2t<tHtZtlt~tttttttttu uuu$u.u8uFuLuZu`upu~uuuuuuuuuuuuvҏv֏v2v<vJvPvZvdvnvxv֏vҏvvvvvvvvv$wwww.w4wDwRwXw~wwwwwwwwwwxxxx&x,x6x@xNxTxbxlxzxxxxxxxyyyyyy,y6y:yJ܏ydyp yzy~yyyyyyyyyy z zz z*z4zBzHzRz\z{*֏{.{2؏{6܏{fԏ{ |||(|4|T|d||||||ԏ}}$}0 }:}F}R}^}b}}*}ҏ}~ ~\!o~n ~x!o~!o~~~8 Z^jt~ԏ  ԏl_p | l ԏ "&>ԏ_  !o^$ ԏ &*6BNRVnԏ   \ W,Dh W!o ԏ,8 BFR^jnrԏ  !o!o!o,!oD!o\ߙߙ$<Tl!o!o!o ߙߙ u0jnz "0>Vp| !o!o!o!o!oLp!o$!o!o!o!o!o!o4!oL!o!o!o!o!o !o8!oP!oh!o!o!o|!o!o!o!o!o!o !o$!o<!oTf$!o!o!o!o!o!o4Ld!o|!o u $0 :JNZhv !o !o8!oP!op!o!o!o!o!o!o!o$!o<!oT!ol!o!o!o!o!o!o!o!o8!oP!oh!o!o!o!o!o!o!o!o(!o` \t!o!o!o!o!o!o u6:FTbz  W0H`x W!o!o!o!o!o,!oD!o\!ot!o!o!o!o!o4ߙ`!ox!o!o!o!o!o!oL!orԏ, >BFTbd nr~  (24  ԏ  &26:Rԏ_   !o !oT!ol!o!o!o!o!o!o!o,>BFTbd nr~ !o@ߙ,L!od!o|!o uߙPߙ u0^bft  !o(!o<!oP!o!o!o!o!o0!oL!ot \ \ W4Ld W!o!o!o!o!o!o0!oH!o`!o!o!o!oߙ0pߙ<!oT!ol!o uߙ@ߙt uL!od!o|!o!o!o \ߙߙ@ߙߙ u@!o!o!o!o W!o !o!o!o!o!od!o|!o!o!o !o8!oP!oh!o!o!o!o!o!o!o!o!o !o$!o<!oT!ol!o$!o!o!o!o!o4!oL uVp!o!o!o!o!o !o$!o<!oX!op!o!o!o!o!o!o!o !o<!oT!ol!o!o!o!o!o!o!o!o0!oH!o`!ox!o!o!o!o!o!o !o,!oDX uf  4!ol ԏ "&>ԏ_  !o!o!o!o!o4!oL` ux!o ԏ$0 :>JVbfjԏ_   &>Xd rvzߙߙߙ8ߙߙ@ߙߙ!oŘ!oŰ!o!o!o@!oX!o!o!o!o!o,!oD!o\!ot!onj!oǤ!oȈ!oȠ!oȸ!o!o!o!o!o0!oH!o`r$ɐ!oɨ!o!o!o!o !o8ߙʠߙߙ $<Tp!oˈ!oˠ!o˸!o u &>Xd nz̠!o!o!o!o !o<!oT!ol!o͈!o͠!o͸!o!o!o!o!o8!oP!ol!o΄!oΜ!oδ!o!o!o!o!o0!oH!o`!ox!oϐ!oϨ!o!o!oߙ^$А!oк$!o!oѬ!o!o!o!o !o!o!o!o0!oH!o`!ox!oӐ!oӨ!o$L!od!o|!oԔ!oԬ!o!o!o!o!o(!o@!oX!op!oՈ!oՠ!oո!o!o!o!o !o8!oP!oh!o֐!o!o!o!o!o,!oD!o`!ox!oא!oר!o!o!o!o !o$!o<!oT!ol!o؄!o؜!oش!o!o!o&*2DNP dp | ԏ֏؏܏B֏P X b؏~֏ڌ ڪڮڲں܏ &2>BF^֏nrz~یۖۚ۴ ֏؏֏ $ .؏J֏X bfnr݀݊ݚݞ܏ݸ *֏.؏J֏X ` j؏ކ֏ޔ ޞޢުޮ޼܏  &26:֏܏؏*ԏl t  ԏ$ .2>JVZ^~ҏ 8Ph ҏ \"0>ԏP `l!ԏЏ   4DTdt$ҏ(8Nҏdt :$F$R$j  \0@ \Phxҏ$4HXp 0@Tdtҏ0@JҏNdx \ҏ,<L\l$ \<L \\fҏvҏ *ҏ.DXhx \ҏ ,<L`pҏ(8L\p *ҏ:ҏL\l|ҏ,<Xhx \ҏ$4DTdtҏ$4DXhxԏ   ( 26BLVZԏf ԏ>$ԏ֏؏܏֏  &؏B֏P nrz~܏  "֏2:>PZ\ nt!o !o!o$FP^ !o"(!o>D!oZ`!ov|!o!o!o!o֏؏֏  "؏>֏L VZbft~܏ >֏B؏^֏l t ~؏֏ ܏ ".:FJN֏؏֏  ؏֏ ,6FJ܏dp z~֏؏֏$ , 6؏R֏` jnvz܏ V\!of֏؏֏  ؏֏ .2܏LX bfr~vԏz֏~؏܏   8BFR\fjԏv  2F PZ dr x        " (2 <F P^ dzҏ~    " (R \n t   $* 4B HR \$   \  & 0: DR \f p~       * 0: DR Xf l         \ B  H V  \ j  p z      \          &  0 F  P                    .  4 J  P b  l                      "  , B  H Z  ` n  t ~                         2  8 J  P Z  d z  ~                 & 0> DZ dr x Z   V    $26 @J Tb hr |       > DZ `v |ҏ6 ҏ     (2 <F P^ d       (6 <RVҏ    " (R \n t   $* 4B HR \$   \  & 0: DR Xb lz       & ,6 @N Tb h~    \   & 0> HZ `j t ҏ     (6 <F P^ dҏ    $> H       $. 8F LV `n t         . 4B HR \j p~       " ,BV \j pz      ҏ  (6 <F P^ dv      * 0: Db hv   $. 8F LV `$   \    2  < F  P ^  d n  x               ! !! !$!2 !8!B !L!Z !`!n !t! !! !! !! \! "" """ "("2 "<"J "T"f "l"v "" "" "" "" "" "" ## ##"P#& #0#B #L#Z #`#j #t#~ ## ## ## ## ## ## $$ $ $. $4$^ $d$r $x$ $$ $$ $$ $$ $$ $% ҏ%*%6 %@%R %X%b %l% %%% %% %& &&.$&V &`&n &t&~ &&$& &&& ' \'2 '8'R '\'f 'p'~ '' '' '' '' '' '' '(& (0(> (D(R (X(b (l(z (( (( (( (( ((( \) )$)2 )8)F )L)V )`)n )x)) )) )) )) )) )) ** **& *,*6 *@*JP*N *X*fҏ* ** ** ** ** ** ** ++ ++&+0+: +D+R +X+b +l+z ++ ++ ++ ++ ++ +,  ,," ,(,6 ,@,R ,\,j ,p,z ,,, ,,ԏ, , ,, - --"d-8!o-L-h W-N-ҏ-!o-X-N------ԏ.. ., .6.:.F.R.^.b.f. . .ԏ/fԏ/j؏/֏//܏/֏/ / /؏0֏0 000&0*080B0N0R܏0V0t0 000000000001 111"181D 1N1Z1v1z1111111 11112222&2<2H 2R2xD2222Џ2܏22 22"#23 33Џ3܏3&3@ 3J3n3r3z3~33333333 3334 4 4*4, 4>4b4f4n4r4v4444444 4444555 5.5:5B5F5b5j5t5~55܏5 55!555Џ5܏6 6&6.686L6^܏6l 6|6!666Џ6܏6 6667 7܏7, 7<7H!7^7j7nЏ7z܏7 777777 888(82868`8j֏8n؏8֏8 8 8؏8֏8 88888999܏949@ 9J9N9Z9f9n9r9v9֏9؏9֏9 9 9؏:֏:( :2:6:>:B:P:Z:j:n܏:: :::::::;֏;܏;؏;;ԏ< <>8 >Z>^>j>t>~>ԏ>>> >>>>>>>?ԏ?h ?t ???????? ?@&@*@2@6@F@T@b@x@@ @@@@@@ @AtAAAAAAAAAA BBB*B@BJBL BBBBBBBCCC&C( C:CHCVClCvCx CCCD@DPDZDdDtDDDDDDDDEE$E4EDETEdE|EEEEEEEEF FF,F<FLF\FlF|FFFFFFFGGG G0G@Gl GGGGGGԏGGG GGHHHHH"H:ԏHP H\ H|HHHHHHHII@IPIb6IJJ,J<JNЏJRJfJnԏJrJzJ JJ fJJ!oK K KK$K^Kd fKKԏKKKЏK K˙KKԏKKLЏL$ L6L8!oLLLLLԏLЏL LDMMMM"ԏM2M6MLMVMZMtM MMM M N&ԏN*N:؏NF܏NV֏N֏N N N؏N֏N NNNNNNO O܏OO0O< OFOJOVObOnOrOzOOOOOO܏O OO!PPP"ЏP.܏PL PZPlPPPPQQ,QbQvQ|QQQQ܏Q QR!RR*R.ЏR:܏RX RfRzRRRRR܏R SS !S"S.S2ЏS>܏S\ SjSSSST.T2T6T:TBTZThTT TTTTTTTUU U&֏U*؏UF֏UT U\ Uf؏U֏U UUUUUUUU܏UU VV VV"V*V.V2VVVVVVVV VWW WW$W.W2WLWX WbWnWWWWWWWW WWWX XX"X&X@XL XVXbXnXvXzX֏X؏X֏X X X؏X֏X YY YYY$Y.Y>YB܏Y\Yh YrYvYYYYYZvԏZz֏Z~؏ZZ܏Z ZZ[[[*[.ԏ[6[T[` [j[n[z[[[[[ҏ\ҏ\zҏ] ]]*]6]d ]]]]]]ԏ]]] ]]^^^^^.ԏ^ ^ ^^ԏ^Џ^ _ҏ_6_t"i_ _"i___˙```0`B`F`t C``` ``a"ia0 Ca@"iaRaZat˙aaa aaabb bԏbb8bD bNbRb^bjbrbvbzbԏb b b bcc, c>cFc^cl"icNcTdd&d@ dL dԏdd֏d؏d܏e ֏e e e*؏eF֏eT e^ebejene|eee܏ee eeeeeeefҏf"֏f@"fRЏfVfjfvf~f܏f f֏f؏f֏f f f؏g ֏g g"g&g.g2g@gJgZg^܏gxg gggggggg֏g؏h֏h h h&؏hB֏hP hZh^hfhjhxhhh܏hh hhhhhhhi"֏i&؏iB֏iP iX ib؏i~֏i iiiiiiii܏ii jjjjj*j.j2j֏j؏j܏jjԏk4 k< kh kkkkkԏkkkk kkkkll l8:lVlZlxlԏlЏll l l m m&m.m2m<mJԏmRmVmtm mmmmmmmmԏn0 n8 nd nrnzn~nnԏnnnn nnnnnno oԏoԏoo؏o܏o֏p֏p p p"؏p>֏pL prppppppppp܏pp ppq qq"q&q*qP"2qbqnqvq~Џq܏qq q֏q؏q֏q q q؏r֏r r&r*r2r6rDrNr^rb܏r|r rrrrrrs֏s؏s.֏s< sD sN؏sj֏sx ssssssss܏ss ssst tttt֏tԏt؏tt܏u֏u, u6؏uF֏uZu^ubufutuuԏuu܏uuu uuuuuuvlvҏv2v6vBvFvJvVvjvnvvvzv!Bv؏v֏vvvvvv w֏w"؏w:֏wP wZ؏wj֏w~wwwwwwԏww܏www wwwwxx x2ԏxx x x xxxxxxx!Bx؏x֏yy"y$y@yJyL y y y y z؏zԏz֏z܏z*zrԏz z z zzzz{ԏ{{{0{< {F{J{X {f{n{x{ԏ{{{{ {{{{{{||| ||Fԏ| | | |||||ԏ}}}$}0 }:}>}L }Z}b}l}zԏ}}}} }}}}}}}}}~~"ԏ~Zԏ~ԏ~~֏~؏~܏֏"*.LVfj܏ ֏؏֏ "0:JN܏ht ~ .2:>LVfj܏ ֏ ؏  ؏":>FJhr܏  ֏ ؏  *؏؏ԏ֏܏ԏ 4 < ^bfxԏ  ԏ0< FJVZ^bԏ  ( RVZlzԏ  ԏ$0 :>JNRVvz~ԏԏ"؏&6ԏ:֏>܏֏֏ ؏  ؏֏ ".2܏6T` jn| ܏  6:>BZ؏r؏֏ ؏  ؏֏,6FJ܏dp z~ ܏ "*BFJN֏jԏn֏r؏v܏z ؏",6BԏFJ܏ht ~!)Џ$ HHX!yԏ܏ *؏L V؏rvԏ܏  ԏ  !<T  @hP|     ( < P       Ld    ( < P  \<ߙ\"-p!BHlx !r4Ld|JNԏZ^j܏n !~؏ ؏&*ԏ6:܏Xd nr~ԏ  ؏ԏ܏4 RVZhvx    p~ ,  $.0 :>JV^bf  &2:>Bx   &*6BJNR 4BNP| ,68 BFR^fjn  @JL VZfrz~$.0 :>JV^bf!D? (8 NVԏZbj܏ " ".2P` v~ԏ܏  , 6:Xh  .2BF  BJh   `p ?  4D Zbԏfnv܏ ߙ $<Tl"-!>Dht ~ "BHlx  ԏ܏  8! f 8 NԏRVbfj܏ V\   <L `? (4 Td ~ԏ܏ D \ p     !\ d  ԏ".26܏P ",T` nr$2rx ( BHp|  ?8D RVfj"*>BԏJRV܏jx   0 JPx  ԏ܏ (T              4Ll! 8D NR^brvèø "0< FJhx ĎĖԏĚĢĪ܏ JRpŘŤ ž  (8 L?~ƆƤ  , L\ rzԏ~džǎ܏Ǧǰ   0 D X l Ȁ  ( < P d x ʌ 0!˄˾ "&Xh |"̸̲ $4 JRԏV^f܏~͈ ͘ Ͱ      (hΈ!&,T` jnz~ώϒ "$LX bfЄД Ъвԏжо܏ fnьѴ  "&DT h?ҚҢ <H hx ӎӖԏӚӢӪ܏  8 L ` t Ԉ Ԝ 8| Ք ը ռ    !<v|פװ ׺׾ 4"jpؘؤ خزؾ  ԏ܏6@ Pٔ ٬      ܠ!NT|݈ ݒݖݢݲݶ  "BHp| ކފޖ޴ ԏ܏ (l ߄ ߘ ߬    !l  @P d"   2:ԏ>FN܏fp ԏ܏ ԏ܏ , FԏJN^b܏f ԏ܏    "Jr"48::<b>@FNJvLNR\^>`ffnp"tJxrz|~:b*RzBj 2Z"Jr:b*Rz,Bj  2Z(*$!f,:>BD.NVZ Pb`2t`$ 2 Tbb `hbb` "&bL!#b``b`zb`2b:?\ ^ V|\\ \ \ \ ` b d B\ r\ \ \@MR`r\`̙̙bdLbdbdVbZdpƙ~`RB``ʙlʙxbd`"b&dnbrd`bd`bdF`V`dvbd\`bdJ`N\z``bd\ƙ`bdƙ`2b6dfbzdMb"dzb~dbd2`NbRdbd``bdbd\Sbd ʙ ʙ  Fb Jd b d b!d!Jb!Nd!b!d""fb"vd"b"d#ƙ$b$ d$>b$Bd$|ƙ$b$d%S%Jb%Zd& &ƙ'b'd'Rb'Vd'ƙ'b'd'ƙ(L̙(\̙((b(d)Jb)Nd)vb)zd)\*\+\-d--d-.P˙.\˙... ԙ. ϙ/ ԙ/`/|/ C/d0" 0P" 0 C1X 1˙2nd2x223$˙30˙3333 44" 4h" 4 C5X 5x˙5d566<!ę6T!ę6p ޙ6 ޙ6˙6˙6˙6˙6˙7r\7d77d7 >8 98 88 98D 8\9\: ;d;2b=H>b^?.f?V?f@fBfC`BEF2fKlRnSjlnZfqfs:ns>lw`w!w!xzrx~nxfyz{HF{#,PRJlJJ,RJRJ?hjR&ptt8N^VtN#v`rxz^VzŠxx&zŦz^zzzz|*~RzNԏRV܏^֏n؏ۢ֏۰ ۺ؏֏ $.2ԏ>B܏`l vz܆ܒܞܢܦܾҏ֏ҏ&֏6ҏF֏݊ҏݞ0֏؏֏ ؏ ֏&*8BFԏRV܏tހ ފގޚަ޲޶޺ԏ $ >ҏN֏^bjn߀ߊߎ߬߸ ֏؏֏ *؏:֏JNVZhrvԏ܏ ԏP \ vz  &(HT f00 $.0 :>JVbfnҏҏ֏ҏҏҏҏFҏbҏf֏~֏ҏ ,8"JЏNz  0:< NR`n ֏ҏҏ.^ҏ 6 ҏ 2T^ҏz ҏ֏,">FԏJRZЏ^܏f    $@ H 6^p  6 6 6TJXd zҏTԏ ܏8 Z֏ "&.4T^` nrvz֏ *֏.hJRV\| ֏"$ .2:>Hhrt ~ҏ ",LVX bfr~ҏԏ܏,8 BFT `  ԏ֏܏؏>؏ԏ܏ &*6>ҏX FbZlԏ܏   ԏ܏ 6ԏ܏ X fh ԏ܏ T |  F *,6>DRԏZ܏h vx   0 J֏Zf֏v$$(2^`j֏z"(bdv|V lj؏z֏ fvzҏd*֏2@!ob֏!o!o!oX!o!o!o!o  !o X!o !o 0!o  !o     "2BR؏b֏r؏֏   f26JNԏRVЏZ܏^b ؏֏֏  "JҏZ֏֏"ҏ֏  :ҏVҏvҏ  "ҏZҏvҏҏҏ  "&2>Jҏҏҏҏҏҏ2֏Zbfj ҏ֏"<FH R^jv֏؏؏"֏Fԏkԏ܏ *6BNR^x    ".:JNZ^t~   "26BF\fh r~ ,68 BR֏z   &*6:PZ\ fvz  *:>JNdnp z  &6:FJ`jl v  ҏ & . 2 6 P Z \  f r v             ! !!$!.!0 !:!0!"!2!"!0!2" "ԏ"""*Џ".܏"2"P "h"ԏ""""Џ""܏" """""## ԏ##܏#@#L #V#b#n#z#~### f######$ $$ f$8˙$J$Rԏ$V$^$fЏ$j܏$n$ $$ԏ$$$Џ$܏$$ $ %˙%%"%6֏%ҏ%ҏ%֏%֏& ҏ&D &X&n&v&&Џ&&&& f'' '.'< f'J'l˙'˙'''' ((&(.(v؏(֏(( f(()2ҏ)b* n*.* u*!o+>+~؏+֏+++,,, ,`,, f, ,,,˙---*֏-R؏-b֏-ҏ-֏.ҏ.jҏ.ҏ.֏.֏.ҏ/Fҏ/z/ 2/ /ҏ/֏0ҏ0Rҏ0ҏ1 ֏1Fҏ1V֏1vҏ11ҏ1ԏ1܏12( 2@2` 22 303< 33 3ҏ4t4 4 444 55 5ҏ6^ҏ6n֏666666666$67777 7888J8N8R8`8l 8ҏ8888888899 9999*969:9F9R9V9Z9h9p 9x 9ҏ9999999 9: :::&:*:6:nҏ::::::: ::::::;;:ҏ;Vҏ;r;z;~;;;; ;;;;;;;> ܏>,>8 >B>N>Z>f>j>v> > > >0>">2>">0?2??&ԏ?.?2?>Џ?B܏?F?d ?r?v?z?? ? ??? ?@@@@@"@.@>@d@p @z@@@@@@@ @@@@AA A$A.A0 A:AJANARA`Ah Ap A~AAAA A AAA AABBBB"B2B6B:BHBT B\ BfBB BBBBBBBBBBC C CCC4C\Ch CrC~CCCCCCCCC CCCD(D2D4 D>DBDNDZDfDjDvDDDDD D DDD EEEE&E*E6EFEJEVEZEpEzE| EEEEEEEEEE FFFF*F.F:FJFNFZF^FtF~F FFFFFFFF FFFFGG G G*G, G6GBGNGZG^GjGzG~GGGGG GGGGGGGH H HH&H*H6H:HPHZH\ HfHrH~HHHHHHHHHH HHHI II$I.I0 I:IFIVIZIfI|IIIIIIIIII IIIJJJJ4JBJFJXJJJ JJJJJK K K`Kl KK KK L,L8 L\Lh LL LM M4M@ M`Ml N N, NNN O>OBOFOTO` Oh OrOO OOOOOOOPPP PP$ P, P6PXPd PnP~PPPP P PPP PQQQ8QD QNQfQjQnQQ Q֏QҏQ֏QQQRRRR0R< RFRRR^RjRnRzR$R֏RRRRRRRSS SSbҏSSSSSҏSSSSSTTT(T2THTRTT TbTTTTTTT TUU UU$U.U2UPU\ UfUrU~UUUU֏U UҏVҏVLV~ҏVҏVҏW W6$WbW~֏WҏX*XXX X XҏY ҏY.Y4Y>Y@ Y YY Y ZZ Z<ZNZTZ| Z [[ҏ[@[h[[ҏ[ [\\*ҏ\ҏ\ҏ\ҏ]ҏ]d]]ҏ^4^\^^֏^֏_L_ `2֏`B֏`$aҏaV֏aaab b$ b8 bbc c@cpccccccdd d&d2d6dBdNd^dbdnd|dddd dd Fdd e Fee e4eNeT eeeeeeee effff f*f.fHfT f^frҏf Fff f Fgg g Fg&g*g.g<gH gP gZg^gpgz֏gggggg ggggggh!ohh!ohFhJhNh\hh hrhvhhhh hhhhhhhi hi0 \iFiJiRi`il ii i!oiiiij j(j4 jRjVjZjljx jj jjjjjj kk kBkFkJkXkd kl kvkzkk֏kkkkkk kkkllll$!ol2l8!olblflrllllll ll!ollmmm m@mL mjmnmrmm mm mm FnynFnJnNn\nh nrnvnnnn nnnnnno o ooo,o6֏oNoRoVopozo| ooooooo!ooo!op!op&p*p.p@pL plpx ppppp pp qq.q6ԏq>qBqNЏqR܏qVqt q qqqqqqqq qqrrrrr.r2r>rLrbrfrr rrrrr؏r֏s sss*s8sBsFsdsp szssssssssssssstt tt*t:t>tJtXtbtftt tttttt t t؏u֏unҏuҏu֏u֏uuuv vvv4v@ vJvVvbvnvvv| v vvvvvvvv vvwwwҏw:֏wjwnwzwwwww wwwwwxxxx0x< xFxbxjxnxxxxx xxxxxxxy yyy8yD yNy^ybyny|yyyy yyy yyyz zzz4z@ zJzVzbznzrz~zz z z"zzЏz؏z֏{"{&{2{6{L{V{X {b{n{z{{{{{{{{ {{{| || |$ |>؏|N֏|x || | | u}} }H }`}} }} ~~~"ԏ~*܏~@ ~r~4P`| u؏֏  "6>BRl   &6nr~ 0:>ԏJN܏t  ""*>FZbv~ "ԏЏ܏ , BD ؏֏ &2>FL \ z6֏F؏vz   ".:FNT `     2D!od!o!o!o!o!o!o,< D f Lbh 8Xl!o!o!o!o!o!o2@!op!o!o!o!o!o(!oJ\!o!o!o!o(!o!o!o$:6P!ox!o֏!o!o!o֏@!oX!op!o!o!o!o!o!o` p!o !oX|    "&2Z` !o!o!o!o4!oH!o h` p h!o!o !o2֏`!oT   6H!o`!or֏!o  $ .:Dht  ".BT!o!o!o!o !o!o!o!o!op!o!o!o(!o@!ol!o !o@ P!o  .8Xd rv ,!oL!ol!o!o!o!o h(H  hD\!ox!o!o!o$`p x  !o`!ox!oP p    "l!o!o!o!o x hԏ܏ !o,T!o hV`nԏv܏ !o!on$  $HT jrv6 $(T h$6"ԏ*܏< P 6 !o@!o\!ot!o!o   6>BN^ft !o!oX!ot   "2:>Jrx !o!o!o!o, hLt!o!o!o h @!op!o!o!o!o $  &0T` v~$~66 $!o<X!ox!o!o!o!o!o!o8ߙbd!oߙ8Ld| ߙ4ߙbd!oFߙ!oH!ot!oߙ u(D!oX€!o!o<!oLh!oÈ!oè!o!o 8Ĉ   <H ^fjvņŒŜ $ :BFVfnƀ!oƎ֏Ƥ!o!o!o$!o\!oDŽ!oǜ!oǴ!o֏!o,!oh Wz֏Ș!oȰ!o!o!o!o!o(!o@!oj֏ɜ!o!o!o!o!o<!oT!op!oʈ!o!o!o,8 b֏jx!o˔˸NN $.2ԏ>B܏ht ~̶̢̖̦̊  2؏B֏jnz~͔͢͞ԏͮͲ܏  .4 F؏V֏Ά֏ΖΞΦΪԏ܏ &2>BNZ`nrφϜϦϨ ˙"Џ&*H^fzЄ PЦ֏ж$кҏ֏֏J֏Z` r؏т֏ѦdѶѺ֏!o&֏6֏FNVZpz~ԏҊҎ܏Ҵ  "6LVX x˙ӎӖҏ֏"֏h"z~ЏԒԖԸ P $$4JP b؏r֏՘˙ծնҏBҏR֏~֏֚֞&ֺּҏҏ׈עҏ׾ҏ8 lFҏnt؂؄ؒؔج ؼ"ЏҏDP"bfЏz~٠٬"پЏ.0 B؏R֏v֏چڎږښڰںھԏ܏  ".2>JP^bvیۖۘ ۸˙ҏҏF֏r֏܎$ܼܶ 2 ֏ҏL vݎ֏ݢݼ  $ 2H ޔ l޼  D l\߆߈ߖߘߦߨ߶ߺ!o&0>@NXn֏~ԏ܏ &*6BFJN`jl x N ֏ d&(6֏:DNTjd0 !oN֏!o(N8XNd ~ҏ2ҏB֏VXbҏrxv|֏$֏֏  "6@JLVZlv$$ .8BZ\f֏v$֏ҏ&֏:<FҏV֏~ҏ$$$ҏ֏$$&$6֏R$b$r$֏0<Pbdrt .0>@NTht   .0>@NPbdrt$$ $ 4@Tfhvx "&8B$p~$*,:<JLZ\jlz|0:$`nt$0<P\f֏t(2$`nt$*ҏ:֏nҏ0>H*0:DVX(6:@NP^`np|0>LXbt֏$&0^$rҏ֏ ҏ֏6ҏF֏rҏ֏֏ҏҏBDN֏^$rҏ$֏2@NXfhvxҏ֏ҏ֏֏Zҏ֏֏ҏ֏JҏZ֏ҏ$ Nҏ^֏ҏ֏ҏ$FHV`ҏ֏$2֏BHR֏bҏҏҏ64>DRXrxҏ֏0Fҏ:<JLV\np $j֏z<*6:֏JPZ<p~<"ҏh|֏0bdr|         " $ 6 8 n p ~֏     $    ( 2 Fҏ Z$ ^ r֏ zҏ ~       $ " 0 > H R p!o ~             . 0 F H R T b j n t          *4H$ .8FHVnpz֏&,@Nҏnpz֏ҏ0bdr| &0<PZҏҏ  &(6@np$ҏ&$^֏f&rt  $>@RT^֏n$&&(:DRT^$@NTfpfp~h8 hJ Bҏ֏h Z \      !ҏ!Fҏ!!!""ҏ"N"r֏"zh"~"ҏ"ҏ#2#8#B#H#R#`#p#ҏ#ҏ#$$F$H$V$`$ҏ$ҏ$$%F%H%V%`%ҏ%$%%%%&"֏&2&8&Bҏ&bҏ&r&x&&&֏&&&&ҏ'2'P'''''''''''((("($(2(8(J(L(^(`(n(t((((((((ҏ)^)`)r)x))))** **,*H **++ +++*+0+ ++++,,, ,V,X , ,ҏ,,,- -"-(-6-P-^-` -֏-- -h- --...*ҏ.:֏.b$.rҏ..../"֏/>/D/\/vҏ/$//ҏ/֏/h0&0L0Z0d00000ҏ0֏1$1.ҏ1>1D1R1T 11 11111111 2"֏2628 2Jh2f2l22222 2؏33 333"ԏ32܏3:3X3b3d 3r3v333333333 334 4 4&4.4F4H 4l4z4444444445 5, j5ҏ5֏5$6ҏ6֏62$66֏6֏78 h7J7Z֏77777$8&8>ҏ8B֏8J8Nh99 h99::::V:X :: :::::::; ; ;;(;P ;t j;; ;֏;< <h<.<4=@=f=p=~=======>.>0>^>p>~>>>!o>>>>>>>> ????6?l?~?????????????@@@@*@,@8@F@P@d@@@@@@@AAAA*A0A>AHAVAXAfA~AAAAAAAAAAAABBB B.B8BRBTBbBpBBCCC"C,CBCjClCvCxCCC CD0 DVDXDfDpDDDDDDDDEBE`EEEEEEEEEFFF"F$F6F8F^FpF~FFG &G"G$G2G<GVGdGrG|GGGGGGGGHHH.H0H>HHHR&HfHhHvHxHHHHHHHHHHHII ILIVIdIrI|IIIIIJ$J0J>JDJVJ`JJJJJLbLdMMM&M(MMMMMMMMNN^N`NNNNNO>O@OOOPPPPPPQ*Q,Q<Q6R:RRRRRSSSS SFSPSbSpTTTT,TTTTUVUXUfUpUUUVVBVDVVW W(W6W8WFWHWZWxWWWWWWWWWWX XX*X,X:X<XJXXXfXhYYYYYYYYZnZpZ~ZZZZZZZZZZZ[[ [,[B[L[z[|[[[[[[[[[[[[\\\\\*\,\:\L\Z\\\f\|\<\6\\\\\\\\]]]&](]:]<]J]L]^]d]]]]]]]]^ ^:^<^N^P^^^^_:_V_X_~_______```2`4`B`P`j`l`````````aa aa*a,aBaDaRaTabapaaaaaaaaab:b<bJb\bjblbzbbbbbb<b6c c cc,c6c8cFcPc^c`cncccccccddd*d8dFdHdVdldzd|ddd<d6dddeeee"e$e2eLeZe\enepe~eeeefff.f4fBfDfRf`ffffffg"6g~ggggghhh"h$h2h4hFhHhZh\hlhhhhhhhhhiiii"i0i>i@iJiXifihiriiiiiiiiiiiijjjj&j(j6j@jfjhjzj|jjjjjjjjjjkkkkk&k(k6k8kFkPkkkkkkkkkkl ll"l$l2l<lRlTlflllllllmmmm m2m4mBmDmRmTmbmlmzm|mmmmmmnnnnn*n,n@nVnXnrntnnnnnnooooo,oBoDoRoTofohovoxooooooooooooppp p.p8pJpLprpppppqqqqqbqqqqqqqqrrrrFrPr^rhrrr \sߙs*s,sBsLsbslsssssssssss!ottt&t(t6t8tBtF tHtVtXt~tttttttttu u uuu0u<uLu^u`urutuuuuuuuvvvv(v2vRvTv^vlv~vvvvvvvvwwBwDw` wnwwwwwwwwxxxx&x(x \xߙxxyy y"y,yByDyVyXytyyyyyyz2z4z>zLzvzxzzzzzzzzzzzz{{{.{0{B{D{j{p{~{{{{&||||(|B|P|^|h||||||||||}}}} } \}ߙ}}}}~~~2~4~F~H~d~v~x~~~~~~~~~&"$v|(68JL^`npz&(2t~"Џ*6F0V2l |   &*6BFVfj  *:>BPX ` nrv    "0< R^h   ( 2T` jvz   (24 >JZ^jx $0 :JNZhrv~   "&2>BNZ$NRV  W ,68 FVZ  $.0 :> W  *6:JZjp  W *.>NTx  "2BHht ~ W &,LX bfrv   0< FJVbnr .:Dx 6:BJ\ l   d p      *LX br    ( :H x  $ .8d \ԏ܏( 8bfjx F$t  $ .2>BNZ^j$vz| 0 WBRXn V$Zjvz  W &,6>LVX fvz 4 Dp  $@JL V   "0:< FJ W "2BHV$bt  "(:LX bfrv    Lh ~   r $ .>`l v   8 FH` np$(    $ 24bfhv| fj @L VZfjv~$V "$.6DNP Zrv  W"0:< J^`jv  *.>NTt  W , 6:JZ`v  W .>Dht ~ W &,LX bfrv   @L Vbnvz    b   *:\h r  h,6:T` jz    (JVf   ԏ֏؏܏ &*:DNRԏVZ܏^  l*.6DNP Z^pz~  *.:HRZԏ^bfj܏  f&: n(jnv FT fp   "2>BT^bn  "ԏ*.܏2T^` n~–ԏ  4 BFXbfnÄÎÐ Þîúü  p0 RVhrvԏ~Ă܏ĆĨIJĴ ԏ  &.6HRVԏZ^܏bŌŖŘ Ų  FJVlvx ƈ ƖƚƬƶƺ    u4 jnǀNJǎǤǮǰ  .2DNRhrt   >TH VT` nr~ɂɔ ʖԏʚ֏ʞ؏ʪ܏֏ ؏&֏Jhrv~˂ː˚˞ԏ˪ˮ܏  *ҏ:֏Jҏ̂0ҏ͎֏͞ͺ0"Џԏ܏0 bfjnr~΂ΐδξ ֏؏2֏@ J؏Z֏jnvzψϒϖԏϢϦ܏  "ԏФ а о0"2n֏rvz~іњѨѶ   *, :JNZhrvҐҜ ҦҲҾ4@ JVbnrӎӒӖӚӞӮ  2.ԏ26BFЏN܏l zԈ PԚ$ԞԲԸ ؏֏*֏:BJNRdnrԏz~Ն܏լնո   *, 8˙JRԏV^fЏj܏֐  l ؏&֏6>FJN`jnԏvz܏ׂר״ ׾, f>BNRZ^bjr n*؏:֏L٢٦ٴپ  ؏֏>L fh v0ڲ2؏֏ԏ&*܏2Xd nrۂێۚ۞ۢۺ2 f &26ܠ n؏֏FJXbd ݮ؏ݾ֏2 f2ԏ&.6Џ:܏` l˙~ކԏފޒޚЏޞ܏ 0"Џ2.؏26:>BV֏Z^p ~ߊߐߴ߾  4@ V^bz|  p֏؏֏ &؏6֏FJRVdnrԏ~܏ ԏ $ 208"B2V֏Z؏z֏ ؏֏ԏ܏  "&6BNRVnԏ  0"2֏؏֏ ؏֏"*.<FJԏVZ܏x ԏ   0"22:ԏBFNR܏p |     .@JL VZbz   NVZ`n ؏֏&8BD NRZr   Vbhv ҏ֏ ҏ(8\l \P n؏֏ j؏z֏2 f   ؏֏"FJN`jl     2:>DRdnp  :؏J֏nvz  :BFLZlvx  JҏZ֏jҏҏ \ , < FJPZ2jЏnԏ܏   *.2@JL Zrz~  ؏&*8FJ`jl v~  FNRXfx ؏֏ "4>@ JNVjr   Zflz ҏ֏ҏ2ҏP`vҏ W \*0BL Wbp  N$ 2:ԏBFRЏV܏x ֏d֏ d&*.<JL V֏  2ҏZh Wz~ "*.8F$`jl ҏ֏  @JL VZjvҏ W .2>JNҏ֏֏&*26@`jl vzҏ$ W6:NPpz| ҏ֏  @JL VZfr~ҏ W&(HRT ^jv֏ҏ֏ @JL Z^jvz~ *ҏ:֏JNVZd   ,68 FJX fjrx  ֏ "$2$LVX bn| $  "&,:$T^` nr ҏҏ֏     * 8 B D  N R b n z ~  ҏ  W     ( 2 4  B F R ^ b     $          4 Fҏ bҏ ֏ ҏ         0 : <  F J V Z j t ҏ ֏              & * 4 T ^ `  j n ~             "*Џ.JRԏZ^n܏   fԏj֏n؏r~܏ *4>Bht ~ҏ* 6  $ X z~  |     6,< 6t 6 6 6fh  @ bfr| l x  "T.26DRT ^bnt  6.6>FT^b   $0 :Bp h    0 , 8 ֏؏ ܏ԏV֏d l v؏֏   ԏ  ܏ < H  R V b f r ~          ҏ ҏ! !.!6!@!`!j!l !v!֏! !h!!ҏ" "."0 ">"F"J"P"p"z"| """""""" "֏" #ҏ#B#L#v֏######## ####$$$ $6$>$B$H$h$r$t $$$$$$$ $$$$%%&%( %>֏%Rҏ%֏% %%%%%%% %&&& &,&6&8 &F&J&Z&^&f&l&&& &&&&ҏ'' W'6'>'B'H'h'r't '''''''$''' '''(2֏(D 6(Vҏ("(Џ(((ԏ(((܏) )*)0)B)Jԏ)N)V)^Џ)b܏) ) P)$)))))**֏**"d*<*J֏*N*\*l*~d* **ԏ***Џ*܏* +؏+֏+$ +4+L+`N+j֏+x ++++++ԏ+܏++++ +,,,&,<,F,H ,T˙,f,nԏ,r,v,Џ,܏, , l- -֏-؏-H -P -Z؏-v֏- -----ԏ-܏--- --..ԏ.J.R.\... ...../ /֏/"/&/4/T/^/` /n/~///// ///"/֏0؏0֏0, 04 0>؏0Z֏0h 0v0~000ԏ0܏000 000001ԏ1ԏ2֏2J؏2R܏2f2 2222333383D 3N3R3^3j3v3z3~3ҏ33405 565:5F5P5Z5j55 55555556P 6\ 66666666 667 77D 7f7j7v77777 7777778 8, 8F8J8V8d8n8r88 889:;( ;>">>>>>> ?< 6?L 6?h?? ? ? 6? 6@ @, @\ @d 6@@ @ @@@A 6A 6A0A@ 6AXAAAABBB BB"B&BFBTBtB~B BBBBBhBBBBCC CCCC"C.C:C>CZC^CjCpCCC CCCCCCCCЏD DTDD$ D6hDD EE E0FFЏFJFRFVFp F|"FF F"GGGG"G&ЏGD GrGvGGGGG GH HHH H.H0 H:H>HJHPHtH~H HHHHHHHHHHHH IIIII8IBID INIRI^IvTIIIIII IIIIIIIJJJ J"J&J2J>JBJbJnJpJzJ~JJJ JJKK>KD K^hKK KKKKKKKLL L LLL>L M Nx N NO@ Oh O O P@ P` P QR R R~ԏRR֏R؏R܏R֏S S S؏S:֏SH S^SxSSSSSSSԏSS܏SS SSTTTTT"TF֏TVTZT^TlTzT| TTTTTTTT TTTTTUUU&ҏUNҏUl UҏU U V V( VJҏV`V֏W֏W$W"WP Wd W W WҏW֏WҏX֏XҏX&ҏXVҏXf֏XҏXҏX0X֏Y*ҏY:֏YJYNYVYZYlYvYzYY YYYYYYYYYZZ Z*Z6ZBZNZjҏZҏZҏZZ֏[ҏ[~ҏ[֏[ҏ[֏[֏[\\\\(\6\8 \B֏\R\V\^\b\l\\\ \\\\\\\\] ]*], ]6]:]F]R]^]b]f]ҏ]ҏ]ҏ]ҏ]^ҏ^F֏^V֏^f^l ^~h^T____ _._0 _>ҏ_N֏_j_~__ 6___ 6_ 6``` 6`0 6`B`P`Zҏ`|`````` `ҏ` 6a 6aa<aL 6abapa| a֏aaaaab bb b"b&b>bBbJbPbpbzb| bbbbbbbbb bcccc&hcFҏcbcfcncrc|ccc ccccccccd dd d"d&d2d6dBdNdRdz֏d~؏d֏d d d؏d֏d dddde eeԏe&e*܏eHeT e^ebenezeeeeԏe֏e؏f֏f$ f, f6؏fR֏f` fjfnfvfzfffԏff܏ff ffffgggԏh.ԏh6֏h:؏h>hB܏h֏h h h؏h֏h hhhhhii(i6iBiHiVԏi^܏ibiii iiiiiiiiii j֏j j֏jjjjkk k kk.k:k@kNkdknkp k~kkkk kҏl ֏l&֏l4 lBlNlTlblxll llllllll lmmҏmrm Wmҏmҏm֏m mmnnn(n2n4 nBnRnXn|nnnnnnnnnoo ooono| Wooooooo ooop $pp(p2p4 pV֏pfҏp֏p ppppppp qqq.q:qDqRqhqrqt q֏qqqqqqq qqrrr(r2r4 rBrVrbrhrvrrr rrsҏs.ҏs>֏s֏s sssttt"t$ t.tJ֏td tvhtҏuB֏uX"ujЏunuuԏuuu܏u uuuuԏuvv Џv܏v4 vX Pvj$vnvvvvvv֏vvdvv֏vw ww.dwL w^wfԏwjwrwzЏw~܏w w؏w֏w wxxNx֏x, x6x>xNxXxfԏxn܏xrxvxxx xxxxxx y˙yy"ԏy&y*y6Џy:܏y\ y ly y֏y؏z z z؏z.֏z< zJzVz\zjԏzn܏zrzzz zzzԏ{2{6{D{R{h{r{t {{{{{{{ {{{{| |$|.|0 |B|N|d"|n֏|r؏|֏| | |؏|֏| |||}ԏ}܏}}0}:}< }J}V}nԏ~~܏~؏~ԏ~֏~֏~ ~؏֏"0:>ԏFJ܏p| ֏ҏ*2^$ .2>JRVZrҏ֏ҏ֏ҏ&Xfh ҏ.ҏ>֏N֏^֏n ֏ҏ R֏~ҏ֏.4BDҏ 0:< NVZrt ~֏hҏ֏ҏ֏֏"ҏn֏֏؏֏ ؏֏ԏ܏4>@ NR^fjԏ  2B֏F؏b֏p z؏֏ԏ܏  "&>ԏT `  ֏ *, >FJj֏z֏   "h>ҏRҏfjrx   ֏.2DRT rv~  "&2DNP rx "24 Fhbfnrv  "&2:>Vhp "8BD RVbjn  0:< NRZ^bx  "&.2@JNZp|   ԏ֏؏܏ ؏ $.2ԏ:>܏`l vzҏ&*.2:>Bh  4 V؏x ؏ԏ܏  &26:Rԏ  0< FJVbn"Џԏ Џ"܏&D bf|ƙԏЏ܏ ˙^hh 4D Rht  hh8H Vlx  " ".8\h rv؏ ؏ "ԏ.܏HT ^bzԏ  ԏЏ܏ *6@dp ~ԏЏ܏ ԏ ܏8 J\ 2nhhhHX f|  &JRjp | >B؏NԏR֏^܏֏ ؏֏ԏ܏$0 :>JV^bfҏ rҏ ؏2֏BFNRVhrvԏ~܏  $ f6>BFNRZ^ t؏؏֏@JL ؏֏ f  ؏"&*.2F֏JN` nz  , 6BJNf֏j؏֏ ؏֏ԏ܏$ .2BNVZ^vԏ   0P\ jrv  pҏ֏؏֏( 2؏B֏RV^bpz~ԏ܏ ԏ ( ^l z| ؏֏  < JNZdvz   ֏",>LVX fn  ,68 F~   r.ҏFJN\jl t ~   ԏ֏؏܏0 RVblvzԏ܏ ҏl  $:>BZbhrv  r( Vfnt~ԏ܏  f"&2Fr f( JN`jl t   "ҏL r~ԏ܏ ԏp |  ҏ&.4>B`jl z~   8BD NZfr L r~ԏ܏ ԏ  :FHRVpz|   (24 BFVXbf < t ŠŒ ®´  2bd ~ÂÄÒäîð  2ĦĬ f2HRT bŬ   "(6HRT ^bzƂƠ ƪ *<FH fh vǂǎǖfl fȂȄȎȒȶ "l ɤ ɺɼ  8 Bbʒʔ ʮʲʴ &*b˂ f"6̢̘̤̂ ̲ 4 NP rx͆ͤ͘͢ ͮͲ JL fjlzΌΖΘ ζ  6:>V^dnrϐϚϜ ϮϺϼ 8`l x ԏ&6֏B؏J܏z֏ш ђ؏Ѣ֏ѲѶѾԏ܏  "&2>JNRjҏ҂҆ҊҎҒҖhҞҢҪҲҶ֏ҏ,< N`l ӆӠ Ӳ֏Ӷ؏֏ ؏֏ (26ԏ>B܏Fht ~ԂԎԒԞԪԮԲԏ0 < r֏Ղҏ"Џ"r֏v؏֒֏֠ ֪؏ֺ֏ԏ܏$0 :>JNZfjn׆ԏל ר  *6BFrvz،ؘؖ آئزضԏ܏ $ 6H 2Zhvz~قنيْhٖٞ٢٪ҏ 6DP jڄ ښڞڪڮH T ۪ԏۮ֏؏&܏*p z؏ܖܚܦܰܺ  "&Vp݂Џ݆ݚݦݪ  ,68 FRj؏ސ ޚ؏޺  *26߼   $0 :FRZ^  f*6>FЏh rvz~˙Џ "Fҏ؏ ؏0< FJVbjnr   , 6BNVZrz  z,8 BNZbf zҏ zX$6>LX frz~ 0@` $\!) JNR`np z~ "0:>FXd nrvЏ  $.2HRVbfx  f!$4 (24 >BNZbfjJ8D NZl &2:>Bl zv  *<H ` zr  z$6:PZ^x  &*.\h vЏ   0:< FJVbjnr   NԏR֏V؏Z܏^ ؏ԏ܏$0 :>JVbfrҏ؏ ؏:>JT^bԏnr܏ ԏ\ h  HVX >hB $.0 B\ ؏ ؏ԏ܏ *, :F^ԏt  $24 JNXbd v 0:< JVnp h *8Xbd x fJ f! .0>@Z^jt !8FHRXfhrv ҏ $ ԏ؏֏܏֏, 6؏F֏VZbfxԏ܏ ҏN֏bnh֏ҏ,:LVX jv   (26PZ\ n֏؏֏ ؏֏ԏ*.܏LVX fԏ    "ҏ 4" FЏ J b h z ԏ   Џ ܏    J   ƙ  ԏ  " .Џ 2܏ T  d˙ z  ҏ   ֏  ҏ 4 B T ^ `  j             fҏ r z          (  Vҏ b j          JҏR֏V^   6:LVX bfr| "z؏֏֏ ؏֏ $.2ԏ>B܏`jl zԏ  ԏЏ܏ *2ԏ:>JЏN܏p ~ԏ܏  2 hJ֏NRҏ^b  0:< ` zh~ҏ(24 FRdrt ~  h*ҏ.2>x    < ^bnh֏ҏ  .2P^` jrz  h֏"ҏ.2lz   8 RVbhҏ *.LZ\ fnv  hҏ".hv   4 fjvhz֏ҏ &( :FXfh rz  h*֏.2ҏ>B|       @  Z ^ jh n ҏ    !!!"!$ !6!B!T!b!d !n!v!~!!! ! !!!h!"ҏ""""."h"v""" """"" """## #, #N#R#^#bh#֏##ҏ####$ $$ $.$2$P$^$` $j$r$z$$$ $ $$$h$%֏%%"ҏ%.%2%l%z%%% %%%%% %%&&& &8 &R&V&b&fh&ҏ&&&&&''' '*'.'L'Z'\ 'f'n'v''' ' '''h'(ҏ(("(.(h(v((( ((((( (())) )4 )Jҏ)bҏ)t )))))) **ԏ*.؏*2*:֏*J܏*z֏* *؏*֏*******ԏ**܏+ + +"+&+2+>+J+N+R+j+++++++ ++,,,֏,"؏,B֏,P ,Z؏,j֏,z,~,,,ԏ,܏,, ,,,,--ԏ-X -d ---- -------- --.. ..".&...r.zҏ.ҏ.$. .".Џ./"/Fҏ/^/// / /////00 000"0<"0N֏0^֏0b؏0~֏0 0؏0֏0000ԏ0܏11 1 111*1Bԏ1 1 1 1"1Џ1222 2 222222 2233"3.36ԏ3:3>3FЏ3J܏3R3p 3~333333 333֏3؏4֏4 4&؏46֏4J4R4V4\4jԏ4v܏444 4444ԏ5, 58 5R5Zԏ5b5f5r܏5v5 55ԏ555Џ5܏55 55ԏ666܏66, 6:6J6P6p6z6| 666666 6 7Rԏ7V֏7Z؏7^܏7b7 7 7 777888"8<8H 8R8V8b8n8z8~88ҏ889$9D 9P"9bЏ9f9z9999 9:":Џ::.:::B:N:d :z: : : ;; ;; ;*;:;T;` ;j;n;z;;;;; ; < <"<&<2<< >*>.>:>D>N>^>x> >>>>>>>>>>??? ? ?"?&?2?8?X?b?d ?n?r?~?????ҏ? r@ r@@ @x @ @ @@@@@@AA AAA*A6ABAFAJAAAAAAA BBBB&B*Bh Bp B BBBB BCC CC"C؏CCԏC֏D܏D2֏D@ DJ؏DZ֏DvD|DDԏDDDЏD܏DD D֏D؏D؏E ֏E E"؏E2֏EBEFENERE`EjEnԏEzE~܏EE EEEEEEEEԏF, F8 FZF`FrЏFvF֏F؏F֏F F؏F֏FFFFGG GԏGG܏G<GH GRGVGbGnGzG~GGԏG G GGԏGGGG܏H H"֏H2؏HFHJHV HHҏHHHҏHHH I fII"ԏI*I2I6ЏI:܏IFIh Ir֏I˙IҏI֏I"IЏIIIԏIIJJ܏J( J2֏JH˙JZ؏J^֏Jz֏J J؏J֏JJJJJJJԏJJ܏K K K"K&K2K>KJKNKRKjԏK K KKԏKKKЏK܏KK K֏LLԏLL"L*ЏL.܏L6LX Lb֏L L fLLԏLLLЏL܏LM M֏M"M*ԏM2M6M>ЏMB܏MJMl Mv֏MMMMMMMMMMMNN NN"N&ԏN2N6܏NTN` NjNnNzNNNNN N ORԏOV֏OZ؏O^Of܏O OOOOOPP P, P6P:PFPRP^PbPfP~P P PҏQ Q>ҏQx QQQQQQQQ QRRRR&R*R R RR RҏS SSD SXSjSvS~SЏS S SSTTTT*TDTP TZT^TjTvTTT T TT fTU UU, fU:URU^UfUnЏU U˙UUUUЏU V˙VVV&V.ЏVP VhVzVVVЏV V VVWWWЏW8 WJWT fWfWp W~W fWWWWWЏW X˙XXX&X.ЏXP X`˙X~XXXЏX XXXXЏY YY&Y*Y6ЏYT Yp YYYYЏY Y Y"YЏZZZ"Z*Z2ZL Z\"ZnЏZrZZZZZ ZZZZZЏ[ [0 [D˙[V[b[j[rЏ[ [[[[Џ[ [ [\ \ԏ\֏\؏\\܏\ ] ]]]$].]:]X]d ]n]r]~]]]]]ҏ]^^0 ^Z^z^^ ^$__8 __ _`&`< ` ```aaa"a<aH aRaVabanavaza~a b b$ bFbJbVb`bjbzbb bbbbbbbc c cc8 cnc cc dd d( dDdPddd ddde eRel ee ee f fHf֏ffԏg؏g܏gRg g؏g֏ggggggԏhh܏h$h0 h:h>hJhVh^hbhfh~ҏh֏h FhҏhhhЏhhhhhhTiL i`!ij0i"iЏiiiԏiiii܏j jjjjj"j, j>jXjd jrj~j֏j؏j֏j j؏j֏jjjkԏk܏k,k8 kBkNkRk^kjk~ԏkek k ll l*2l:؏lJ֏lZlbljlrlllԏll܏lll llllmmm mR*mVmbmfmz2m2m˙m$mҏn0n"n*Џn.nBnJԏnNnVn^nb܏n nnnnnnnn2n؏n֏nnoo oo"o&ԏo2o6܏o:o`ol ovozoooooo$oooooo2opp؏p֏p.p0p\ph pvpp pppppp2ppq 2q˙q"ҏq2q:q@qNqVq\qjqrqxqqqqqqqqqqqqqqrrrr r*rF$rV$rfrprrrr rrrҏrrr֏rss$s.sJsXsb0slsҏsss$s$t $t"t,t<tV$tf֏t$tttԏt܏t tt ttuuu u0 u8 uJuRuXu|u uuuuuuuuu v ؏v֏v2v:vFvPv^ԏvf܏vjvv vvvvv fvvw wxx.؏x>֏xyҏyҏz2ҏzVz\ zn؏z~֏zz fz z֏{$ {6{D{h{t {{{{{|| |.|2|>|b|p|| ||||} } }2֏}Bҏ}~}}} }}~~$ ~>~L~t~ ~~ "*0\h  ֏ҏ*8dp   , L\ x ֏NV\  .֏>ҏ֏ҏ  *ҏ֏ҏҏ.DP j| ҏҏ0"2 Zbl  *BҏfvzЏҏ֏Џ .T  $ H 6X 6fx ҏ 6  0"Z֏^؏z֏ ؏֏ԏ܏ &>ԏT ` ~ԏ܏  6 6 6.<X l"ԏ܏ $ .Vht   &,T` z֏ҏ "*0\h   4@ V^d  "֏2ҏnr|  *28`l  ԏЏ܏  , NTp   X  "(P .<\h  $NT ԏ܏  .ԏ:܏\ fҏԏ܏ .4  ֏z 0< n֏~ҏ &4Xd  $ FNhvԏ܏ ,8 jx  $ H rv "*0`l   DVԏbf܏| ԏ܏ (4 rx   ҏ0 6@ 6J`l  Fh~ҏ֏  Fҏp  T hDT d T   $@ \ rv|  &6<\h  "(HT   >Tj  $6L\ 6fx 6 6   <H ҏ ֏X  6 6 ҏ0@ 6R\h  6 6 ( 6:D`   ҏ  6֏jҏ   $ :b&*jrx ԏЏ܏ 2:@ht   @L fnt  ,< Lԏ܏ (4 ft  ^l   0T`   <H  $0 jp  ^fl  ԏ܏ 0nҏҏ 0 n  RXbҏԏ܏ ( fl~ҏ ԏ܏ :Hht ²¸ҏ"8JP d|Úäòԏö܏  , nt ĈĠľԏ܏ *8Xd ŦŬ ԏ܏$ 0N\|ƈ $:@V\rxǎǔ hN| ȼ"-!) &֏>FL|Ɉ ɺ .@RZ`ʔʠ ֏ ԏ܏"&ЏH ^bԏfj܏vzЏ˜ ˴ uߙߙߙߙ:hx \̌ߙ̨ u̼ \ h4 \Hߙ\ uͮҏ.<H Μ Ψ ζκ$ ",>HZdr|ϢϬϾ",>HXjtВҏ(2J֏NҏцѐњѲѼ*< JLVҏjnt҆ҐҢҬԏЏ܏ "6<F؏J֏fhӔӠ ӮӺ ԏЏ܏ *.8 FNԏVZbЏf܏jԌ ԚԞԨ  ԏЏ܏ &*.26FPjrxՆՎՔբժհվ .6<JRXbrzԏւֆ֊Џ֎܏ָ֖ ҏׂ֏ז׾֏؏"$.T` nz؀ ؞تԏخزغЏؾ܏   6Ljtيِٞ٪ٰ0L Zb|ڐ$Fҏnҏ֏*.4R؏b֏rt~ܤܰ ܾ2 ҏ֏z֏~݂݌ݖ؏ݦ֏ݶݸ "2&, >FԏJRZЏ^܏fވ ޒޖޚޞޢް   hԏЏ"܏*P ^h vx߆ߎߜ߲߮߸ҏ &*0Bҏ^ҏz~ҏ4 JNT  ԏЏ܏ "2:ԏBFRЏV܏Z| $ "ҏ BJNRbԏf܏   "&*FP \ ݙ.ԏ2֏6܏:؏b֏ ؏֏ԏ܏(4 >BNZbfjҏ֏ F &n$.0&~"Џ&^x !֏20bjvԏ܏ ֏؏֏, 6؏F֏^flzԏ܏ ԏ\M` l ֏ ֏*֏F֏j֏~֏*֏ ֏ D؏֏  2lP ^֏֏֏&0^֏rz ֏.6HT nx  2.֏h x2 l؏B֏RVjtԏ܏0  2$ f: n؏֏ht ؏֏2 f*֏:2R2\˙~؏֏  2:@dp ~   6:P pb֏֏֏>N  "-BRx!)֏26֏֏hh h&h^֏ ֏֏֏"֏2֏0֏&2v֏   @L VZj0v~ ֏  , 6:V0nT֏B֏0֏֏2.6<h   2 "֏FJXx    h l z ~  2 T         < L  b f l      ֏   " & , L X  b ֏ ֏ <  L h  x       , 8  F V Z ֏    "NRXjx *<H Vv֏ ԏ ܏Џ6@ RVԏ^b܏nЏrv Џ "ԏ"܏.:P `"vzԏ~܏Џ  ֏.֏rv  Nhfjp $0 :NRԏ^0b܏fjЏnr ԏ0܏Џ 2 < VX h؏֏  4@ Nbd p  &*0P\ ؏֏ &*P  <H T T  00:2jԏnv~0܏Џ  R^p| ֏0 HT ^bz   ֏"*0\ t T֏R֏֏֏.֏^fl     0 @  J֏ v z        !!$!0 !>!~! l!!! !T!!""$"0 ":"L "l"| """"" """#֏#,#< #R#V#\#|# ##֏#֏$֏$b֏$֏$ $$ %% %2h%Fh%Z%bԏ%f%j܏%vЏ%z%~% %h%h&֏'>2'NЏ'R'V'b'p"'֏'؏'֏' '؏(֏(("(((6ԏ(B܏(\(h (r(v(((ԏ( ( (ԏ(܏(() )h)*h):)֏*, *<*H"*^Џ*b*z֏**++ +ԏ+"܏+&+H+T +^+b+rԏ+v܏+++++ + ++ +,2ԏ,:,>,B,J܏,N,h ,x -*֏-B-F-L-h-t ---- .^֏.֏/ / /ԏ/֏/؏//܏0 0 08 0V0Z0f0p0z000 000000001ҏ121B1v1111111122 2&2*2.222V2X 222222 2 2222233 333*363>h3V3Z3^3l3z3| 3 3333333 3334 4"4&h4.Џ424F4R4Z4b4| 44 4 4 445 555.5H5T 5^5b5n5r5~5556( 60 6\ 6f6j6v66666 666666667 7 7 77777788 8&8*868:8F8R8V8Z9Nԏ9R֏9V؏9Z܏9^9 999999ԏ99܏::( :2:6:B:N:V:Z:^:v6:z:: ::::::; ԏ;;܏;8;D ;N;R;^;j;r;v;; f;;;;;;<4ԏ> > >>> >>?? ??,?8 ?F?R?Z?b?x????? ???? @@*@4@>@Bԏ@N@R܏@p@| @@@@@@@@ԏ@ @ A AA(A2A6A>ATA` AnAzAAA AAAAAABB BB, B:BPBZB^BfB|B BBBBB BBBC(C4 Cx C CC CCCCCD DD0!oDD!oD!oDDDDE ԏE܏E E<ElEzҏEEҏE!oE!oF !oF,!oFL!oFl!oFFFFFҏFG WGVG\GG fGGGHH Hh H| HH HHHHHH III<!oIP!oI!oIIIIJ JԏJ"܏J0 J:JPJJJ!oJ!oK!oK0!oKP!oKp!oK K KK LL܏L؏LԏL֏L֏L L؏L֏MM M*M.M6M:MHMRMVԏMbMf܏MM MMMMMMMMҏN N< lNRNp N؏N֏NNNNNNNNԏNN܏NOO$ O.O2O>OJOROVOrO fOOOOOOOOOP( nPF؏PV؏PZ֏PxPPPPP Q"؏Q*֏QVQ` fQ| QQ؏QQQQQQ֏Q QR RR4R>R@ RNRZRn֏Rr؏R֏R R؏R֏RRRRRRRԏRS܏S S, S6S:SFSRSZS^SvԏS S T0T"T2T:֏T>؏TZ֏Th Tr؏T֏TTTTTTTԏTT܏TT UUUUU&U*UBԏUX Ud U~0U"U2U UUUU UVVV V.V2V:V>VBVT pVz֏V~؏V֏V V؏V֏VVVVVVVԏW W܏W,W8 WBWFWRW^WfWjWԏW W W0W"W2W WW WX&؏X:֏XVXZX^XpXzX| XX XXXXXXXX YYY Y$ Y6֏YjYnYrYxYYYY YYY Z.Z6Z<ZJZ\ZfZh ZZZZZ[[[ [@ [N0[\"[nЏ[r[[ԏ[[[܏[ [[[2[ԏ[\\\Џ\܏\8 \P P\b$\f\z\\\ \؏\֏\\֏]] ]]]],]6]:ԏ]B]F]N܏]t]~] ]]]]]]]]]]] ]˙^ ^ԏ^^^&Џ^*܏^L ^X ^l^N^ ^^ԏ^^^Џ^܏^ ^^_֏_ _d_0_>֏_B_P_`_rd_ __ `bԏ`f֏`j؏`n܏`r` ``aaaa"a.ԏa2a6܏aTa` ajanazaaaaaab bBbFbRbVbdbnbzԏb~b܏bb bbbbbbcc fc.c2c:c>cJcRcc fc dd"d>dH dRdhdrdvdd ddddddee e*e6ed eeeeeԏee܏ee eeffff.ԏf f fffgg gg( g6gLgVgZgtg ggggg gggggggghhh hh0h:h< hJhNhZhbhfh hhhhԏhh܏i ii i&i*i6iNԏid ip iiiiiii iiiiij jj j$jnjrjj jj jjjjkk k"k.k:k< kLkZkk k ll l.l@lL ljlt llll `lm( m6m< mm֏m؏m܏nԏn:֏nH nR؏nb֏nrnvn~nnnnԏnn܏nn nnnno ooo.ҏo2ot oo"oo oop< pNp֏p؏p֏p p؏p֏ppqq qq"q&ԏq2q6܏qTq` qjqnqzqqqqqԏr r r2֏r6؏rR֏r` rj؏rz֏rrrrrrrԏrr܏rr rrs sss"s&s>ԏsT s` ss"s s֏s؏t֏t t*؏t:֏tJtNtVtZthtrtvԏtt܏tt tttttttԏu u u< uRuX ux 6uuuuuu uuuuuuuv v vvv&v.v2v6vT vh vԏv֏w܏w ؏ww` wh w wwwwwwww xxxxx*x.x2xzx xxx xhx y 6y y:y>yByPy^y` yjynyzyyyy yyyyyyyyzҏzZҏzp z z z zzzz{{{0{< {F{J{V{b{j{n{r{ { { {||||"|2|L|X |b|f|r|~||||ҏ| | } }*}.}:}D}N}^}x} }}}}}}~~܏~؏~ԏ~֏*֏8 B؏R֏bfnr|ԏ܏  < xRV`np x  6֏bp ؏֏ԏ܏ 8BD VZf f !o؏>؏B֏b֏r| (JX fjx ؏֏  $.0 >J~ ֏؏֏( 2؏B֏V^bhvԏ~܏ ԏl x  " *0>BXbd r~ "Џԏ ܏, NTfnԏrzЏ܏ ƙ؏֏ "$68NBJVZdrԏz܏~  ,˙N\n ؏֏ԏ܏(24 JNZ~ f!o ؏2؏6֏V֏fp  6D f` ؏֏   2>DRVlvx  "Џ ( 6>BHVt~ ֏؏֏ ؏֏"*.4BԏJ܏Nlvx ԏ  ԏ ܏4 V؏f֏    &2RT ` l v؏ ؏ &6fl!oz؏؏֏֏4>@ ~ f  ؏ ؏&,6LVX v ԏЏ܏ 0 >FԏNR^Џb܏ ؏֏   *6<JNdnp ~   ؏ ؏4>@ ~!o؏؏֏"֏2<R  f( 4 >؏RT ^؏v  $4 Fh` nrvz bԏf֏j؏n܏r ԏ܏0:< FJVZfnrz z  ".HRT ^vz"Џԏ ܏8 fv  BFRXbfԏnr܏v ԏd p  "&.ԏ2:BЏN܏l ƙN *6ԏ:>܏Bhrt  ˙*2ԏ6:FЏN܏l  ԏ܏HRT jnz fX!o f \ fj|   &*2HRT jv~ "Џ  &*6<FJVpz|    *.ԏ6:܏>`jl ~ԏ  ԏ܏, P ^d   &*2HRT jv~  h t   ,!oD!o\!ot!o!o!o!o!o(!o@!oX!op!o!o!o!o!o!o!o!o:>PZ^t~ (!o f R^lvx    "&<FH Vjr!o!o!o(!o@!oX!op!o!o!o!o!o!o!o!o0!oH!o`!ox!o!o  8 D RZԏbfrЏz܏  h  rԏv֏؏܏֏( 2؏B֏RV^blvzԏ܏  |2<JL T bjnt ֏Ǚ"(( 0 f ԏ܏  *6d ~ ֏؏֏, 6؏F֏Zbflzԏ܏ ԏd p  <FH Vb    ԏ܏&.Xbd v $ 8 PXbd l z ֏؏֏( 2؏B֏V^bhvԏ~܏‚ ª¬ º¾ԏ  2<T ~âêöԏ܏  *6ZhĄ Įԏ܏ 8BD Vh zhŔ ŢŦŪŮŲŶż &؏N֏pƈƸԏ܏ >BNXbrnjǘ ǢǦDzǾ!o,!o>BNXbfȈȔ ȞȢȮȺ֏ FJV`jzɔɠ ɪɮɺ8 D P ~ʂʎʜʦʪ 8H T l ~ԏ˂܏ˆԏF֏N܏R؏̆֏̔ ̞؏̮֏̾ԏ܏( 26BNVZ^͜Ͱ  |Ǚ(  @ ΂ΊΎΒΨβζԏξ܏ &.D Zbπϊό ϚϦϲ֏϶؏Ͼd֏ ؏ ֏&*4BԏJ܏Nlvx ЂЎВОЪоԏ $ >BNXjръь њѪѺ  0D L rҔ  ԏ܏"PZ\ fr~ӆӚӪӰ ( 2<LZdrԏv܏Ԉ ԘԢҏԲ֏Զ؏֏ ؏֏ (26ԏBF܏dp z~ՊՖ՞բպԏ  2@ WRV^bfր֊֌ ֲֺ֖֦֚־ (:N`t תײ׺׾ԏ܏ *, 6BNVbp ؈جؾ :>JN\fjԏnrv܏z٬ٶٸ   "b 0X(( j$ v& x lTb(x j$ v& x l"(\ jj$p v~& x l( j$ v*&4 x< l( j$ v& x l*( j$ v& x l$0`nz(( j$ v& x l^b$n(r& j v x ld xl l| j v$"^(l jv$ v& x l$( j*$4 v>&H xP l$$$2$L^$~( j$ v& x l$ƙ$4 /L!oZ$$( j$ v& x l2Z$( j$ v& x l$$$8 WF$h !o$$( j$ v&$ x, lX | $( j$ v& x l *$V$lƙ( j$ v& x l( j*܏2&:>$T d lr( j&$  l( j܏&$  l(, j6$@ vJ&NV$h xp l$Lƙpƙ&*$ƙƙƙƙ\ƙz~$$:*.$Xl$L`l4LƙXhƙ 0Tƙ`pƙ(8\ƙhxƙN$j$$N$$$n$~$$,@>$f$v$$$$$$.$ $<lՙt ʙ$$,H ՙ  ʙ $  >$Bt˙n$vzЏ !ә< *\!ә *!ә!ә!ә4!ә^$bЏf !ә$@ *d!әv$ $2$\ *$$$@ ^(!$!ؙ$$$b ]Џ$ *]$$D fv$$$.$6$  * h z$ !!&!F!!$!""N"f" "#0 #B#lș#Ι#Ι#Ι#Ι#ʙ#$< &$'j$'$'$''(Z(^$((($($) ):) **6*+ +0+T +6+++,,8 ,Z,,, ,-*.B$.$/, /6$/B/j/r$/$/// ~0*0,00.0>$00$01,3j$3$3 ԙ3 a4 4$4$455 ~5*6,60.6l C6v6,7J7t ϙ7 80 8L ϙ8 ϙ8 ԙ9 9$9Z9^$99$::$;$^$>z?( *@$@A.Cb$D$D"$DJ$DD$D$D$EV$EtE$E!E$F(Ff$G6$Gj$G$G$G$H H @H~*H$I$IR$II$I$J$J~$JK $K*$KK$M$M>$MN$M$MM$OO$PN$P$Qn$Rv$R$R$R$R$S$SL S^Sf$SS ~S*S,S.T$TjTr$UVTV^Vx ~V*V,V.V CWW$W@,WfWj$WW,Xv$Z["\"\ ]"^ ^l ^ C^ _h"_ ` `X C`"a aD"a\ b^.c0 c` Ccx d e Def Dff$g\glJgJh,6i(j8jL Wjj$l$lB$lf$l$m$mDmR$mmmmnn$n:nB2nN$o8 ԙoF2oo$p$p$qZ$q~qqqrr(r@rT"rd"rt"r"r"rss$tB$tZ$t$uvvvw ٙw,w8 ٙwPw\ ٙwtw ٙw ٙw ٙx"xbxx$y$y$y$z"$z>$z$| $|,||| |}.}|}} }!}!ؙ~ƙ~ ~2~v~ ~~șΙ ʙ8P>\șh|ΙΙʙ$2$^$$$$$șΙΙΙʙʙΙ$$$$0J>$`pJ~$ vfj 4(^BFv((L ƙƙ$ƙ2(`St~vSƙS(v^xƙb(n( 4b((:&(v *nƙƙVf< \J^hƙƙbf(&v*4ƙfnvr(܏:>((܏(܏"&f(܏b(܏*z܏v˙j(j((2(*܏V܏Zn܏܏܏܏܏&(B( W x W H,x HD Hv26>(B ƙ<ƙZ܏.:Vb~&6H Vj ƙ ƙ",ƙ\ƙntƙƙƙƙƙƙƙrv˙v&Dv ԙ"7r.2Rƙv^b"* ٙ:v*ZJzª :jÚ*ZĊĺJzŪ @$DdȄȤ$DdɄɤ$Ddʄʤ$Dd˄ˤ̶̨̔Hd͈ ř!38Πδ!3bbЏh!әrЂкƙƙH4ZєƙҒҖЏ $ܙ26(Ӣ!ؙƙ"Ԝ  C!$ƙդ պJ܏&6܏bْٲBVڬ ƙfv۪۾` jܼ ntƙ݂ݖݢݨƙݸ ƙ C ".d zߌ Cߠ Cߴ C C  C, C@ CNR^bЏzƙ4Џ>Lƙ /| /@PVj܏$0Rf ƙ(2B8ƙFLƙh CzƙƙЏ.FTƙbhƙ$426ЏNftƙƙJbrxƙ"^< vƙ2Fƙ CЏ!ә,ƙ:L^lz~ƙ4ƙЏ(ƙ@`4Џ$ƙv &*Zpƙ>P ƙƙƙ2>Џz"Nj& ƙƙƙƙ N     . J ƙ    0  Z `ƙ 9   ƙ  ƙ ƙr"0"t  "Brx H(>Dp H*0ƙP\ / / / /tL? Џ ( .! *"v% ?%&,'̙'(0ƙ(P̙(lΙ(Й((ș()P))*@ܙ*2?,//0J0T01202\23|?3"5"A58"<5"A5̙6$"<6L"<7"9v9"A9̙9"<::H"<:"A:"<;?<<* AFIJbJNJR`R`cFjlЏmT!mt!mЏn!nnomo ޙo,o8oD<oooooo>qj؏q|q@rr\rrs<sLshNstJs̙sXsssXss؏t t$t8DtPDthDtDtDu Du$HuL}utv\v4vDvdJvt^v{vvXvv؏ww؏ww0DwTwlwwDww{xxx{xxDyyy4Dy\yxyyz?L?ď(?8??6ƏP ȏȏȏ̙,Bȏ0H̙`Tȏfȏt̙^ȏ̏ȏȏȏ&ȏpȏ$2v C ȁ Ώ:ЏЏЏЏЏЏЏ&ЏЏ0`p  ҏ  $2ҏ`lΏΏЏΏfԏn֏ҏb̏Џ0>ЏΏΏtЏ(6Ώ^ΏrЏvΏ2ЏDXp ޙ ޙ̏Џ,:̏JЏl~v Џ&̏̏"ҏ&Џ&ҏDҏЏ$ Џ0ЏxΏJЏ*RzЏЏЏ6Џp0̙ͬΐPϦϸЏюЏbҌ!Ұ! D!`!Ӭ"PӺ^Ԉ̏xֆ֚̏̏.״::*؆""2̏قB̏n̏ڈʙ 8^dʙ| ʙ$܎̏rxʙݐʙpޚ&>ߞߴ&0>fv<b(!H̙\j!<!=!=!ؙl@!ؙf<!ebЏ !e$!eTЏ(Rh 0֙H8֙֙bj`h2 M  | M P `  M r M H H M H H H M$ H M < M  M , H L M t H  H  H  H  H  H  H  h H x M  H  M  H  H h h j j P l h h h h h h n ƙ Й v C     " J r  *   J   & > *z + -> - 1" 2 3 52 ; < @Z A G H J J J K KF K K P P! Qb Qj  Q  Q Q  Q RR RV  R^  R R S S6 S^ S S SЏ S S T"v T(ƙ T6 T  T T U^ U VvЏ W WN Wb Wf  W  W W  X X X.  Xb Xr X  X X X  Y   Y&  Y2  Yn Yr  Y  Y Y Y  Z  Z2 ZB ZR  Z Z Z  [ [:  [^ [n [~  [ [ [  \ \ \.  \  \  \  \ \  \ \ ] ]* ]J  ]r ] ^ !  b c$!) d!) d  d. d!) d d d e!) e* e>v eB  eLƙ ev e!) e f! g gT! g  h h8 k! l2  lH l` ln l| l m m m n<  n`!) n n n  n o o  oF o pJ p^  p~ p q!) r r" r2  rp!) r~ r r  r r sp  s!) t t u"  w w w  y: y> yz  | | |"  |  }  }  }& }n ~B ~R ~b  ~ ~ ~    " 2  ~  !.   : J  j     * F b      " & b      " J r  ( n* ( j ܏  , . 0  l H j R V, Z. ^0 t  | l ( j 0 v  ,  l S $ (7 \W W S :  ,љ :, B0 \ f( t j v  l F: N Xљ f, n0  ( j 0 v 0  l j( * :  љ , * 0  j  v * , x 4 l Y j  , 0  l * * 2( X j b f, n0 |  l ( j  , 0  l & 9 W B* d[ :  љ , 0  (  j , v 6 D L l  :  љ , 0  (  j  v " 0 8 l b p  :  љ , 0 0 :( H j X v b p x l :  љ , 0 $ .( < j F0 P v Z ^0 l t l  :  љ , 0  ( , j < v F T \ l    :  $љ 2, :0 T ^( l j | v   l p    : " 0љ >, F0 ` j( x j v  l :  љ , 0  ( , j < v P X l 0 \   :  љ , 0  *( 8 j B0 L v Z0 d l l :  љ , 0  ( j  v  l   T  :  љ , 0  ( j v  ( l V: Z hљ v, ~0  ( j v  l    @ b: f tљ , 0  ( j 0 v 0  l : " 0љ >, F0 ` j( x j v  l 6: > Hљ V, ^0 x ( j v  l :  љ , 0  "( 0 j @ v T \ l :  љ , 0  ( j v  l &: * 8љ F, N0 h r( j v  l :  љ , 0  ( , j < v P X l    v: ~ љ , 0  ( j v   l . XX :  љ , 0  ( j 0 v  0 ( 0 l R: Z `љ n, v0  ( j v   l V: ^ dљ r, z0  ( j v   l  <X :  љ , 0  ( j v   l .: 6 <љ J, R0 l v( j v   l 6: > Dљ R, Z0 t ~( j v   l  X f: n tљ , 0  ( j 0 v  0  l :  $љ 2, :0 T ^( l j | v   l :  $љ 2, :0 T ^( l j | v   l  X J: R Xљ f, n0  ( j v   l :  љ , 0 0 :( H j X v b p x l  :  љ ", *0 D N( \ j f0 p v z ~0  l  X &: . 4љ B, J0 d n( | j v   l  &: . 4љ B, J0 d n( | j v   l  X >: F Lљ Z, b0 | ( j v   l ( F: N Tљ b, j0  ( j 0 v  0  l  4X j: r xљ , 0  ( j v   l h :  љ , 0  ( j v   l > lX :  љ , 0  ( j  v   ( l :  љ , 0  ( j v    l N xX :  љ , 0  (  j "0 , v 6 :0 H P l r: z љ , 0  ( j v   l v: ~ љ , 0  ( j v   l . \X :  љ , 0  ( j v  $ , l N: V \љ j, r0  ( j v   l V: ^ dљ r, z0  ( j v   l  8X :  љ , 0  ( j 0 v  0   l 6: > Dљ R, Z0 t ~( Œ j œ v ¦ ´ ¼ l V: ^ dљ r, z0 Ô Þ( ì j ü v   l  <X Ċ: Ē Ęљ Ħ, Į0  ( j v    l 2: : @љ N, V0 p z( ň j Ř v Ţ Ű Ÿ l f: j xљ Ɔ, Ǝ0 ƨ Ʋ( j v  l PX Ǟ: Ǣ ǰљ Ǿ, 0  ( j 0 v 0 $ , l N: R `љ n, v0 Ȑ Ț( Ȩ j ȸ v  l h Ɇ: Ɋ ɘљ ɦ, ɮ0  ( j v  l ʄX ʺ: ʾ љ , 0  (  j $ v 8 @ l ˪. 6 2 | ̎( ̠ j ̪0 ̴ v , x l ͖ ͮ :  љ , 0  .( @ j J0 T v ^ b, j0 x ΀ l Ψ j β ζ, ξ0  l &0 .,   Њ. Т6 2 @ X v( ф j ю0 ј v Ѧ, Ѹ x l  0 Ҁ Ҩ :  љ , 0  ( , j < v P X l Ӑ~ Ӫ :  љ , 0  ( , j < v P X l z: Ԃ Ԉљ Ԗ, Ԟ0 Լ ( j v    l 8 j B T  \ l . 6 ֪: ֮ ּљ , 0  (  j  v ( 0 l p ז: ך רљ ׶, ׾0  ( j v   l >: B Pљ ^, f0 ؀ ؊( ؘ j آ0 ج v غ0  l :  љ , 0 0 >( P j ` v j | ل l ٬ j ٶ  l Z. r6 :  љ , 0  ( j 0 v D L l ۈ ۮ: ۲ љ , 0  (  j  v , 4 l V: Z hљ v, ~0 ܘ ܢ( ܰ j v  l :  љ , "0 @ N( ` j p v z ݌ ݔ l ݼ j   l f. ~6 T |4 :  љ *, 20 L V( d j t v  l :  љ , 0  (  j ( v < D l f: j xљ , 0  ( j v  l :  љ *, 20 P ^( p j v   l j   l z. 6 :  љ , 0 0 :( H j X v l t l  :  љ , 0  "( 0 j @ v T \ l ~:  љ , 0  ( j 0 v 0  l .: 6 <љ J, R0 p ~( j v   l j     l . 6 r( j 0 v , x l  R( ` j j0 t v , x l   : " 0љ >, F0 ` j( x j v  l :  љ , 0  &( 8 j H v R d l l j   l 6. N6 :  љ , 0  ( j 0  v 0  $ l R: V dљ r, z0  ( j v  l # 2: : @љ N, V0 t ( j v   l j    l . 6 &: * 8љ F, N0 h r( j v  l % :  љ &, .0 H R( ` j p v  l :  љ , 0  (  j  v , 4 l V: ^ dљ r, z0  ( j v   l  j  0  8 l . 6 : " 0љ >, F0 ` j( x j 0 v 0  l ' :  љ ", *0 D N( \ j l v  l :  љ , 0  ( 0 j @ v J \ d l j   l v. 6 :  љ , 0  ( , j < v P X l :  љ , 0  ( j v   l T :  љ , 0  "( 0 j @ v T \ l :  љ , 0  ( j v   l V: ^ dљ r, z0  ( j v   l  j  0  8 l . 6 b: f tљ , 0  ( j v  l :: > Lљ Z, b0 | ( j v  l :  љ!,! 0!$!.(!< j!L v!`!h l!:!!љ!,!0!!(! j! v!! l!2:!6!Dљ!R,!Z0!t!~(! j!0! v!0!! l!:!!љ!,!0!$!2(!D j!T v!^!p!x l! j!! ! l!Z.!v6!z0!:!"!0љ!>,!F0!d!n(!| j! v! x! l!*:!.!<љ!J,!R0!l!v(! j! v!! l!:!!љ!,!0!!(!, j!< v!P!X l!.!6!>:!B!Pљ!^,!f0!!(! j!0! v!0!! l!ՙ!*:!.!<љ!J,!R0!l!v(! j! v!! l!:!! љ! ,! 0! 8! F(! X j! h v! r! ! l! j! ! ! l! R.! j6! :! ! љ! ,! 0! ! (!  j! ( v! <! D l! |ՙ! :! ! љ! ,! 0! ! (! j! v! ! ( l! n:! v! |љ! ,! 0! ! (! j! v! ! !  l! , j! 6! H ! P l! .! 6!Z:!^!lљ!z,!0!!(! j! v!! l!!::!>!Lљ!Z,!b0!|!(! j! v!! l!:!!љ!,! 0!$!.(!< j!F0!P v!^0!h!p l!:!!љ!,!0!!(! j! v!! !( l!P j!Z!l !t l!(!60!>!HZ!!!!!:!!љ!,!0!<!P j!` v!j!|! l!! j!!,!0! ! l!!":!*!4љ!B,!J0!d!x j! v!! l!:!!љ!,!0!!"(!0 j!@ v!T!\ l!:!!љ!,!0!!(! j! v!! l!.:!2!@љ!N,!V0!p!z(! j!0! v!0!! l!n:!r!љ!,!0!!(! j! v!! l!,!>:!B!Pљ!^,!f0!!(! j! v!! l!0!!o!@!!o!!o!!H!o!^:!b!pљ!~,!0!!(! j! v!! l!:!!љ!,!0!!(! j! v!!(!0 l!f0!j!tZ!! !$4!!(! j! v!!,! x! l!<!L!X!h!(! j! v!!,! x! l!!!!4!V(!d j!t v!~!,! x! l!!4! ! ,! @4! b(! p j! v! ! ,! x! l! ! ! 4!!(!!, j!!< v!!F!!J,!!\ x!!d l!!r(!! j!! v!!!!,!! x!! l!!:!!!!љ!",!"0!"(!"2(!"@ j!"P v!"Z!"h!"p l!":!"!"љ!",!"0!"!"(!" j!" v!#!#!# l!#::!#B!#Hљ!#V,!#^0!#x!#(!# j!# v!#!#!# l!$R*!$hٙ!$~(!$ j!$!$,!$0!$ !$ l!$ٙ!%":!%&!%4љ!%B,!%J0!%d!%n(!%| j!%0!% v!%0!%!% l!%:!%!%љ!%,!&0!& !&*(!&8 j!&H v!&\!&d l!&*!'ٙ!'&!'*!'T5!'n(!'| j!'0!' v!'!',!' x!' l!( Й!(<!(N(!( j!(!(,!(0!( !( l!(!) j!)!)",!)*0!)< !)D l!)x j!)!),!)0!) !) l!):!)!)љ!),!)0!*!*( j!*8 v!*B!*X x!*` l!*:!*!*љ!*,!*0!+!+(!+, j!+< v!+P!+X l!+:!+!,љ!,,!,0!,8!,B(!,P j!,Z0!,d v!,r0!,|!, l!,-!,:!,!,љ!,,!,0!-!-(!-, j!-< v!-P!-X l!-:!-!-љ!-,!-0!.!.(!., j!.< v!.P!.X l!./!.:!.!.љ!.,!.0!.!.(!. j!/ v!/!/$ l!/!/0!/ W!/(!0$ j!0.!02,!0D !0L l!0~!0!0:!0!0љ!0,!00!1!1 (!1 j!1( v!1<!1D l!1z:!1~!1љ!1,!10!1!1(!1 j!1 v!1!2 l!2!20!2 W!3(!3< j!3F!3J,!3\ !3d l!3!3!3:!3!3љ!3,!30!4 !4(!4$ j!44 v!4H!4P l!4v!4!4:!4!4љ!4,!40!5!5(!5 j!5*0!54 v!5B0!5L!5T l!5z:!5~!5љ!5,!50!5!5(!5 j!5 v!5!6 l!6!7&!7B!7`5!7r(!7 j!7܏!7!7,!70!7 !7 l!7!8:!8\!8,!80!8!9n:!9v!9|љ!9,!90!9!9(!9 j!9 v!9!: !: l!:j0!:x W!:(!: j!:!:,!: !: l!::!:!;љ!;,!;0!;4!;>(!;L j!;\ v!;p!;x l!;:!;!;љ!;,!;0!;!;(!; j!< v!<!<$ l!(!> j!> v!>4!>< l!>(!>,!>!>!>!?,!?*:!?.!?<љ!?J,!?R0!?l!? j!?0!? v!?,!?0!?!? l!@ j!@0!@$ v!@2,!@@ x!@H l!@V,!@n,!@,!@0!@!@!A>!AN:!A\љ!Aj,!Ar0!A!A(!A j!A v!A!A l!B,!B!B:!Bљ!B,!B0!B!B(!C j!C 0!C v!C"0!C,!C4 l!C!C!DT!D!!E!!E:!E!Eљ!E,!E0!E!E(!E j!E v!E!F!F l!F8!FR:!FZ!F`љ!Fn,!Fv0!F!F(!F j!F v!F!F!F l!F:!F!Fљ!G,!G0!G(!G2(!G@ j!GP v!GZ!Gh!Gp l!G!G!G!H!H!H:!Hљ!H,!H0!H!H(!H j!H0!I v!I0!I !I( l!I!J!J":!J&!J4љ!JB,!JJ0!Jd!Jn(!J| j!J v!J!J l!Kw!K4w!K!K:!K!Kљ!K,!K0!K!L(!L j!L0!L( v!L60!L@!LH l!Lw!M_!M,!M:!M!Mљ!M,!M0!M!M(!M j!M v!N ,!N x!N l!NN(!N\ j!Nf0!Np v!Nz!N~,!N x!N l!O,!OJ:!ON!O\љ!Or0!O!O(!O j!O0!O v!O0!O x!P l!P|a!Pa!Q2.!QJ6!Q:!Q!Qљ!Q,!Q0!Q!Q(!Q j!R v!R!R$ l!R\)!R:!R!Rљ!R,!R0!R!R(!R j!R v!S!S l!SN:!SV!S\љ!Sj,!Sr0!S!S(!S j!S v!S!S!S l!T j!T!T( !T0 l!T.!T6!U:!U"!U0љ!U>,!UF0!U`!Uj(!Ux j!U0!U v!U0!U!U l!U)!V :!V!Vљ!V*,!V20!VL!VV(!Vd j!Vt v!V!V l!V:!V!Vљ!V,!V0!W!W&(!W8 j!WH v!WR!Wd!Wl l!W j!W!W !W l!X4ę!XJ:!XR!XXљ!Xf,!Xn0!X!X!X!X!X!X:!Y!Y!Y !Y:!Y@љ!YN,!YV0!Y|!Y!Y:!Y!Z:(!Z\ j!Zf!Zj,!Zr0!Z !Z l!Z!Z j!Z0!Z v!Z!Z,!Z x![ l![L![b:![f![tљ![,![0![![ j![ v![![ l!\F!\T!\!]!].!]6!]:!^!^љ!^,!^&0!^@!^J(!^X j!^b0!^l v!^z0!^!^ l!^:!^!^љ!^,!^0!_!_(!_ j!_0 v!_D!_L l!_z:!_~!_љ!_,!_0!_!_(!_ j!_ v!_!` l!`0!`d!`:!`!`љ!`,!`0!`!`(!` j!a v!a!a !a( l!aP j!aZ!al !at l!b.!b.6!b:!b!bљ!b,!b0!b!b(!b j!b v!c!c l!c\!c:!c!cљ!c,!c0!c!c(!c j!c v!d!d l!d2:!d6!dDљ!dR,!dZ0!dt!d~(!d j!d v!d!d l!d:!d!dљ!d,!e0!e!e&(!e4 j!eD v!eX!e` l!e:!e!eљ!e,!e0!e!e(!e j!e v!e!f!f l!f@ j!fJ!f\ !fd l!f.!g6!g!g!g!h!h:!h!i љ!i,!i"0!i<!iF(!iT j!i^0!ih v!iv0!i!i l!i:!i!iљ!i,!i0!i!j (!j j!j, v!j6!jH!jP l!jx j!j!j !j l!k.!k*6!kf:!kn!ktљ!k,!k0!k!k(!k j!k v!k!k,!k!l l!lX j!lb!lf,!lx !l l!l!m..!mF6!m:!m!mљ!m,!m0!m!m(!m j!m0!m v!n!n0!n!n l!nx j!n!n0!n !n l!o2.!oJ6!o:!o!oљ!o,!o0!o!o(!o j!p v!p!p$ l!pT+!pz:!p~!pљ!p,!p0!p!p(!p j!p v!p!q l!qF:!qN!qTљ!qb,!qj0!q!q(!q j!q v!q!q!q l!r j!r!r !r( l!r.!r6!r:!s!s љ!s,!s"0!s@!sN(!s` j!sj0!st v!s~!s,!s0!s!s l!s j!s!s,!t0!t !t l!t.!t6!u:!u!uљ!u",!u*0!uH!uV(!uh j!ux v!u!u!u l!u j!v!v !v l!v!vA!v!vA!wj.!w6!w:!w!wљ!w,!w0!x!x(!x j!x*0!x4 v!x>!xB,!xJ0!xX!x` l!x j!x!x,!x0!x !x l!xI!yv.!y6!y:!y!yљ!y,!y0!z!z(!z, j!z< v!zP!zX l!zI!z:!z!zљ!z,!z0!{!{"(!{4 j!{D v!{N!{`!{h l!{ j!{!{ !{ l!|!|A!|:!|!|љ!|,!|0!|!|(!| j!|0!| v!}0!}!} l!},!}:!}!}љ!}0!~ !~*(!~8 j!~H v!~d x!~l l!^.!v6!*:!.!8љ!F,!N0!t!~(! j! v! x! l!:!!љ!,!0!!(! j! v!! l!.:!2!@љ!N,!V0!p!z(! j! v!! l!:!!љ!,!0!!&(!8 j!H v!R!d!l l! j!! ! l!2.!J6!:!!љ!,!0!!(! j!0! v!0!$!, l!r:!v!љ!,!0!!(! j! v!! l!>:!F!Lљ!Z,!b0!!(! j! v!!! l! j!! ! l!,!&:!*!8љ!F,!N0!t!~(! j! v! x! l!N:!R!`љ!n,!v0!!(! j! v!! l!~.!6!r(! j!0! v!,!! l!,!(! j!܏!,!0! !0 l!h j!v,!~0! ! l!:!!љ!,!0!!(! j! v!$!, l!b:!f!tљ!,!0!!(! j! v!! l! :!!љ!&,!.0!T!^(!l j!| v! x! l!:!!љ!,!0!8!B(!P j!` v!t!| l!:!!љ!,!0!0!:(!H j!X v!l!t l!:!!љ!,!0!!(! j!0! v!0!!$ l!F:!N!Tљ!b,!j0!!(! j! v!!! l! j!! !( l!.!6!(!:!&!,љ!:,!B0!`!| j! v!!,!! l! j!!,! ! l!&6!V:!Z!hљ!v,!~0!! j! v!! l!:! !љ!&,!.0!H!\ j!l v!! l! j!0!,! ! l!:!!љ!,!0!!(! j! 0! v!"0!,!4 l!j:!n!|љ!,!0!!(! j! v!! l!!$!f:!j!xљ!,!0!!(! j! v!! l!0!0ƙ!V!^:!lљ!z,!0!!(! j! v!! l! ;!4!D!T!d!t!!!!0!ƙ!:!!љ!,!0!!(! j! v!! l!B0!L!X!!!4!:!!љ!,!0!!(! j! v!,!4 l!b:!f!tљ!,!0!!(! j! v!! l! :!!љ!*,!20!L!V(!d j!t v!! l!:!!љ!,!0!!(! j!0! v!.0!8!@ l!:!!љ!,!0!8!B(!x j! ! l!:!!љ!,!0!!(! j! v!! l!0!!!!*:!.!<љ!J,!l!v(! j! ! l!!!!!!t!!!:!!(љ!B,!`!j(!x j! ! l!!F(!| j!܏!!,! ! l!:!!љ!,! !*(!8 j!T !\ l!j:!n!|љ!,!!(!:!!љ!,!!&(!::!>!Lљ!f,!!(! j! ! l!:!!љ!,!!&(!4 j!T !\ l!j:!n!|љ!,!!(!!!!h!:!!љ! ,!(!2(!F:!J!Xљ!f,!!(! j! ! l!N:!R!`љ!n,!!(!:!!љ!,!!(! j!0 !8 l!j:!n!|љ!,!!(! j! ! l!!!N:!R!`љ!z,!!(! j! ! l!:!!љ!,!<!F(!:!!љ!,!!(!:!!(љ!B,!`!j(!!:!!љ!,!!(!:!! љ!:,!X!b(!:!!љ!,!!(!:!!љ!,!<!F(!Z:!^!lљ!z,!!(! j! ! l!:!!љ! ,!,!6(!J:!N!\љ!v,!!(!:!!љ!,!!(! j!, !4 l!B:!F!Tљ!b,!j0!!(! j! v!! l!:!!љ!,!0!!"(!0 j!@ v!T!\ l!:!!љ! ,!0!,!6(!D j!N0!X v!f0!p!x l!:!!љ!,!0!!(! j! v! !( l!L!x!!:!!љ!,!0!!(! j! !( l!r:!v!љ!,!0!!(! j! ! l!!8!Z(!l j!v܏!~!,!0! ! l!!!(! j!!,!0!$ !, l!t j!~܏!!,!0! ! l!!:!!љ!,!0!8!B(!P j!l !t l!8!!0!0!"!8!N0!x!(! j!,!0! ! l!:!! љ!.,!60!\!f(!t j! ! l!¾:!!љ!,!0!! (! j!( v!<!D l!f:!j!xљ!Æ,!Î0!è!ò(! j! v!! l!:!! љ!.,!60!P!Z(!h j!x v!Č!Ĕ l!:!!$љ!2,!:0!T!^(!l j!v0!ŀ v!Ŏ0!Ř!Š l!.:!2!@љ!N,!V0!p!z(!ƈ j!Ƙ v!Ƭ!ƴ l!2:!6!Dљ!R,!Z0!t!~(!nj j!ǜ v!ǰ!Ǹ l!0!!:!!$љ!2,!:0!T!^(!l j!| v!Ȑ!Ș l!:!! љ!.,!60!P!Z(!h j!r0!| v!Ɋ0!ɔ!ɜ l!ɦ0!0!!:!! љ!,!"0!<!F(!T j!^0!h v!v0!ʀ!ʈ l!ʒ0! (! j!&0!0 v!:!>,!P x!X l!n(!̤ j!̮!̲,!̾0! ! l!(! j!0!$ v!.!2,!D x!L l!!!!L!d!Φ:!Ϊ!θљ!,!0!!(! j!0! v!.0!<!D l!.!6!B:!J!Pљ!^,!f0!Є!В(!Ф j!д v!о!,!! l!4 j!>!B,!T !\ l!.! 6!^:!b!pљ!~,!҆0!Ҡ!Ҫ(!Ҹ j!0! v!0!! l!2:!6!Dљ!R,!Z0!t!~(!ӌ j!Ӝ v!Ӱ!Ӹ l!:!! љ!,!"0!@!N(!` j!p v!z!Ԍ!Ԕ l!Լ j!! ! l!r.!Պ6!:!!љ!,!0! !*(!8 j!H v!\!d l!֪:!֮!ּљ!,!0!!(! j! v!(!0 l!v:!~!ׄљ!ג,!ך0!׸!(! j! v!!! l!4 j!>!P !X l!.!6!>:!B!Pљ!^,!f0!ـ!ي(!٘ j!٢0!٬ v!ٺ0!! l!:!!$љ!2,!:0!T!^(!l j!| v!ڐ!ژ l!:!!љ!,!0! !.(!@ j!P v!Z!l!t l!ۜ j!ۦ!۸ ! l!R.!j6!ܾ:!!љ!,!0!! (! j!( v!<!D l!݊:!ݎ!ݜљ!ݪ,!ݲ0!!(! j! v!! l!V:!^!dљ!r,!z0!ޘ!ަ(!޸ j! v!!! l! j!!0 !8 l!ߪ.!6!:!! љ!,!"0!@!N(!` j!j0!t v!~!,!0!! l! j!!,!0! ! l!!:!љ!,!0!!(! j! v!$!, l!ϙ!!!!!ߙ!ՙ!6,!D!z!ߙ!ՙ!B.!Z6!:!!љ!,!0!!(! j!0! v!0!$!, l!f:!j!xљ!,!0!!(! j! v!! l!!!!F:!J!Xљ!f,!n0!!(! j! v!! l!!:!!љ!",!*0!D!N(!\ j!l v!! l!!!!:!"!(љ!6,!>0!\!j(!| j! v!!! l! j!! ! l!8!.!6!2:!6!Dљ!R,!Z0!t!~(! j! v!! l!!!"!*!N!~!!(! j!0! v!,! x! l! !8!F!N:!\љ!j,!r0!!(! j! v!! l!!(! j!0!( v!6,!P x!X l!f:!j!xљ!,!0!!(! j! v!! l!:!! љ!,!"0!<!F(!T j!d v!x! l!:!!љ!,!0!!(! j! v!! l!.:!2!@љ!N,!V0!p!z(! j! v!! l!:!!љ!,!0!!(!$ j!4 v!>!P!X l!l j!v! ! l! !&.!>6!:!!љ!,!0!!(! j!0! v!0!! l!V:!Z!hљ!v,!~0!!(! j! v!! l!!! !6:!:!Hљ!V,!^0!x!(! j! v!! l!!:!!љ!,!0!4!>(!L j!\ v!p!x l!!,!!.:!6!<љ!J,!R0!p!~(! j! v!!! l! j!! ! l!.!6!6!:!B!f!!(!,!0!,!n0!|!,!0!י!:!! љ!,!"0!<!F(!T j!d v!x! l!:!!љ!,!0!!(! j! v!,!4 l!V:!Z!hљ!v,!~0!!(! j! v!! l! :!!љ!*,!20!L!V(!d j!t v!! l!:!!љ!,!0!!(! j! v!0!8 l!Z:!b!hљ!v,!~0!!(! j! v!!! l! j!"!4 !< l!!.!6!j!n!v!!:!!љ!,!0!!(! j! v!(!0 l!x!(! j!0! v!,! x! l"0"Z(","0""0""*,".0"lי":""љ","0""(" j" v"" l"::">"Lљ"Z,"b0"|"(" j" v"" l":""љ","0""("( j"8 v"L"T l"b:"f"tљ","0""(" j"0" v"0"" l":"" љ",""0"@"N("` j"p v"z"" l" j"" " l"J."b6"""""0"N("d j"n܏"v,"~0" " l" j","0" " l":("ٙ","0""&0"8"ٙ""ٙ","0" ,י" Z:" ^" lљ" z," 0" " (" j" v" " l" :" " љ" .," 60" P" Z(" h j" x v" " l" :" " љ" ," 0" " ("  j" , v" @" H l" j:" n" |љ" ," 0" " (" j" v" " l" :" " љ" .," 60" T" b(" t j" v" " " l" j" " " l" r." 6" " " "":"""0љ">,"F0"`"j("x j" v"" l"ՙ":""љ"","*0"D"N("\ j"l v"" l":""љ","0""(" j"0"$ v"20"<"D l"f:"n"tљ","0""(" j" v""" l"$ j"."@ "H l"."6">"B"J"n":""љ","0""(" j"$ v"8"@ l"x}":""љ","0""(" j" v""$ l"F:"J"Xљ"f,"n0""(" j" v"" l":""љ","0"0":("H j"X v"l"t l":""љ","0""(" j" v" "( l"J:"N"\љ"j,"r0""(" j" v"" l":""љ","0"4"B("T j"d v"n"" l" j"" " l"r."6"""""Z:"^"lљ"z,"0""(" j" v"" l"}">:"B"Pљ"^,"f0""(" j" v"" l":""љ","0"("2("@ j"P v"d"l l":""љ","0""(" j" v" " l"B:"F"Tљ"b,"j0""(" j" v"" l":""љ" ,"0","6("D j"N0"X v"f0"p"x l":""љ","0""(" j" v""("0 l"X j"b"t "| l"."*6"n:"r"љ","0""(" j" v"" l" J$" N," `o" :" " љ" ," 0" " (" j" v"!"!"! l"!D j"!N"!` "!h l"!."" 6""Z:""^""lљ""z,""0""""("" j"" v"""" l"#$"#."#(o"#N:"#R"#`љ"#n,"#v0"#"#("# j"#0"# v"#0"#"# l"#:"$"$ љ"$,"$"0"$@"$N("$` j"$p v"$z"$"$ l"$ j"$"$ "$ l"%r."%6"%:"%"%љ"&,"& 0"&$"&.("&< j"&L v"&`"&h l"&$"&"&o"&:"&"&љ"&,"'0"'"'&("'4 j"'D v"'X"'` l"':"'"'љ"',"'0"'"'("' j"' v"("( l"(*:"(2"(8љ"(F,"(N0"(l"(z("( j"( v"("("( l"( j"(") ") l").")6"):")"* љ"*,"*"0"*<"*F("*T j"*d v"*x"* l"*$"*&"*o"*:"*"+љ"+,"+0"+0"+:("+H j"+R0"+\ v"+j0"+t"+| l"+:"+"+љ"+,"+0"+"+(", j", v",",,",4 l",\ j",f",x ", l"-."-*6"-z:"-~"-љ"-,"-0"-"-("- j"- v"-". l".2$".6"".Ho".n:".r".љ".,".0".".(". j". v".". l"/:"/"/$љ"/2,"/:0"/X"/f("/x j"/ v"/"/"/ l"/ j"/"/ "/ l"0r."06"0:"0"0љ"0,"00"1"1("1( j"120"1< v"1J0"1T"1\ l"1:"1"1љ"1,"10"1"1("1 j"1 v"2"2 l"26"2F"2j"2n"2|o"2:"2"2љ"2,"20"2"2("3 j"3 v"3"30"38 l"3` j"3j"3| "3 l"4."4*6"4z:"4~"4љ"4,"40"4"4("4 j"4 v"4"5 l"52"56"5Ho"5n:"5r"5љ"5,"50"5"5("5 j"5 v"5"5 l"6:"6"6$љ"62,"6:0"6X"6f("6x j"6 v"6"6"6 l"6 j"6"6 "6 l"7."76"7:"7"8 љ"8,"8"0"8<"8F("8T j"8d v"8x"8 l"8("8*"8o"8:"8"9љ"9,"90"90"9:("9H j"9R0"9\ v"9j0"9t"9| l"9:"9"9љ"9,"90"9"9(": j": v":":,":4 l":\ j":f":x ": l"; 0";2.";J6";:";";љ";,";";("; j"; v"< ,"<"< l"<\ j".">66">~0">$">."> ">$">."> "? :"?"?љ"?*,"?20"?L"?V("?d j"?n0"?x v"?0"?"? l"?:"?"?љ"@,"@0"@,"@:("@L j"@\ v"@f"@x"@ l"@ j"@"@ "@ l"Af."A~6"A0"A$"A"A "B$"B""B4 "BZ:"B^"Blљ"Bz,"B0"B"B("B j"B v"B"B l"C6:"C>"CDљ"CR,"CZ0"Cx"C("C j"C v"C"C"C l"C j"C"D "D l"D."D6"D:"D"E љ"E,"E"0"E<"EF("ET j"E^0"Eh v"Ev0"E"E l"E$"E&"E "F:"F&"F,љ"F:,"FB0"F`"Fn("F j"F v"F"F"F l"F j"F"F "G l"G."G6"G:"G"H љ"H,"H"0"H<"HF("HT j"Hd v"Hx"H l"H$"H""H "I:"I""I(љ"I6,"I>0"I\"Ij("I| j"I v"I"I"I l"I j"I"I "I l"Jz."J6"J"J"J"K "K:"K>"KP "Kv:"Kz"Kљ"K,"K0"K"K("K j"K0"K v"K0"K"L l"LV:"L^"Ldљ"Lr,"Lz0"L"L("L j"L v"L"L"L l"M j"M"M0 "M8 l"M."M6"N::"N>"NLљ"NZ,"Nb0"N|"N("N j"N v"N"N l"O"O"O4 "OZ:"Ob"Ohљ"Ov,"O~0"O"O("O j"O v"O"O"O l"P j"P""P4 "P< l"P."P6"Q>0"QV("Q^*"Qh "Q("Q*"Q "Q:"Q"Qљ"Q,"Q0"R "R("R$ j"R.0"R8 v"RF0"RP"RX l"R:"R"Rљ"R,"R0"R"R("S j"S v"S&"S8"S@ l"Sh j"Sr"S "S l"T."T26"Tr("Tz6"T:"T"Tљ"T,"T0"U"U j"U$ v"U8"U@ l"U2"U j"U0"U v"U,"V x"V l"VZ:"V^"Vhљ"Vv,"V~0"V"W j"W܏"W,"W*0"W@ "WP l"W j"W܏"W,"W0"W "W l"W j"X0"X v"X,"X0 x"X8 l"X j"X܏"X,"X0"X "X l"Y j"Y,"Y0"Y( "Y0 l"YV:"YZ"Ydљ"Yr,"Yz0"Y"Y j"Y v"Y x"Y l"Z:"Z"Z,љ"Z:,"ZB0"Z\"Zp j"Z v"Z"Z l"Z:"Z"Zљ"Z,"Z0"Z"[ j"[ v"[$"[, l"[::"[B"[Hљ"[V,"[^0"[|"[ j"[0"[ v"["[,"[0"["[ l"[ j"["[,"\0"\ "\ l"\."\6"\:"\"\љ"],"] 0"]("]6("]H j"]X v"]b"]t"]| l"] j"]"] "] l"^0"^"_ ٙ"_X"_:"_"_љ"_,"_0"_"_("_ j"` v"` "`( l"`J"`b:"`f"`tљ"`,"`0"`"`("` j"` v"`"` l"a "a":"a&"a4љ"aB,"aJ0"ad"an("a| j"a v"a"a l"a:"a"aљ"a,"a0"b"b6:"b:"bHљ"bV,"b^0"bx"b("b j"b v"b"b l"b:"b"bљ"b,"c0"c "c*("c8 j"cH v"c\"cd l"c:"c"cљ"c,"c0"c"c("c j"c0"c v"d0"d "d l"d:"d"dљ"d,"d0"d"d("e j"e v"e0"e8 l"e"e:"e"eљ"e,"e0"e"e("f j"f v"f"f"f*"fj"fn"f"f x"f l"g$ٙ"g`"g:"g"gљ"g,"g0"g"g("g j"g v"h"h l"h.:"h6"h@љ"hN,"hV0"hp"hz("h j"h v"h"h l"i"("i::"i>"iLљ"iZ,"ib0"i|"i j"i v"i"i l"i"j j"j0"j$ v"j."j2,"jD x"jL l"jv0"j"j"j j"j v"j"k"k l"k\"k"k j"k v"k"k"k l"l"l@ j"lP v"lZ"ll"lt l"l"l j"l v"l"m"m l"mH j"mR"mV,"mh "mp l"m j"m܏"m"m,"m0"m "m l"m:"m"mљ"n,"n 0"n$"n8 j"nB0"nL v"nZ0"nd"nl l"n:"n"oљ"o,"o0"o4"o>("oL j"o\ v"op"ox l"o"o("o j"o0"o v"o"o,"p x"p l"p20"p<"p`"p("p j"p v"p"p"p l"q"q@"qb("qp j"q v"q"q"q l"q"r("r, j"r< v"rF"rX"r` l"r"r("r j"r v"r"s"s l"s<a"sb("sp j"sz"s~,"s "s l"s j"s܏"s"s,"s0"s "s l"t :"t"tљ"t*,"t20"tL"tV("td j"tt v"t"t l"un."u6"u:"u"uљ"u,"u0"v"v("v$ j"v4 v"v>"vB,"vT"v\ l"v j"v"v,"v "v l"v"wn."w6"w:"w"wљ"w,"w0"x"x("x$ j"x.0"x8 v"xB"xF0"xX"x` l"x j"x"x0"x "x l"yݙ"yl"y:"y"yљ"y,"y0"y"z("z( j"z20"z< v"zJ0"zT"z\ l"{*"{R("{` j"{j2"{t v"{4"{ x"{ l"{4"{("{ j"{2"{ v"{"{4"{"{ l"|4"|4"|B4"|R4"|v2"|~6"|2"|4"}L "}V4"}("} j"}܏"}4"~ "~ l"~X j"~f4"~ "~ l"~8"~8":"".4"P"Z("h j"x v"4"" l":""4"."2""("( j"8 v"F4"T"\ l"|"(" j"2" v"4" x" l"4"4"Z"\"^"`"*b"Bd"Zf"rh"j"l"n"p"2"2"2"22"J2"b2"z2"2"2"2"2"2" 2""2":2"R("br"x j"܏"4"2" " l"r"J2"V2"b2"~2"2"2"2"2"2"2"2"2"(" j"܏"4"2" " l"( j"2܏":4">2"` "p l"""4"^6"b2"f4"4"4" j"2" v""4"" l"$""6Џ"P j"Z2"d v"r4"" l"4"2"="d"4"2"" j"*4"22"H "P l"t j"~܏"4"2" " l" j"4"2" " l" j"܏"&4"*2"H "X l"l j"z4"2" " l" j"܏"4"2" " l" j"4"2", "4 l"H j"V4"^2"l "t l"("e"q""2"2"2"4"""Vf"x"B":""("*"B2"N"^2"n2"2"ƙ" j" v" x" l"V܏"h "~2""2""2""2"2"2"@ƙ"R2"j2"~2"ƙ"2"2"ƙ""""&2"8"JZ"l"z"Z""Z"""Z"""">"V2"f`"tƙ"p"ƙ"2"ƙ"""h"4ƙ"Z2""Й""h"ƙ""`"0ƙ">`"J2"Tƙ"fZ"t""Z""""rd"ƙ"2"ƙ""Й""d" ƙ"62"@ƙ"h"Й""d"ƙ""2"Й"T"0Й"@"R2"X"hЙ"z"2"""Й",T"DЙ"T"f2"l"|Й"2"ƙ"2""2"ƙ""("DЙ"`"jh"|ƙ"b"""Z"""Z""" Z" "2"6f"L"V."^2"l"T"Й""2" "Й"""2"^"v""""f4"j2"" :"""4"*2"L"V("d j"t v" x" l"N4"(" j""4"2" " l"4"("J:"N"f4"n2""(" j"2" v"2"" l""""4" "ҙ":"N""R$"pę"$"ș"&"$"ę".$"Pș"r"("*"ș"$","ș":."Pș"2"(" j"܏"2" "0 l"z""" j"2", "4 l"V"r""2"2"62"~"$","ș"0"ș".2"~2":""2""(" j" v"P x"X l"d"2"2"F2"2"2":""24":2"\"f("t j" v" x" l""(" j"2" v"."F2"R"V4"j2""2" x" l"2">"B2"b"r2"~"2"4"2"p /"~""4"2":r"H"R(" j"܏" " l" "<"F2"T""Й""T"Й""2""$Й"4"2"4"2"2"2"62"N2"f2"~2"2"2"2"2"2"2"&2">2"V2"n2"2"2"2"2"2"2"B("P j"Z܏"b4"j2"| " l"r"","">4""T":""2""("( j"8 v"F"t x"| l"""(" j"2" v""" l"J"\"j2"t"N":""2""(" j" v"4 x"< l"("< j"F4"J2"X "` l" j"4"2" " l" j"4"2" " l" /".("6"\ j"f2"p v"~4" x" l"T"Й""2""Й"4"PЙ"p"„ j"Ž܏"¤ "´ l"" /""("( j"2܏"D "T l"Й""2""Й"("$Й"D"\T"2"J("` j"j܏"r2"Ɛ "Ơ l" j"2" " l"Ǫ("F""4"""&"*"~"ɢ("ɴ j"ɾ2" v"4" x" l"ʆ("ʔ j"ʞ2"ʨ v"ʶ4" x" l"˶4"(" j"2" v" x" l"8"x"̞6"2"Z2""(" j"2" v"&4"< x"D l"Φ""""""ϒ"Ϯ:"϶"4"2"" (" j"( v"P x"X l"&"*4"4""$"2,"62"j0"("܏"""(" j"2" v"4" "( l"^2"v4"&("6:":"x"Ղ("Ր j"ՠ v"ռ"" x" l"8 j"P"l "t l"ֈ j"֤" "܏" l"ז:"ך"׮4"׶2""(" j" v"( x"0 l"(" j"܏" 2"24"< "L l"| j"ن܏"َ2"Ι"Ι"6("P j"Z܏"b2"ڊ4"ڔ "ڤ l" j"2"4" " l"64":2"۞4"ۢ2"(Ι"B4"F2"ܪ:"ܮ"4"2""(" j" v"0 x"8 l"("("r("ހ j"ފ2"ޔ v"ޢ4"޴ x"޼ l"4"2"r("ߚ4"ߪ2"2"F("j4"~2"2"&4".2"" "4"X "(" j"2" v"" l"("*4"B2"x j"2" v"4" x" l"4"2"F4"J2"("4"2"2"64"2"v4""">("L j"V2"` v" x" l""""&"J("\ j"f2"p v" x" l"" j"2" v" x" l"4"n2"2"T"0T"D j"N2"X v"" l" j"2" v" x" l"."D"V2"hƙ"r:"vh""(" j" v"ۙ" x" l"ۙ"""(" j"2" v" x"$ l"v""(" j"2" v"( x"0 l"P"ۙ"T"(" j"2" v"" l"4"2"hX"r(" j"܏"2" " l"("4"2"D" j"܏" "܏" l" j"܏" "܏" l"$ j"4 v"P"l x"t l" ۙ"T j"^2"h v" x" l", j"62"@ v"` x"h l"2"&"x j"2" v" x" l"" j" v" x" l"C"8T"x j"2" " l""2" j"܏" "܏" l" j"܏", "6܏"< l"d j"n2"x v" x" l"("4"܏"2""T j"d v"" x" l" j"2" v"( x"0 l"V2" j"$ "0 l"h j"r2"| v" x" l" j" " l# j#< #H l#\ j#| # l#:##4#2##(# j# v#( x#0 l##j#l#r###(# j#2# v#4#, x#4 l#F4#R(#` j#j2#t v# x# l#2#(# j#2# v#4# x# l#>(#\ j#f܏#n4#v2# # l# j#܏#4#2# # l#8 j#B܏#J4#R2#h #x l# j#܏#4#2# # l#"(#D #R#f(#t j#~2# v##2## l# ##4ԙ#D֙#p֙#(##2#ܙ# 4ڙ# Pڙ# f(# | j# 2# v# 4# x# l# (# 4# 2# # j# v# # l# # ,ܙ# 4# 4# f(# x j# 2# v# 4# x# l# T#  j# 4# 2# ( # 0 l# R4# b(# T# j# 4# 2# # l# 4#(#,T#@ j#N4#V2#h #p l#4#(#T# j#4#2# # l#ș#(#( j#2܏#:4#n2# # l# j#4#2#0 #8 l#b2#pƙ#z4#:##4#2#@#J(#X j#h v# x# l#28#b##4#2#Z4#^2##4#2#(# j#2# v#4# x# l#]#.Џ#>:#B`#J4#N2##(# j#2# v#2# x# l##4#2#(##f(# j#܏#4##2# # l#T_#` j#z4#~#2# # l# j# # l#0 j#:܏#d #n܏#t l# j# # l# j#&܏#P #Z܏#` l#v:#z## j# v# x# l# j#0 v#H#h x#p l# j#܏# #܏# l#  j# 8 # @ l# \ j# j܏# n# # ܏# l# j# #! #! l#!( j#!@#!` #!h l#! j#!܏#!#! #!܏#! l#! j#"#"$ #", l#"HT#"P j#"^܏#"|#"#"#"##$ ##.܏##4 l##P j##^܏##| ##܏## l##:###$8#$L j#$\ v#$ x#$ l#$#$#$#% j#%#% #% l#&#&"#&h j#& #& l#&!#' j#' ܏#'0 #':܏#'@ l#'L!#'\!#' j#'܏#' #'܏#' l#( j#(, #(4 l#(V:#(Z#(n4#(v2#(#((#( j#( v#( x#( l#)J:#)N#)b4#)j2#)#)(#) j#)2#) v#)2#) x#) l#*$#*".#*22#*#+D #+\#+j#+ #+#+(#+ j#+2#+ v#+#,#, l#,J(#,` j#,j܏#,r~#,z4#,2#, #, l#, j#,܏#,~#,4#- 2#- #-, l#->2#-P #-` l#-~#-4#-2#-#.*2#.8#.(#. j#.܏#.~#.4#.2#/ #/ l#/0 j#/>~#/B4#/Z2#/l #/t l#/2#/ #/ l#/(#/ j#/܏#/~#/4#02#0 #0 l#00 j#0:܏#0B~#0F4#0f2#0t #0 l#02#0 #0 l#1(#12#14#2(#2#3H j#3R܏#3x #3܏#3 l#4 j#4܏#4"#4H #4V܏#4\ l#4k#4 j#4#5 #5 l#5L j#5V܏#5Z2#5| #5܏#5 l#5 j#52#5 #5 l#5 j#5܏#62#6 #6.܏#64 l#6L j#6^2#6p #6x l#6 j#6܏#6#62#6 #6܏#6 l#7 j#7&#7.2#7P #7X l#7t j#7~܏#72#7 #7܏#7 l#7 j#72#7 #7 l#8<T#8TЙ#8d#8v2#8|#8Й#8:#8#8#9 j#9 v#90#9X x#9` l#9x j#9 #9 l#9 j#:$ #:, l#:D j#:N܏#:t #:~܏#: l#::#:#:2#:#; j#;2#;4 #;< l#;F:#;J#;d j#;r܏#;z2#; #;܏#; l#;:#;#; j#< #<( l#<@ j# x#> l#>*2#> j#>܏#>#> #>܏#> l#?@ j#?X#?t #?| l#@ j#@8#@X #@` l#@ j#@ v#@#@ x#@ l#A~#A<!#AL!#A j#A܏#A #A܏#A l#A j#B #B l#B2:#B6#BJ4#BR2#Bl#Bv(#B j#B2#B v#B2#B x#B l#D0#DZ4#D^2#D4#D2#E(#E j#E2#E v#E4#E x#E l#F#G4#G2#G4#G2#HJ(#H\ j#Hf2#Hp v#H~4#H x#H l#Ir(#I#I#I2#I4#J4ܙ#Jn(#J| j#J܏#J4#J#J2#J #J l#J(#J j#J܏#J#J4#J2#K #K l#K*#K>#KB܏#KJ2#KXڙ#Kj(#Kx j#K Й#K l#K(#K j#K܏#K#K2#K Й#L l#L(#L$ j#L.܏#L6#L:4#L>2#LP #L` l#Ln#L#L܏#L2#Lڙ#L(#L j#L Й#L l#M(#M j#M&܏#M.#M22#M@ Й#MP l#MZ4#M^2#N(#N0 j#N:܏#NB#NJ4#NN2#N` #Np l#N #N(#N j#N v#N#O l#O #O"4#OTܙ#Op j#Oz܏#O#O4#O2#O #O l#O(#O j#O܏#O4#O#O2#O #P l#P(#P2#PXڙ#Pj(#P(#P#Pڙ#P(#Q(#Q j#Q8 Й#QH l#QX j#Qt Й#Q l#Q j#Q4#Q #Q l#Q j#Q4#Q #R l#R j#R( Й#R8 l#RB(#RP j#Rl Й#R| l#R j#R4#R #R l#R j#R4#R #R l#S(#S j#S܏#S&#S*4#S.2#S@ #SP l#SZ(#S(#TR#TV2#Tr#T#T#T j#T2#U v#U#U4#U( x#U0 l#UB4#UX j#Ub2#Ul v#Uv#U x#U l#U2#Vp j#Vz܏#V#V4#V2#V #V l#V #W#W$ j#W4 v#WF#WT#W\ l#Wl #W#W j#W܏#W#W4#W2#W #X l#X j#X"܏#X*#X.4#X22#XD #XT l#X(#YZ(#Yp j#Yz܏#Y4#Y2#Y #Y l#Y#Y#Z (#Z, j#Z6܏#Z>#ZZ#Zn#Z~#Z4#Z2#Z #Z l#Z j#[#[#[.#[>#[N4#[R2#[d #[l l#[4#[2#[ #[ l#[ j#[#[4#[2#\ #\ l#\*4#\.2#\(#\:#\#\4#\2#\#\(#\ j#] v#]( x#]0 l#]b#]n#] j#]4#]2#] #] l#^*#^..#^26#^J.#_B2#_B#_(#_ j#_ v#_4#_ x#` l#`V(#`l j#`v܏#`~4#` #` l#` j#`4#` #a l#aR(#ar(#a j#a v#a4#a x#a l#a(#b, j#b:4#bL #bT l#b(#c(#cT j#c^܏#cf4#cj2#c #c l#c j#c4#c2#c #c l#d4 j#d>܏#dF4#dJ2#dd #dt l#d j#d4#d2#d #d l#e:#e#e4#e"2#eL#e` j#ej2#et v#e2#e x#e l#e:#e#e4#e2#f#f$ j#f4 v#fP x#fX l#fz2#f(#f j#f܏#f4#f #f l#g j#g"4#g4 #g< l#g(#g j#h܏#h 4#h2#h( #h8 l#hB2#hx j#h4#h2#h #h l#h:#h#h4#h2#h#i(#i j#i$ v#iD x#iL l#iz:#i~#i4#i2#i#i(#i j#i v#j x#j l#k#k#k4#k(#ld#l2#l j#l܏#l2#m #m l#m&(#m>4#m\#m~2#m(#m#m2#n"(#n8 j#nB܏#nJ2#nh #nx l#n(#n j#n4#n2#n #n l#o:(#o4#o2#o4#p0X#pD j#pN#pR4#pZ2#ph #pp l#p4#p:#p#p4#q2#q(#q< j#qL v#qZ4#qh#qp l#q:#q#q4#q2#r#r j#r$ v#r24#r<#rD l#r4#s*(#sHX#sR(#sr2#t8 j#tB#tF2#tX #t` l#t~(#t:#t#t2#t#t(#t j#t v#u#u l#u>:#uB#ub2#ux#u(#u j#u v#u#u l#v.(#vR4#vj2#v2#vX#w4#w( j#w2#w62#wD #wL l#w4#w4#w2#xr:#xv#x4#x2#x#x(#x j#x v#x4#x#x l#y":#y&#y>4#yF2#y`#yj(#yx j#y2#y v#y4#y2#y#y l#y:#y#y4#y2#z#z(#z( j#z8 v#zF4#zP#zX l#z4#z(#{J:#{N#{n2#{#{ j#{ v#{#{ l#| #|":#|*#|F2#|d#|x j#| v#|#| l#|J#} j#} ܏#}#}2#}8 #}H l#}v:#}z#}2#}#} j#} v#}#} l#}:#~#~"2#~8#~L j#~\ v#~p#~x l#~:#~#~2#~#~ j#~ v#~# l#:##22#H#\ j#l v## l#:##2## j# v## l#:#"#B2#X#l j#| v# x# l#4#&:#.#B4#J2#d#n(#| j#2# v#4#2# x# l##4#.#6#.4#>:#B#b2#x#(# j# v# x# l#j:#n#4#2##(# j# v## l#:##64#>2#X#b(#p j# v## l#:##4#2##(# j#2#( v#62#@#H l#j:#r#4#2##(# j# v### l#$ j#.#@ #H l#4#(# j##2# # l#T j#^#b2#t #| l#(#R(#` j#j2#t v#~## l#4#r:#z#4#2##(# j# v### l# # ۙ#":#*#:4#B2#\#f(#t j# v### l#:##4#2##(# j#0 v#:#H#P l#~4#:##2##(# j# v## x# l#V4#f:#j#4#2##(# j# v#4# x# l# #6:#>#R4#Z2##(# j# v#4## l#4##64#V4#4#4####:##4# 2#4#>(#L j#\ v#j4## l##:##4#2##(# j#0 v#>4#L#T l#z:#~#4#2##(# j# v#4## l#.:#2#J4#R2#l#v(# j# v#4## l#:##4#2##(#, j#62#@ v#J4#N2#\#d l#4#V(#d j#n2#x v## x# l#&#*2#(# j#܏#2# # l#V2#`ƙ#ƙ#hܙ#p!$#4ƙ#F(#T j#^܏#t # l#Й##4d#T#Й###Й#T#Й#,#@#PЙ#|T#Й###Й# T#8Й#H#\#lЙ#2#ƙ#ƙ#2#ƙ#ƙ#"2#,ƙ#Xƙ#r2#xƙ#ƙ##2##f#j2#z##j4#T#r# 6#V(#d j#n2#x v##4## l###.##.(#24#LG#X#b2#r:#z#2## j# v## l###f2#I#:### j# v# x#( l#8#P#f#z#-# j# v##, x#4 l#X j#h v#r## l# j# v#"#0 x#8 l#d #ՙ# j# v## x# l## j#$ v#.#<#D l#N#l j#| v### l# j## # l# j# v#*#< x#D l#Z8#^#b#f# j# v## x# l#8### #@ j#J#X #` l#t j# v## x# l# j##2# # l#:##4#2#H#R(#` j#p v## l#4#2#j#2###(# j#2# v##4#2# x# l#2##<#H#T#^4#hי#r2#x#6#(# j##6#2# # l#6##6#.###"8#*#.#2#t#6#.#2#4#*#>#"4#:##2##(# j#, v#D x#L l##>:#B#b2#x#(# j# v## l#2## :##.2#D#N(#\ j#l v## l#4)#d-# #2 #h#~:##4#2##(# j# v## l#*#@#4#(#D j#N#V2#t #| l#:##2## j# v## l#B(#t j#~#2# # l#:##2## j# v#,#4 l#Z(# j##2# # l#:##2## j# v#0#8 l#z:#~#2##(# j# v# x# l#$/#J(#t##1# j#܏##2# # l##P j#Z2#d v#n# x# l#:##2## j# v## l#N:#R#r2##(# j# v## l#:##2#4#>(#L j#\ v#p#x l##:##2##J(#t j#~܏##2# # l# j#܏##2# # l#:# #*2#@#T j#d v#x#€ l#¦(# j##2## #( l#F:#J#j2#À#Ô j#ä v#ø# l#(#:##"2#8#L j#\ v#p#x l#Ĝ#Į:#IJ##2# # j#0 v#H#x x#ŀ l#Ţ2#Ŭ# j##2# # l#&:#*#J2#`#t j#Ƅ v#Ƙ#Ơ l#(# j##2# # l#V(#d j#n܏#v#~2#nj #ǜ l#(# j#܏##"2#< #L l#f(#t j#~܏#Ȇ#Ȏ2#Ȩ #ȸ l#:##2##(#, j#< v#P#X l#~(#ɸT# j##2# # l#:##&2#<#P j#` v#t#| l#ʠ'#:##2# #(#$ j#4 v#H#P l#t+#˞(# j##2# # l#&:#*#J2#`#t j#̄ v#̘#̠ l#(# j##2#$ #, l#::#>#^2#t#͈ j#͘ v#ͬ#ʹ l#(# j##2#8 #@ l#N:#R#r2#Έ#Μ j#ά v## l#(## j#&܏#.#62#D #T l#d j#n܏#v#~2#ϐ #Ϡ l#Ϯ:#ϲ#2## j# v# #( l#V:#Z#z2#А#К(#Ш j#и v## l##(#0 j#:#>2#P #X l#т:#ц#Ѧ2#Ѽ#(# j# v## l#(#:(#\ j#f#j2#| #҄ l#Ҧ(#Ҳ # j##2# # l#:##&2#<#P j#` v#t#| l#Ӱ#:##4#2##(# j#&2#0 v#>2#H#P l#Ԣ(#Ԫ#"(#*#բ(#ժ#"(#*#֢#(##ę#22#@ƙ#J4#:##4#2##(#( j#8 v#T x#\ l#$## #(#2#ڢ&#ڲ"##,#0#.###"#2#Bď#RƏ#bȏ#rʏ#v̏#zΏ#~Џ#ۂ*#ۆ2#2#2#&2#22#>2#J2#V2#b2#n2#z2#܆2#ܒ2#ܞ2#*## ۙ#.(#LT#݄ j#ݖ2#ݢ4#ݰ #ݸ l#4# # l##>:#B#Z4#b2#|#ކ(#ޔ j#ޞ2#ި v#޶2## l#߂(#ߚ#ߤ#߶(# j#2# v##4# x# l#(# j##2#$ #, l#B#|T#(# j#2# v##4## x# l#b:#fp#r4#v2###(#8 j#B#F2#P #X l#|T#(# j#2# v##4## x# l#6:#:p#B4#F2#d#T#(# j#2# v##4# x# l#&:#*p#64#:2#T# j##2# # l#ٙ#(# j#2# v##4# x# l# #(# j#2# v##4#2# x# l##4##r##(# j#2# v#4# x# l#"#2#6ď#>Ə#B#(# j#2# v#4# x# l#:Џ#>Ώ#F#(#T#T# j#܏#2#64#H #T l#T#T# j#2# v#4# x# l#(#:##4#2##, j#< v#P#X l##:##4#2## j# v#$#, l## j#2# v##4# x# l##<#F2#X# j#܏#4## # l# j#܏#"4#@#\ #l l#:##4#2## j#2# v#2# # l#v#####(# j# 2# v#"4#8 x#@ l#(# j#2# v#4# x# l#R4#~#.:#6#J4#R2#l#v(# j# v## l#:##4#2##&(#4 j#D v#X#` l##(# j#2# v##4# x# l#6(#` j#j܏#r#v4##2# # l## j#܏##4##2#( #8 l#D#t j#~܏##4##2# # l# j#܏##4#(#22#H #X l#:##4#2# #*(#8 j#B2#L v#Z2#d#l l#:##4#2##(# j#2# v#2## l##.(#< j#F2#P v#Z#^4## l#(#2#~##*4#4#2#~##(#4#62#2$ $:($^4$v2$2$r:$z$4$2$$($ j$ v$$ l$$B$F$N$j$($ j$2$ v$4$ x$ l$>($P j$Z2$d v$r4$ x$ l$($, j$62$@ v$N4$d x$l l$4$$:$$4$2$ $($$ j$4 v$H$P l$~:$$4$2$$($ j$ v$$ l$2$F($T j$^2$h v$v$~4$ x$ l$($ j$ ܏$ $ "4$ 4$ >2$ P $ ` l$ l$ j$ ܏$ $ 4$ $ 2$ $ l$ $ ($  j$ ܏$ $ 4$ ,$ :2$ L $ \ l$ p j$ z܏$ $ 4$ $ 2$ $ l$ $ ^($ v:$ ~$ 4$ 2$ $ j$ v$ $ l$ L j$ V܏$ ^4$ |$ 2$ $ l$ j$ 4$ $ 2$  $ $ l$ \ j$ f܏$ n4$ $ $ 2$ $ l$ j$ ܏$4$$0$B2$\ $l l$$"($0 j$:2$D v$N$R4$t$| l$$4$:$$4$2$,$6($D j$N2$X v$f4$r2$ x$ l$4$2$n4$r2$^:$f$z4$2$$($ j$2$ v$2$$ l$($D j$N܏$V4$t$2$ $ l$ j$4$$2$ $ l$T j$^܏$f4$$$2$ $ l$ j$܏$4$$,$>2$\ $l l$:$$64$>2$X$b($p j$ v$$ l$$$$$>4$l $($ j$$2$4$ $$ l$B:$F$^4$f2$$($ j$2$ v$2$$ l$V($n:$r$4$2$$($ j$ v$ $ l$@ j$J2$T v$^$b4$t x$| l$($ j$2$ v$$4$ x$$ l$6($` j$j2$t v$~$4$ x$ l$ $4$($2$4$$4$$4$$4$$4$$ j$ v$4 x$< l$4$ j$ $ l$ j$ v$ x$ l$R4$l j$| v$$ l$4$ j$ $ $ , l$ :4$ :$ $ 4$ 2$ $ ($! j$!2$! v$!*2$!4$!< l$!l$!|$"":$"&$">4$"F2$"`$"j($"x j$" v$"$" l$#T$#b($#n:$#v$#4$#2$#$# j$#2$# v$#2$#$$ l$$h j$$r2$$| v$$$$4$$ x$$ l$$$% j$%܏$%4$%<$%L$%b2$%p $% l$% j$%܏$%4$%$%$& 2$& $&, l$&:$&$&4$&2$&$&($' j$' v$',$'4 l$' j$'$'4$'$'2$' $' l$(L j$(V$(Z4$(^$(b2$(t $(| l$( j$($(4$($)2$) $) l$) j$)$)4$)$)2$) $) l$*, j$*6$*:4$*>$*B2$*T $*\ l$+ j$+*܏$+.$+62$+D $+R܏$+X l$+n($+rj$+vn$+zr$+t$+2$+܏$+2$+܏$+2$+܏$,P j$,Z$,h Й$,r܏$,x l$, j$,$, Й$,܏$, l$, j$,$- Й$-܏$- l$-H j$-R܏$-V$-Z2$-h Й$-r܏$-x l$- j$-܏$-$-2$- Й$-܏$- l$- j$-܏$-$.2$.( $.2܏$.8 l$/.<$/R>$/X$/nЏ$/($/ j$/$/ $/ l$0$0@ f$0xF$0$0$1($1b>$1h$1$1 ԙ$1 $2D /$2R<$2h$2t$2$2$2$2$3"<$3&@$3@$4$4&<$4\$4>$4$4$4 /$4$5 >$5 W$5<$5X$5b>$5l$5|$5 /$5>$5 W$6r>$6z>$6 W$6>$6>$6 W$7$78$7l$7$9<$:F>$:Xʙ$:d $:x$:$;*@$;.@$;8$;F@$;P$;`$;p$;$;$;@$;$;$;$;$;$;$<@$<$<,$<<$@$> $>$ l$>8 j$>F@$>X $>d l$>x j$>@$> $> l$> j$>@$> $> l$> j$?@$? $?$ l$?8 j$?F@$?X $?d l$?x j$?@$? $? l$? j$?@$? $? l$? j$@@$@ $@$ l$@8 j$@F@$@X $@d l$@x j$@@$@ $@ l$@ j$@@$@ $@ l$@ j$A@$A $A$ l$A8 j$AF@$AX $Ad l$Ax j$A@$A $A l$A j$A@$A $A l$A j$B@$B $B$ l$BB$B j$B($B j$B܏$B$B $B l$C j$C"܏$C*$C@ Й$CP l$Cl v$C l$C@$C$C$C$C$C$D$D $D,$DT$D`$D$D$D$D$D$E$E $ED$EP$Et$E$E$E$E$E$F$F$FD$FP$F$F$F$F$F$G$G($G4$GX$Gd$G$G j$G$$G l$G j$G܏$G$H Й$H l$HLʙ$Hhʙ$Hʙ$Hʙ$H!$$H$H$H$I4$I@$JP$J^<$J$J>$J$J$K /$K8 W$KT$Kd$Kt$K /$K W$Ld W$L W$L$M$O&@$O6@$OF@$OZ@$Oj@$Oz@$O@$O@$O@$O@$O@$O@$P@$P"@$P>@$PZ@$Pv@$P@$P<$P($Q j$Q$Q">$Q, $Q4 l$Qb($Qp j$Qz>$Q v$Q$Q x$Q l$RV@$Rd$Rv($R j$R>$R v$R$R x$R l$R>$SL$S`$Sz($S j$S>$S v$S$S x$S l$S$S$T,$T`$T$T$U$U\$U$U$V $Vh$V$V$WP$W$W$X$X<$X$XD$X$Y$Y($Yh$Yv($Y j$Y$Y>$Y $Y l$Y$YD$Z$Z,$Z@$Zx$Z($Z j$Z$Z>$Z $Z l$\($\<$\($\<$]J<$]N($]p$] j$]>$] v$]$] x$] l$]@$^( j$^2>$^6$^@ $^H l$^R@$^r@$_*@$a$a($a<$a($b j$b>$b v$b0 x$b8 l$b($b j$b܏$b>$b $b l$c$c@$c@ j$cJ܏$cV>$cd $ct l$c$c@$c j$c܏$c>$c $c l$d j$d܏$d@$d">$d4 $dD l$dP$dl j$dv܏$d~@$d>$d $d l$d$d j$d܏$d@$d>$e $e l$e $e< j$eF܏$eN@$eZ>$el $e| l$e$e j$e܏$e@$e>$e $e l$e$f j$f܏$f@$f*>$f< $fL l$fX$ft j$f~܏$f@$f>$f $f l$f$f@$f j$g܏$g>$g $g0 l$g<$gX j$gb܏$gj@$gv>$g $g l$g$g j$g܏$g@$g>$g $h l$h$h"@$hH j$hR܏$h^>$hl $h| l$h$h j$h܏$h@$h>$i $i l$i( j$i6܏$i>>$iH $iV܏$i\ l$ip j$iz܏$i $i܏$i l$j>$k$kʙ$k$k$lN@$lpʙ$l$l$lʙ$l@$l$mʙ$m<$nl$n$n$o"@$oX$of($ox j$o>$o v$o$o x$o l$o>$p$$p<$pJ<$pN($pv($p j$p>$p v$p$p x$p l$q$qd$q$q$r<$r($r j$r$r>$r $r l$s4$s`$s|$s@$s$s<$t @$t /$tL /$tZ<$th$tx$t($t j$t>$t v$t$t x$t l$u<$u $u,$u<$ud$u$v&@$v6@$vd$v@$v@$w$wB@$wR>$w\ʙ$wf<$w>$wʙ$w<$w@$x >$xʙ$x<$x@ /$xN<$x<$x<$x($x j$x>$x v$x$y x$y l$yd$y$y<$y$y<$y$y<$z~<$z($z j$z>$z v$z$z x$z l${`h${z(${ j${>${ v${${ x${ l${>$|@$|$|0$|@$|($| j$|>$| v$|$| x$| l$}4 $}p$}$}$~<$~>$~<$$l$$2<$`$$<$$$<$,$:<$<$<$n<$ $@$<$X$j@$$@$>$ʙ$$$$@$ $D$V@$t$$@$$$@$$4$F@$d$$@$$$@$$$$6@$T$t$@$$$@$$$"@$&>$8ʙ$D$h$t$>$$@$!ә$@$b<$D$<$>$$!ә$>$ $$>$ $4$$$<$$>($\ j$f>$j$t $| l$ $ j$ $ l$<f$>$$<$x$$($ j$$>$ $ l$($ $P$ j$$>$ $ l$N($x j$>$ v$$ x$ l$F$FH$F$H$J$BJ$F$F$FH$H$FH$H$&H$H$F$H$F$$$$$`$$<$$$$("?$p.$D ?$$L$D$$$$t$ $$,$$$N$N$6P$VN$$$$$N$"$$$$$$$$$8$D$z"$p$|$$$$$$ $^N$v"$p$|$$$$$ $$<$H$`$l$F"$4$@$d$p$$$$$&P$2R$8$BR$T$V$X$ j$( j$6P$:܏$L $X l$` j$t $ l$܏$P$ j$ $ l$8 j$X $d l$l l$$ j$.P$6܏$D $P l$x j$zN$P$P$^P$P$$t$²t$ $ $Џ$0b$BЏ$X$jЏ$2^$Ȑg$ȢЏ$x$ʄ$ʤV$g$Џ$\l$nЏ$͜"$t$DB$Џ$T"$fЏ$r^$"$Џ$t$$$4V$|"$׎Џ$צt$("$~Џ$!$:Џ$ܒ^$ !Q$ZЏ$`$l$V$!Q$BЏ$$"^$"d$Џ$$$V$"d$Џ$"$Џ$$!$6Џ$!V$"t$PB$Џ$!V$|!V$Џ$z$^$"_$ t$dB$2Џ$dV$$^$V$$"_$6Џ$![$Џ$q$Џ$($:Џ$t$B$h$$Џ%H%ZЏ%&t%TB%%L%^Џ%{%&Џ% T{% fЏ% v% Џ%$v%6Џ% %%Џ% %% %%Џ%` %%vЏ% %%Џ% %%Џ%^%V%Џ% %RЏ%, %&(%4 j%>%H v%R%Vt%l x%t l%(% j%% v%%t% x% l%n(% j%%t%% % l%(% j%%t%%( %0 l%H%f%t%%%%%(% j%% v%%t% x%  l% (% $ j% .% 8 v% B% Ft% x% l% (% j% ܏%!%! t%!%!$ %!4 l%!(%! j%!%! v%!%!t%" x%" l%"F(%"p j%"z܏%"%"t%"%" %" l%# j%# ܏%#%#t%#%#0 %#@ l%#!Ι%#(%$ j%$%$ v%$*%$.t%$<%$D l%$T%$p j%$z%$ v%$%$t%$%$ l%%|%%%&.%'"d%'.(%'@ j%'J%'T v%'^%'bt%'n%'| x%' l%'Џ%(%) "_%)&(%)8 j%)H v%)R%)Vt%)l x%)t l%)(%) j%) v%)%)t%) x%* l%*b(%+"}%+ j%+, v%+6%+:t%+L x%+T l%+ j%+ v%+%+t%+ x%, l%,"x%,T j%,d v%,n%,rt%, x%, l%,"x%,k%,m%, j%,%-&t%-4 %-< l%-X j%-b%-ft%-x %- l%-(%- j%- v%-%-t%- x%- l%-Џ%/%0t%04B%10%1%1ƙ%1%1ƙ%1%1ƙ%1%1ƙ%1%1ƙ%1%2ƙ%2%2ƙ%2&%2,ƙ%2:%2Dƙ%2R%2Xƙ%2f%2tƙ%2%2ƙ%2%2ƙ%2%2ƙ%2%2ƙ%3.%32t%4v%4x%4z%4|%5"~%5J%5r%5%5%5%6%6:%6b%6%6%6%7%7*%7R%7z%7%7%7%8%8B%8j%9 %9"%9*%96%9B%9N%9Z%9f%9r%9~%9%9%9%9%9%9%9%9%:*%:B%:N%:Z%:f%:r%:~%:%:%:%:%:%:%:%:%:%:%; %;B(%;%;%;%;%;%;%%?X%?t%?| l%@ ^%A<V%A"n%C %DN(%D%D%D%Dď%DX%E0ƙ%EЙ%Eؙ%EЙ%FЙ%F ƙ%FH j%F` %Fh l%Ft j%F %F l%Fƙ%F j%F%Fď%G %G l%G`%H<T%HF(%HX j%Hbď%Hl v%Hv%H%H%H%H l%H%I%I l%I%I^(%IT%IX%I j%I܏%I%I%I%Iď%J %J l%J.%J6ď%JT %Jd l%Jv(%JT%J(%LB(%LN:%LR%L\љ%Lj%Lrď%L%L j%Lď%L v%Lď%L%L l%M%M0%M j%M%M%Mď%M %M l%M%N%NH%Nvď%N%N%N%N j%N v%N%N%N%N%O x%O l%O8 j%OH v%OR%OV%Ol x%Ot l%O\%O j%O v%O%O%O x%O l%P %P%P z%P j%P%P%P %P l%Q j%Q v%Q*%Q.%QH x%QP l%Q^%Qh%Q j%Q v%Q%Q%Q x%Q l%Q j%Q%Q%Q %R l%R j%R&%R*%R2ď%R@ %RH l%Rl%R j%R%R%Rď%R %R l%R j%R%R%Rď%R %R l%St%S(%S j%Sď%S v%S%S%S%S l%T(%T j%Tď%T v%T%T%T%T l%Uv:%U~%Uљ%U%Uď%U%U(%U j%Uď%U v%Uď%U%V l%V6ď%V<%VN(%V\ j%Vl v%Vv%Vz%V x%V l%V ԙ%V ϙ%V %V%V(%W j%W v%W"%W&%W8 x%W@ l%WL˙%W!%W˙%W(%W j%W v%X%X %XЏ%X, x%X4 l%X@%X%Y%Y(%Z "s%Zb(%Zp j%Zzď%Z v%Z%Z%Z%Z l%[H%[\%[n(%[| j%[ď%[ v%[%[%[ x%[ l%[%\%\< j%\F%\J%\Nď%\\ %\d l%\ j%\%\%\ď%\ %\ l%\ j%\%\%\ď%\ %\ l%]:%]%]$љ%]2%]:ď%]T%]^(%]l j%]| v%]%]%] l%]:%]%]љ%]%]ď%^%^(%^( j%^8 v%^F%^P%^X l%^:%_%_љ%_%_&ď%_@%_J(%_X j%_h v%_|%_ l%_:%_%_љ%_%_ď%`%`"(%`0 j%`@ v%`T%`\ l%`~:%`%`љ%`%`ď%`%`(%` j%` v%`%a l%a:%a%aљ%a%aď%a%a(%b j%b v%b$%b, l%br:%bv%bљ%b%bď%b%b(%b j%b v%b%b l%c2:%c6%cDљ%cR%cZď%ct%c~(%c j%c v%c%c l%c:%c%cљ%c%dď%d%d&(%d4 j%dD v%dX%d` l%d:%e%eљ%e%e&ď%e@%eJ(%eX j%eh v%e|%e l%e:%e%eљ%e%eď%f %f(%f$ j%f4 v%fH%fP l%fr:%fv%fљ%f%fď%f%f(%f j%f v%f%f l%g:%g%gљ%g%gď%g%g(%h j%h v%h$%h, l%hr:%hv%hљ%h%hď%h%h(%h j%h v%h%h l%i:%i%i,љ%i:%iBď%i\%if(%it j%i~ď%i v%iď%i%i l%i:%i%iљ%i%iď%j %j(%j$ j%j4 v%jH%jP l%j:%k%kљ%k%k&ď%k@%kJ(%kX j%kh v%k|%k l%k:%k%kљ%k%kď%l%l (%l j%l"ď%l, v%l:ď%lD%lL l%ln:%lr%lљ%l%lď%l%l(%l j%l v%l%l l%m.%m6%m:%m%nљ%n%nď%n8%nB(%nP j%nZď%nd v%nrď%n|%n l%n:%n%nљ%o%o ď%o$%o.(%o< j%oL v%o`%oh l%o:%o%oљ%o%oď%o%o(%o j%p v%p%p$%p, l%pT j%p^%pp %px l%p.%q6%q>:%qF%qLљ%qZ%qbď%q%q(%q j%qď%q v%q%q%qď%q%q l%r0 j%r:%r>%rFď%rT %r\ l%r.%s6%sR:%sV%sdљ%sr%szď%s%s(%s j%sď%s v%sď%s%s l%tV:%t^%tdљ%tr%tzď%t%t(%t j%t v%t%t%t l%u j%u%u0 %u8 l%u.%u6%u:%v%v љ%v%v"ď%v@%vN(%v` j%vjď%vt v%v~%v%vď%v%v l%v j%v%v%wď%w %w l%w.%w6%x:%x %xљ%x%x&ď%xD%xR(%xd j%xt v%x~%x%x%x l%x j%x%y%y %y l%y.%y6%z:%z%z љ%z.%z6ď%zP%zZ(%zh j%zx v%z%z l%{ :%{%{љ%{&%{.ď%{L%{Z(%{l j%{| v%{%{%{ l%{ j%{%{ %{ l%|N(%|x j%|ď%| v%|%|%| x%| l%}%}%}%}%~(%:%%,љ%:%>Ώ%\%f(% j%Ώ% v%Ώ% x% l%":%F%Xљ%f%jΏ%%(% j% v% x% l%:%%љ%%Ώ%%(% j%Ώ% v%*Ώ%4 x%< l%:%%љ%%Ώ%% (%, j%< v%P x%X l%:%% љ%%Ώ%<%F(%h j%rΏ%| v%Ώ% x% l%(%p j%zΏ% v%%% x% l%0 j%:Ώ%D v%N%R%` x%h l%%0 %%"n% %%v%"n%%V%"n%(%R%V܏%^ڏ%%ڏ%% j%܏%% Й% l% j%%4 Й%D l% Й% l% j% Й% l%%.ڏ%4%h j%r܏%v%zڏ% Й% l% j%܏%%ڏ% % l%ڏ% % l%%U%%"(%@"s%d"s%~:%%љ%ڏ%%(% j% v%% l%`_% ڏ%%0%י%(%:(%H j%R܏%Z%l %| l%:%%љ%ڏ%%(% j% v%4%< l%Xۙ%p j%z%~ڏ% % l%"s%% j%%ڏ% % l%:%"%,љ%Bڏ%X%%%Fڏ%י%:%%љ%ڏ%%b%%%%b8%f%%%R(%T% j%%ڏ% % l%:%\%%ڏ%%J:%N\%Z%^ڏ%%Z%<T%F:%J%Tљ%b%jڏ%%(% j% v%% x% l%ƙ%<T%F:%J%Tљ%b%jڏ%%(% j% v%% x% l%T%:%% љ%.%6ڏ%T%^(%l j%vڏ% v%%ڏ% x% l%%% (%LT%` j%j%nڏ% % l%T% j%ڏ% v%%% l%% T%4 j%>ڏ%H v%V%d%l l%v%(%(% j%ڏ% v%% x% l%%PT%`Й%n(%v:%~%љ%Й%ڏ%% j% v%Й%4 x%< l%% j%ڏ% % l%J(%hT%| j%ڏ%T%%%:%%љ%%.ڏ%X%b(%p j% v%% x% l%%(% j%ڏ% %$ l%j(%| j%ڏ% v% x% l%b%!%%(%%ڏ%%( j%6%H %P l%%(%%ڏ%%R(%d j%nڏ%x v%% x% l%v%(%%ڏ%%< j%X %` l%t%ڏ%%(% j%ڏ% v% x%( l%%%&%r:%v%љ%%ڏ%%(% j%ڏ% v%%ڏ% x% l%%(% j%ڏ% v%% x% l%*(%%:%%љ%ڏ%%(% j% v%0 x%8 l%%:%%(љ%>ڏ%T%^(%l j%| v% x% l%B%:%%љ%%ڏ%%(%( j%2ڏ%< v%F%Jڏ%X x%` l%%^:%b%lљ%ڏ%%(% j% v% x% l%f%:%%љ%%ڏ%%(% j%ڏ% v%%ڏ% x% l%%(% j%ڏ% v%% x%( l%%%:%%љ%%ڏ% %*(%8 j%Bڏ%L v%V%Zڏ%h x%p l%%j%(% j%ڏ% v%% x% l% (%b%%%"F%2:%6%Dљ%R%Zڏ%t%~(% j%ڏ% v%%ڏ% x% l%~%ڏ%ƙ% ʙ%%%L%%%(% j% v%% x% l%(% j% v%%4 x%< l%*:%.%<љ%Rڏ%h%r(%Ā j%Đ v%Ĥ x%Ĭ l%:%%љ%ڏ%%&(%4 j%D v%X%` l%Œ:%Ŗ%Ťљ%źڏ%%(% j% v% % l%6:%:%Hљ%^ڏ%t%~(%ƌ j%Ɯ v%ư%Ƹ l%:%%љ%ڏ%%"(%0 j%@ v%T%\ l%%%":%&%4љ%B%Jڏ%d%n(%| j%Ȍ v%Ț%Ȥ x%Ȭ l%%%J%ɠ%%ڏ%ʙ%:%%0љ%>%\%f(%t j%ʄ v%ʒ%ʤ x%ʬ l%ʸ%%R%ˠ%%3% (% j%, v%6%:%L x%T l%`%̰ʙ%:%%љ%% %(%$ j%4 v%B%T x%\ l%j%|ܙ%̈́!$%͠ʙ%Ͷ:%ͺ%љ%%%(% j% v%.%@ x%H l%΄%(% j% v%%% x% l%%H%ϐ%(% j%ڏ% v%%% x% l%*%T%И%:%%љ%%ڏ%%(%, j%< v%J%\%d l%і:%њ%Ѩљ%Ѷ%Ѿڏ%%(% j% v%%% l%J:%N%\љ%j%rڏ%Ҍ%Җ(%Ҥ j%Ҵ v%%% l%:%%љ%%ڏ%8%B(%P j%Zڏ%d v%n%rڏ%Ӏ%ӈ l%(%>(%P j%Z܏%b%f%jڏ%Ԅ %Ԕ l%(% j%܏%%%ڏ% %( l%8 j%B܏%J%N%Rڏ%l %| l%(%6(%N(%ֈ j%֒܏%֚%֢%֦ڏ% % l% j%܏% %%ڏ%0 %@ l%T j%^܏%f%n%rڏ%׌ %ל l%ؔ%؞%R(%` j%j%n%r%ـ %و l%"}%(% j%*%.%6%D %L l%n:%v%z(%ڈљ%ږ%ڦ%% j% v% %( l%~:%ۂ%ېљ%۞%ۦ%%(% j% v% x% l%%8 %`"n%"x%(%%=%%,%L j%V܏%b%v%~%߆%ߠ %߰ l%|% % %D% % j%%% %( l% % j%%% % l% j%%% % l%D=%d%z(% j%% v%%%% l%^:%b^%j%n%%%(% %@ j%J%N%` %h l%:%^%%%%d j%n%r% % l%:%^%%%%%%%Z(%h%A%%% j%܏%% %( l% %Й%:%%љ%%Й%% j%܏%4Й%P %` l%% j%% % l%%4 % %% %Й% j%"܏%*%@Й%\ %l l%| j%% % l% j%% % l%A%r(% %(% j%% % l% %:%"%,љ%:%D%|%(% j%܏%% % l%%X j%f%t %| l%(% j%*%4 v%>%B%T x%\ l%(% j%% v%%% x% l%(% j%%%% % l% %4 %(%h%z%%%%ʙ% :%% љ%.%L%V(%d j%n܏% % l%"%*%N%hʙ%v%%%P %f%x%Џ%%J%![%%(%R%^:%f(%j%n%%%%%(%%l j%v܏%~%%% % l%4%LT%| j% % l%4%,T%\ j% % l% j% % l&&&љ&H&\ j&l v&v&& l&&&&![&&&4&$&0 j&:&T&t &| l&&:&(&&&&&&(&>&Dљ&p& j& v&&& l&8&&![&&&4&0&< j&F&`& & l&&:&(&&&&&&8&N&Tљ&& j& v&&& l&H&&![&& &$4&@&L j&V&p& & l&&&&:&&љ&&& & *(& 8 j& H v& `& h l& & & :& & љ& & & (& 2(& @ j& P v& d& l l& & :& & љ& & & & (& j&  v& & ( l& J:& N& `љ& n& v& & (& j& v& & x&  l& & :& & љ& & & 8& B(& P j& Z& d v& r& & l& & :& & љ& & &&(&( j&8 v&P&X l&&&&&܏&"(& j&( &6܏&< l&P&Z:&^&lљ&z&&&(& j& v&& l&T&f:&jЏ&vZ&z&&&(& j& v&&&& l& &&"Z&(&&"U&"U&::&>&Hљ&V&^&& j& v& x& l&"U&&6&:&F&6:&:Z&Z&l&:&\&&&>(&&܏&T& j& Й& l& j& Й& l&0 j&D Й&P l&l j& Й& l& j& Й& l&& j& Й&$ l&8 j&L&\&| & l&&T& j&܏&& &$ l&&&$"K&N&R&Z&T&&&&&(&( j&2&< v&L&Z&l &t l&&(&T& j&"܏&*&2&H &T l&"K&& & "Z& (& :& & љ&!&!&!,&!6(&!D j&!T v&!l x&!t l&!:&!&!љ&!&" &"(&"2(&"@ j&"P v&"l x&"t l&""U&""U&# &#&#&#:&#Z&#&$ &$*:&$.^&$R&$h&$&$&%<"K&%h!&%&%(&% j&%&% v&%&%&% && l&&h&&&&&&&& j&&܏&&&&&& &' l&',&'>&'D&'N&'R&'^&'&'&'&'&'&'&(&(&(&(&)"&)J&)&)&*~(&* j&*&*&*&* &* l&*"}&+D"}&+n(&+ j&+&+&+&+ &+ l&+:&+&+љ&+&,&,0&,:(&,H j&,X v&,&, l&-Z:&-^&-lљ&-z&-&-&-(&- j&- v&- x&- l&.F&.&/6&/D&/X&/j(&/x j&/&/ v&/&/&/&/&/&/ l&0,&0:&0D&0b&0l&0~&0&0(&0 j&0&0 v&1&1&1&1 &1( l&1&1&2"n&2"x&2"x&3(&3 j&4&4 v&4*&44&4< l&5(T&52(&5@ j&5J&5N&5d &5l l&5&5(&5 j&5&6 v&6&6&6<&6D l&6^:&6b\&6n&6r&6&6:&6\&6&6&6&7 &7 &7 &8r(&8 j&8&8&8 &8 l&9@&9r(&9 j&9&9&:&: &: &: l&:^&:r&:~&:&: &: l&:&;&< 5&< &<4&&> v&>&>(&>0 l&>B&>(&? j&?&&?6&?D &?L l&@`&A j&A&A&A, &A4 l&AJ(&A` j&Aj&An&A &A l&A(&A j&A&A&A &A l&B5&B &B(&B j&B&C v&C&C&C, x&C4 l&C&C &D&D &ET&E(&E&F;&F,&F@&Fd j&Fn܏&Fz&F&F &F l>Й&Gf:&Gj&Gtљ&G&GЙ&G&G&G j&G܏&HЙ&H &H0 l&H`&HЙ&H j&H&H&H &H l&I j&I&I v&I.&I< x&ID l&I\ j&If&Ij&I| &I l&I;&I:&I\&I&I&J&JTЙ&Jf:&Jj&Jtљ&J&JЙ&J&J&J(&J j&J܏&KЙ&K$ &K4 l&Kd&Ll &L &L &LT&M"(&Ml j&Mv&Mz&M &M l&N(&N&N j&N&O&O &O l&P@ &Q&Q &Q&Q &RT&R"(&R0 j&R:&RD v&RN&RR&Rd x&Rl l&S &S( &S< &V.(&V@ j&VJ&VT v&V^&Vb&Vt x&V| l&V(&V j&V&W v&W&W&W$ x&W, l&Xz(&X j&X&X v&X&X&X&X l&Yh&Z(&Z6(&Z j&Z܏&Z&Z&Z&Z&Z &Z l&[&[ j&[&܏&[.&[6&[:&[L &[\ l&[l j&[v܏&[~&[&[&[ &[ l&[ j&[܏&[&[&[ &[&\ &\ l&\$ j&\.&\2&\:&\H &\P l&\j(&\x j&\&\&\&\ &\ l&\&]&^ (&^ j&^"&^, v&^6&^:&^L&^T l&^Z&^(&^ j&^&^ v&^&^&^&^ l&_&_&(&_4 j&_>&_H v&_R&_V&_d&_&_ l&`D&`j&`n&`:&`\&a&a&a(&aX&aj(&a j&a &a l&a(&b j&b &b v&b"&b,&bL&bT l&c8 &cF(&cl j&cv&cz&c~&c &c l&e&e&eT&f&f"&fDʙ&fZ:&f^&fpљ&f~&f&f(&f j&f܏&f &f l&g&g&g&gʙ&g&h &h&h&&h8&hP&i$&i6(&iD j&iN&iX v&ib&if&it&i&i l&i&i&i&j \&j<&jX&jh&l&l &l(&l j&l&l &l&m &m l&mD"}&m(&m j&m&m &m&m &m l&m:&m&m(&nљ&n &n&&nP&nd j&nt v&n&n l&n:&o&oљ&o &o&&o@&oJ(&oX j&oh v&o| x&o l&p& &p &p&p"n&q|"x&r(&r&r5&r&r&s j&s"܏&s.&sB&sJ &sR&sl &sz܏&s l&t j&t &t&u &u l&uX&u &u&u&u j&u &u&v &v l&v( j&v2 &v6&vL &vT l&v| j&v&v v&v &v x&v l&v j&v &v&v &v l&w45&wL&wb(&wp j&wz&w v&w &w&w&w l&x^:&xb\&xj &xn&x&y&y(&y< &y` j&yj &yn&y &y l&y:&y\&y &y&y&zD&zt &z j&z &z&{ &{ l&{":&{&\&{2 &{6&{X&{:&{\&{ &{&{&|T&}(&}&};&}&}&~ j&~"܏&~.&~F &~d &~t l&~Й&~:&~&~љ&~ &~Й&&8&L j&V܏&pЙ& & l& &@Й& j& && & l&$&T &x& j& && & l& j&& v& & x& l&0 j&: &>&P &X l&x;&(& &(&( j&2 &6&H &P l&l &&:&&љ& &&&&(& j&܏&0&L &\ l&x& j& && & l&(& j&& v&* &4&< l&(& j&*&4 v&>&B &T x&\ l&(& j&& v&& & x& l&J(&X j&b&l v&v&z && l&(& j& & v&&" &0&8 l&&6(&n(& j&܏&& &&& & l&$&8 j&B܏&J&R &V&h &x l&& j&܏&& && & l& j&܏& &&8 &J&X &h l&| & j&& && & l&(& j&& && & l&X&8&J(&X j&b&l v&v&z && l&Z&(& j&& v&& && l&L&^(&l j&v& v&& &&& l&|&(& j&& v& &&& l&&:&\& &&&(& j&* &.&@ &H l&j:&n\&z &~&&F(&X j&b&f &j&x & l& & &(&&T&b&&ʙ&:&&љ& &&(& j&܏&@ &P l&&&& &@ʙ&N&Z&h&4 &H &\ &&P?&:(&X&8&:& j&"<&, v&:>&L x&T l&>&<&& j&.>&6<&H &P l&l j&>&<& & l&<& & l&8&Lՙ&` j&j܏&r>&v<& & l&>(&>& j&<& v& x&$ l& j&܏&<& & l&:&&(љ&:<&h& j&܏&<& & l&:&& љ&P j&Z<&d v& x& l&B&H j&R܏&Z>&^<&t & l&(& j&܏&>&<& & l&F>&>&:&& љ&6<&L&V(&d j&t v&& l&:&&љ&<&&"(&0 j&@ v&T&\ l&(& j&܏&&<& & l&( j&>&N<&l &t l&:&&љ&<&&(& j& v&& l&>:&B&Pљ&f<&|&(& j& v&& l&(& j&܏&<&4 &D l&X j&f<&| & l&(&:&&љ&<&& j& v&0&8 l&x j&܏&<& & l& j&<& & l&(&:&&$љ&:<&P&d j&t v&& l& j&<& & l& j&܏&"<&@ &P l&b(&n:&r&љ&<&& j& v&& l&, j&:<&P &X l&l j&v܏&~<& & l&(&:&&љ&<&& j&, v&@&H l& j&<& & l& j&܏&<& & l&&:&&љ&">&*<&D&N(&\ j&f<&p v&z&~<&& l&:&&љ&>&<&&(& j&$ v&.&<&D l&>&(&$&F<& j&܏&<&@ &P l&b:&n&|љ&<&& j& v&& l&$ j&:<&H &P l&b:&f&pљ&<&& j& v& x& l&(& j&&>&<& & l&>>&T&&N:&R&`љ&n>&v<&&š(&¨ j&¸ v&& l&R:&V&dљ&r>&z<&Ô&Þ(&ì j&ü v&& l&:&&љ&">&*<&D&N(&\ j&l v&Ā&Ĉ l&b:&j&pљ&~>&ņ<&Š&Ū(&Ÿ j&<& v&&<&& l& :&&љ&&>&.<&H&R(&` j&p v&z&ƈ&Ɛ l&ƪ:&Ʋ&Ƹљ&>&<&&(& j& v&&(&0 l&J:&R&Xљ&f>&n<&Lj&ǒ(&Ǡ j&ǰ v&Ǻ&& l&:&&љ&>&<&(&2(&@ j&P v&Z&h&p l&Ȧ:&Ȯ&ȴљ&>&<&&(& j& v&&$&, l&b<&f&d&ʒ:&ʖ&ʤљ&ʲ>&ʺ<&&(& j& v&& l&::&>&Lљ&Z>&b<&|&ˆ(&˔ j&ˤ v&˸& l&̶:&̺&љ&>&<&& (& j&( v&@ x&H l&z&͆<&ͦ(&L j&Z>&l &t l&Ϊ:&ή&μљ&>&<&&(& j& v&(&0 l&b:&j&tљ&ς>&ϊ<&Ϥ&Ϯ(&ϼ j& v&& l&Ђ>&>&::&>&Hљ&^<&t&~(&ь j&і<&Ѡ v&Ѯ<& x& l&Ғ>&:&&љ&>&<&&(&D j&N܏&V>&p &Ӏ l&.(&B>&r:&v&Ԁљ&Ԗ<&Ԭ& j& v& x& l&,&><&Ւ&դ&:&&љ&<&&, j&< v&\&d l&ֆ:&֊&֔љ&֪<&& j&܏&<& & l&הę&צ(&ײ:&׶&љ&>&<&&(& j& v&< x&D l&N(&l j&v܏&~>&؆<&ؠ &ذ l& j&>&<& & l&&.:&2&@љ&N>&V<&t&~(&ڌ j&ڜ v&ڼ x& l& &2:&6&@љ&N>&V<&x&ۂ(&ې j&۠ v&& l&J&<&8&t&&:&&љ&>& &*(&8 j&H v&d x&l l&&(& j& v&>&$ x&, l&ޠ&B&R:&j&pљ&~>&߆<&ߨ&߶(& j&܏&>&<& & l&d j&r>&<& & l&(&4 j&>܏&F>&J<&d &t l&(& j&<& v&>&<&& l&@#&R(&d j&n<&x v&>&<& x& l& j&>&<& & l&b(& j&܏&>&<& & l& j&>&<& & l&(&4 j&>܏&F>&J<&d &t l& j&>&<& & l&(& j&܏&>&<& & l&` j&n>&v<& & l&<&(&H j&X v&f>& x& l& j&*܏&2>&X &h l&3& j& v&*>&< x&D l&t&:&&љ&>&& j& v&& l&:&&љ&>&& j&, v&X x&` l&>&:&&љ& & j&0 v&P x&X l& j& v&& l& j& v& x&( l&:&&љ&>& &P j&` v&| x& l&&:&&љ&>&(&< j&L v&p x&x l& j&܏&>& &$ l& j&܏&>& & l& j& ܏&>&0 &@ l&~:&&љ&>&& j& v& x& l&p j&>& & l&:&&љ&>&&( j&8 v&d x&l l&>& j& v&>&$&, l&l j&| v&>& x& l& j&>& & l&(&l j&| v&>&& x& l& j&܏&>& &$ l&(& j&܏&>&.<&@ &P l& j&܏&>&<& & l&(& j&"܏&*<&D &T l& j&<& & l& j& <& v&">&4 x&< l&n(& j&<& v&>&& l& j&>&<& & l&B(&r(&(& j&<& v&>& x& l&Z(&v(& j&<& v&>&& l& j&>&<& & l&:&& љ&.>&6<&X&&>:&B&Lљ&Z>&b<&&(& j&<& v&<& x& l&('$ j'.܏'6>'><'X 'h l''':''љ'>'<'' j' v'< x'D l'B'P'l j'v܏'~>'<' ' l' j'>'<' ' l'L j'V܏'^>'f<'| ' l'6>'V:'Z'dљ'r>'z<''(' j' v' x' l'('4'<'N('h j'r܏'z>'<' ' l' j'&܏'.>'6<'T 'd l'r:'v'љ'>'<'' ' (' j' ܏' >' <'  ' $ l' j' ܏' >' <' ' l' ' ~.' 6' (' 6' j'܏'>'<' ' l':' 'љ'&>'.<'H'\ j'l v'' l':''љ'>'<'' j' v'0'8 l'Z:'b'hљ'v>'~<'' j' v''>'' l' j'"'&>'8 '@ l'(' j'<' v'>' x' l'>'(' j'܏'>'<' ' l'$ j'2>':<'L 'T l'(' j'܏'>'<'( '8 l'B('n(' j'܏'<'>' ' l' j'&>'6<'P 'X l'z>'(' j'܏'>'<' ' l', j':>'><'T '\ l' j'>'<' ' l'(':' B'z('8'B(''':''љ'>'<'D'N('\ j'l v' x' l' j'>'B' ' R<' h ' p l' j' ܏' ' B' >'!6<'!@ '!P l'!j<'!t '!<'":>'"H'"l j'">'"B'"<'" '" l'# j'#܏'#"B'#*>'#<'# '#܏'# l'#<'# '#<'# '$2<'$@ '$N܏'$T l'$n<'$| '$<'$ '$'%B'%rB'%B'%'&v.'&6'&6'&(''b>''('' j''<'' v'' x'' l'(~('( j'(<'( v'( x'( l')h j')r܏')z>')~<') ') l'):')')љ')>')<')')('* j'* v'*0'*8 l'*f:'*n'*tљ'*>'*<'*'*('* j'*<'* v'*'*<'*'+ l'+, j'+6'+:<'+L '+T l',"',&n',2l',6j',:p',>t',Fr',`ԙ',lԙ',|֙',֙',',ڙ',ڙ'-('- j'-<'- v'->'- x'- l'.(ڙ'.'/'1\'2'3B'3h'3t'3Й'3'3:'3љ'3>'3<'4'4('40 j'4@ v'4d x'4l l'4ՙ'5:('6, j'66<'6@ v'6N'6Z>'6l x'6t l'6ՙ'6:'6'6љ'7>'7 <'7('7< j'7L v'7t x'7| l'7%'7ՙ'7%'7ՙ'8F>'8N:'8R'8\љ'8r<'8'8ՙ'8 j'8܏'8<'8 '9 l'9 j'9<'9( v'96>'9T x'9\ l'9pՙ'9 j'9>'9<'9 '9 l'9ՙ':0ՙ':x':(': j':<': v':>'; x'; l'< j'<>'<<'<, '<4 l'<4'<'<4'<'<'=( j'=< Й'=D l'=X'=p j'= Й'= l'= j'= '= l'=:'='=љ'=>'><'>'>&('>4 j'>><'>H v'>V<'>`'>h l'?.^'@^<'@<'@'A'A"('AD'AZ<'A^<'Ab<'Af<'Aj<'A|!o'A!o'A!o'B'B'B j'B<'B v'B>'B<'B x'B l'B'C W'C, j'CD 'CL l'Ch!o'C<'C<'C'C j'C<'C 'D l'D:'D'D љ'D.>'D6<'D\'Dp j'Dz<'D v'D<'D'D l'DV'F:'F'Fљ'F*>'F2<'FL'FV('Fd j'Ft v'F x'F l'G'G":'G&'G0љ'G>>'GF<'G`'Gj('Gx j'G v'G x'G l'G'G:'G'Hљ'H>'H<'H4'H>('HL j'H\ v'H x'H l'H'I 6'I<6'I:'I'Iљ'I>'I<'I'I('J j'J v'J8 x'J@ l'J`'Jv8'J'J6'J6'J:'J'Jљ'K>'K<'K('K2('K@ j'KP v'K x'K l'Lv('Lz'L~<'L>'L܏'L>'L܏'L>'M'N( j'N6܏'N:>'NT 'N^܏'Nd l'O j'O>'O<'O 'O l'O j'O܏'O>'O<'O 'P܏'P l'PD j'PN܏'Ph 'Pr܏'Px l'P j'P 'P܏'Q l'Q$ j'QD 'QN܏'QT l'Qr:'Qv'Qљ'Q>'Q<'Q'Q j'Q v'Q>'R x'R l'RD j'RN<'RX v'Rf>'Rx x'R l'S j'S>'S 'S l'S j'S܏'S>'S 'T܏'T l'T j'T>'T<'T 'T l'U j'U܏'U>'U<'U< 'UJ܏'UP l'UT'U'UЙ'V'V<'V'V,Й'VL'VV:'VZ'Vdљ'Vz>'V'V j'V v'V>'V'W x'W$ l'WR:'WV'W`љ'Wn>'Wv<'W'W j'W v'W>'W x'W l'Y.'Y6'Zz('Z j'Z'Z>'Z<'Z 'Z l'Z('[ j'[&'[*>'[2<'[@ '[H l'[p'[('['['[%'[ j'\>'\<'\ '\$ l'\2:'\:'\@љ'\N>'\V<'\t'\('\ j'\ v'\'\>'\'\ l'] j'] ']>'] ']( l']<'^('_8 j'_F>'_R<'_` '_h l'_| j'_܏'_>'_<'_ '_ l'`:'`'`љ'`>'`<'`'`('` j'a v'a( x'a0 l'b:'b&'b,љ'b:>'bB<'bh'br('b j'b<'b v'b<'b x'b l'c('d j'd*>'d6<'dD 'dL l'dZ:'d^'dhљ'dv>'d~<'d'd j'd v'e x'e l'eL j'eV܏'e^>'ef<'e 'e l'f:'f'fљ'f>'f<'g'g('g j'g&<'g0 v'g><'gX x'g` l'h^:'hb'hlљ'hz>'h<'h'h('h j'h v'h x'h l'j>('j>'kl'k j'k<'k v'k>'k'k l'l j'l܏'l>'l<'l 'l܏'l l'm <'m 'm"܏'m( l'm><'mH 'mV܏'m\ l'mn<'mx 'm܏'m l'nf<'nxƙ'o..'oF6'pf('pt j'p~<'p v'p>'p'p l'p('q>'r.6'rp j'r~>'r<'r 'r l'r('r j's<'s v's>'s, x's4 l'sp j's~>'s<'s 's l's:'s'sљ's's<'s't>'t('t2('t@ j'tP v't x't l't't't'u'u6'uN'uj:'ur'uxљ'u>'u<'u'u('u j'u v'u'u'v l'v"('v0 j'v:'vL 'vT l'vv:'v~'vљ'v>'v<'v'v('v j'v v'v'w'w l'w('x j'x<'x v'x.>'x<'xD l'y.'y66'y~:'y'yљ'y>'y<'y'y('y j'y<'y v'y<'z'z l'z>'z('z j'z<'z v'{ x'{ l'| :'|'|љ'|&>'|.<'|L'|Z('|l j'|| v'|'|'| l'| j'|'| '| l'}\'}l'}|'}:'}'}љ'}>'}<'~,'~6('~D j'~T v'~t x'~| l'~<''$<'8'X<'l'<''(' j'*>'.<'@ 'H l' j' ' l' j' Й' l' j' Й'( l'< j'X '` l't j' ' l'Z''''2('@ j'J<'T v'b>'p x'x l'*>'B<'Z<'r<'<'<'<'('<' j'܏' >'<'$ '4 l'><' ('H j'R܏'Z<'^>'| ' l'B'(' j' ܏'<'>'4 'D l'b<'B'('<'('<'܏'܏' j' '"܏'( l'2(' j'܏'<' ' l'('$ j'.܏'2<'D 'T l't j'~܏'<' ' l'(' j'܏'<' ' l' (' j'0 Й':܏'@ l'J('d j'n܏' Й'܏' l'(' j'܏'>'<' ' l' (''ϙ'(', j'6<'@ v'N>'` x'h l'~''''^'p'' '2('D j'N<'X v'f>'x x' l'ՙ'>''6'('B<'x'''@ j'J<'T v'p x'x l'ՙ'( j'8 v'T x'\ l'(' j'<' v' x' l'ՙ'N('\ j'f<'p v' x' l'ՙ''(' j'<'$ v'@ x'H l'\ՙ'<''''`'| j' v' x' l'>'<'י'0ՙ'b('p j'z<' v'>' x' l'ՙ''(':''љ'>'<'' (' j'( v'H x'P l'dՙ':''љ'>'<''(' j' v', x'4 l'b:'j'pљ'~>'<''(' j'<' v'<' x' l'T' ':''$љ'2>'B<'d'n('| j' v'' x' l'v(' j'<' v'>' x' l' j'܏'>' <'( '8 l'd j'n<'x v'>' x' l' j'܏'>'<'0 '@ l'\ j'f܏'n>'r<' ' l' j'܏'>'<' ' l':''љ'>'<''('( j'2<'< v'J<'T'\ l'('>'$ j'.'2<'D 'L l'r:'v'љ'<'' j'<' v'<'' l':''љ'>'<''('( j'2<'< v'J<'T'\ l':'@'B':''$љ'2@':D'T'^('l j'vD' v'D'' l':''љ'@'D''('( j'8 v'L'T l'@'"s':' (''љ'*D'L'z(':''љ'D'' j' v' ' l':''љ'D'' j' v' x' l'D'VD'd' j'܏'' ' l'''':''$љ'2@':D'T'^('l j'| v'' l':''љ'@'D''(' j' v' '( l'J:'N'\љ'j@'rD''(' j' v'' l':''љ'@'D''(' j'D' v'D' '( l' :''љ'*@'2D'L'V('d j't v'' l'J.'b6':''љ'"@'*D'H'V('h j'x v''' l' j'' ' l':'',љ':@'BD'\'f('t j'~D' v'D'' l'^:'b'pљ'~@'D''(' j' v'' l':''љ'@'D'0':('H j'RD'\ v'jD't'| l':''љ'@'D''(' j' v'' l'.'6'^:'b'pљ'~@'D''(' j'D' v'D'' l'>:'F'Lљ'Z@'bD''(' j' v''' l' j'' ' l':''љ'@'D' '*('8 j'H v'\'d l'B:'F'Tљ'b@'jD''(' j'D' v'D'' l':''$љ'2@':D'T'^('l j'| v''˜ l''*'\"n'ö@'''D''"':'('F'Hљ'V@'^D'|'Ő j'Š v'Ū'Ů@' x' l''љ' @'D','@ j'P v'Z'^@'l x't l'Ɔ'ƈљ'Ɩ@'ƞD'Ƹ' j' v''@' x' l''љ'"@'*D'L'` j'p v'z'~@'ǐ x'ǘ l'(' j' ܏''@'"D'4 'D l'Ⱦ:''љ'D','6('D j'ND'X v'b'fD'ɀ x'Ɉ l'ɺ'ɼљ'D''(' j' v'"'8 x'@ l'R'Tљ'ʚD'ʸ'(' j' v'', x'4 l'.'6'j:'n8'j@'͢:'ͦ'ʹљ'@'D''(' j' v'( x'0 l'~8'Ά:'@'&:'*'8љ'F@'ND'l'v('τ j'ϔ v'Ϭ x'ϴ l':'B'8'V@'n:'r'Ѐљ'Ў@'ЖD'д'о(' j' v' x' l'::'>'Lљ'Z@'bD'р'ъ('ј j'Ѩ v' x' l'h'B:'J'Pљ'^@'fD'҄'Ғ('Ҥ j'Ҵ v'Ҿ'' l' j'' '( l'Ӟ:'Ӣ(''љ'D'' j'D'( v'2'6D'L x'T l'Ԇ'Ԉљ'ԚD'Ը' j' v'' x' l'&'(љ':D'X'l j'| v'Ն'՘ x'ՠ l'n.'ֆ6':'8'@':''љ'@'&D'D'N('\ j'l v'؄ x'، l'8':'2@'r:'v'لљ'ْ@'ٚD'ٸ'(' j' v' x' l'*:'.B'N8'ښ@'ڲ:'ڶ'љ'@'D''(' j' v'8 x'@ l'~:'ۂ'ېљ'۞@'ۦD''(' j' v' x' l'<j'~:'܆'܌љ'ܚ@'ܢD''(' j' v'' ' l'@ j'J'\ 'd l':'(' ' љ'*D'@'T j'^D'h v'r'vD'ތ x'ޔ l''љ'D'' j' v'&'8 x'@ l'f'hљ'zD'ߘ'߬ j'߼ v'' x' l'.'6'(' j'܏''@'D' ' l'@'@'l'@'r@':''љ'@'D''(' j' v'' @''$ l'X j'b'f@'x ' l'6':''љ'@'D''(' j'D'$ v'.'2@':D'H x'P l''љ'@'D''(' j' v''@' x' l'Tl'(' j'D' v''@'' l'R('j' ' '(' j'&D'0 v':'P'X l'j:'n@''љ'D''(' j' v'' x' l'>'@љ'VD'p'z(' j' v'' x' l'6'('@''D' '4 j'>܏'T '^܏'d l'''<' j' v' x' l'D j'T v't x'| l' j' v' x' l'< j'L v'l x't l' j' v' ' l'$t'<v'H j'` 'h l''l j'zD' ' l' j''@'D' ' l'^('D' j'܏''@'D' ' l'4 j'>D'H v'R'V@'h x'p l'@ j'J܏'R'Z@'^D' ' l'n6':''љ'@'D'4'>('L j'VD'` v'nD'| x' l':''љ'@'D''(' j'0 v':'X x'` l't j' v'' ' l'':'"8'RB'(' j'܏'&'*@'.D'D 'T l''Pp'f:'j8'.'6(:((љ(@(D(((( j( v(( @( x($ l(:(<љ(J@(RD(t(~(( j( v((@( x( l(:(@(&((6(8љ(ND(h(| j( v(( x( l((љ(D(( j( v(*(@ x(H l(f:(j8(:(@((((љ(D(,(@ j(P v(Z(l x(t l((љ(D(( j( v(( x( l(:("8(:(@((((љ(D(( j( v(( x( l(2(4љ(JD(h(| j( v(( x( l(8(:(n(r:(z(љ(@(D(((( j( v((( l( j(&(8 (@ l(.(6( :( @( (( ( љ( D( ( j( D( v( ( D( x( ( l( b( dљ( zD( ( j( v( ( x( l( ^:( b@( j(( z( |љ( D( ( j( v( ( x( l( ( љ( "D( @( T j( d v( n( x( l( :( 8( B( N:( R@( Z(( j( lљ( D( ( j( v( ( x( l( ( љ(D(0(D j(T v(^(t x(| l(8(:(p(:(B(v:(z@((((љ(D(( j( v(( x( l("($љ(:D(X(l j(| v(( x( l(:((љ(@(D((((( j(8 v(B(T(\ l(p j(z( ( l(~.(6(pr(.(6(f:(z(|љ(@(D(((( j( v((@( x( l(:(<љ(J@(RD(t(~(( j( v((@( x( l(B:(F@(N((^(`љ(vD(( j( v(( x( l((љ(D($(8 j(H v(R(h x(p l(:(@( (((љ(2D(L(` j(p v(z( x( l((љ(D(( j( v(($ x(, l(v:(z@((((љ(D(( j( v(( x( l("($љ(:D(X(l j(| v(( x( l(:((љ(@(D((((( j(8 v(B(T(\ l(p j(z( ( l(.(66(:(@((((љ(D( ( j(*D(4 v(>(BD(T x(\ l((љ(D(( j( v(( x( l(:(@((((љ(D(( j( v( (  x( l( 6( 8љ( ND( l( j( v( ( x( l(!>:(!B@(!J((!Z(!\љ(!rD(!(! j(! v(!(! x(! l(!(!љ("D(" ("4 j("D v("N("d x("l l(":("@("(("("љ("D(#(# j(#( v(#2(#D x(#L l(#b(#dљ(#zD(#(# j(# v(#(# x(# l($:($($љ($"@($*D($H($V(($h j($x v($($($ l($ j($($ ($ l(%2D(%Tƙ(%ƙ(&ř(&@(&('('@('př('"n('"x('ř(((((D() j()܏()()&@()*D()T ()d l() j()D() v()()@() x() l(* j(*D(* v(*(*@(* x(* l(+t j(+~܏(+(+@(+D(+ (+ l(,"}(-:(-(-(љ(-6@(-:D(-h(-r((- j(- v(-(- l(.((. j(.D(. v(.(.@(. x(. l(.((/4 j(/>܏(/F(/J@(/ND(/l (/| l(/((0((0 j(0D(0 v(0(0@(1 x(1 l(2((3"6(3^((3l j(3vD(3 v(3(3@(3 x(3 l(4((5 j(5D(5 v(5"(5&@(5@ x(5H l(5((6D(6ƙ(7.(76(7D(7ƙ(7x(7D(7ƙ(8D(8ƙ(8*D(80ƙ(8BD(8Hƙ(8ZD(8`ƙ(8vD(8|ƙ(8D(8ƙ(8D(8ƙ(:F(:H(:"J(:&L(:.N(:2(:6P(::R(((FbX(FX(F"n(GZ(HZ(HT"n(H\(RZT(R((R j(RV(R v(R(R x(R l(SV(S(S("s(SJ((SX j(SbV(Sl v(Sv(S x(S l(S"s(T<"s(TnV(Tt(T"s(T"s(TV(T(U "s(UD"s(U^(V~`(Wb(WP(W\(X"n(X((X j(X܏(X(XT(XV(Y (Y l(Y`"}(Yv((Y j(YV(Y v(Y(YT(Y x(Y l(Z"}(Z((Z( j(Z2V(Z< v(ZF(ZJT(Z\ x(Zd l(ZrV(Z(Z((Z"}(Z((Z j([ v([ ([T([ x([( l([l([~(([ j([ v([([T([ x([ l(\ (\((\0 j(\@ v(\J(\NT(\` x(\h l(\ j(\܏(\(\T(] (] l(])(]((]j(^l(^&n(^p j(^~܏(^n(^j(^l(^(^T(^V(^ (^܏(^ l(_"V(_, (_FV(_P (_nV(_x (_܏(_ l(_V(_ (_V(_ (`((`\ j(`f܏(`n(`rT(`vV(` (` l(aj((ax j(a܏(a(aT(aV(a (a l(b((b j(bV(b( v(b2(b6T(bL x(bT l(b%(b((c j(cV(c v(c&(c*T(c< x(cD l(cV(d%(d((d( j(d2܏(d:(d>T(dBV(dX (dh l(e )(eBj(ebn(ef((e j(e܏(en(ej(el(e(eT(eV(f (f l(fVV(f` (fp l(f((fl(f((g j(g(gT(g&V(g4 (g< l(g((g j(g܏(g(gT(gV(g (h܏(h l(h^((h)(h((i$ j(i.(i2T(i:V(iH (iP l(i'(i((i j(iV(i v(i(iT(i x(i l(j((j j(j܏(j(jT(jV(j (k l(k2((k(k j(k܏(k(kT(kV(l (l l(lz((lT(l(lV(n)(n0'(nT%(n j(n܏(n (n܏(n l(n j(n v(o x(o l(oh j(o| v(o x(o l(o j(o v(o x(o l(p j(p0 v(pP x(pX l(p j(p(pT(pV(p (p l(q\(qn((q j(qV(q v(q(qT(q x(q l(r(r&((rP j(rZ܏(rb(rfT(rjV(r| (r l(r((r j(rV(r v(r(rT(r x(r l(s0(s((s(t4 j(t>V(tH v(tR(tVT(tl x(tt l(t j(tV(t v(t(tT(t(t x(t l(u j(u(uT(uV(u (u l(v j(v܏(v(v"T(v&V(v8 (vH l(v((wj(w((wT(wn(wl(w(wV(xJp(x^r(xnt(yB((y j(y܏(y(yT(yV(y (y l(z( j(z2܏(z (z܏(z l(z (z ({܏({ l({( ({l j({~V({ ({ l({ j({V({ (| l(|( j(|6܏(|>V(|X (|f܏(|l l(|j(|((|T(|n(|l(|(|V(}*p(}>r(}Nt(~ j(~܏(~ (~܏(~ l(~ (~ (~܏(~ l( (>((BT(Nn(Rl(^(bV(p(r(t( j(܏(j( (܏( l(8 (l (v܏(| l( (((T(n(l(j((V(Jp(^r(nt( j(܏(t (~܏( l( ( (܏( l( ()(j(l(n(^n(z(( j((T(V( ( l(l)(j(l(n((( j(&(*T(2V(@ (H l(zn(p(p(r(r(t()(j(l(*n(Np(jr(~t(Nr(np(n((( j((T(V( ( l()(l)(~(( j((T(V( ( l()((( j((T("V(0 (8 l(^V(pƙ(ƙ(ƙ(ƙ(ƙ(d)(j(l(*n(vt(r(p(ƙ(8ƙ(ƙ(ƙ(ƙ(Hƙ(,)(>((l j(v(zT(V( ( l(^^(!("x("n( "x(D"x(`"x(x((( j(V( v((T( x( l(V((p j(z܏((T(V( ( l(&($ j(.V(8 v(B(FT(X(` l("}( j(V( v((T(( l((J(8(X j(bV(l v(v(zT(( l(V(("}( j(0 v(:(>T(P(X l(( j( v((T( x( l(8(X j(h v(r(vT( x( l( j(܏("(*T(@ (L l( )(.((\ j(fV(p v(z(~T( x( l(T(t+(Џ(( j(܏(V( ( l( (2Џ(8 j(BV(L v(V(l x(t l( j(܏((V( ( l(>V(H (X l(~V( ( j(܏((V( ( l( +(6Џ(T j(^܏(f(nV( ( l( j(܏((V( ( l( j(܏((V( (, l(@ j(JV(T v(^(t x(| l(((T( j(܏((&V(< (L l(((( j(2܏(:(>T(BV(X (h l(V(%((($ j(.V(8 v(B(FT(X x(` l((( j(V( v(( T( x(( l(^((l j(v܏(~(T(V( ( l(+(Џ((( j(܏((V( ($ l(.((D j(N܏(V(bV(p ( l((( j(V( v(( x( l((( j(܏(( V($ (4 l(X+(rЏ((( j(܏((V( ( l((((( j( ܏((V(, (< l(F((bЏ(r(( j(܏((V( ( l(( (((*Џ(0 j(:V(D v(N(d x(l l((( j(܏((V( ( l( )(((, j(6(:T(BV(P (X l((( j(V( v((T( x( l(rT(+(Џ((( j(܏((V( ( l( (( j(*܏(2(:V(L (X l(b((p j(zV( v(( x( l((( j(܏((V( ( l(0+(:((JЏ(` j(j܏(r(zV( ( l(( ( j( V( v((4 x(< l(p j(z܏((V( ( l((( j(܏((*V(4 (@ l(NV(X (d l(N((VЏ(ZV(f(r܏(z܏((( j(܏(&(*T(.V(@ (P l(bT(+(+( j(, (:܏(@ l(h ( j(܏( (܏( l( j(( v(D x(L l(h j( (܏( l( j(܏( (܏( l( j(܏($ (2܏(8 l(L j(\ v(x x( l(0)(B((p j(z(~T(V( ( l((( j(V( v((T(0 x(8 l(l'(~(( j(V( v((T( x( l(V(T(((+(Џ(((:(( j(܏((V( ( l( j(܏((V( ( l( j(&܏(.(6V(H (T l(^((t j(~܏((V( ( l((( j(V( v((V( x( l(6((@ j(J܏(R(^V(p ( l((( j(܏((V( ( l(((T($ j(.܏(6(>V(` (p l((0(2((H j(RV(\ v(f(jT(x( l(&(J(( j(V( v((T( x( l(( j(V( v((T( x( l( j(&܏(.(2T(6V(H (X l( j(šV(¤ v(®(²T(( l(40(>((Ò((.Џ(T (Ě((Ĩ j(IJV(ļ v((T( x( l((( j(V( v(&(*T(D(` x(h l((( j(V( v((T( x( l(2((J܏(RV(Ƃ((Ɛ j(Ơ v(ƪ(ƮT(Ƽ( l((( j($ v(.(2T(@(H l(Z((x j(dž(ǰ ( l( j((T(V( ( l(\ j(f܏(n(vT(zV(Ȍ (Ȝ l(ɮ((T(V((܏( j( v(0(8 l(Z(( j(܏((T(V( ( l( j(D (N܏(T l(h (r܏(x l(̔ ( j(V( ( l(8 j(FV(T (\ l(͘ j(ͦV(ʹ (ͼ l(T(V((܏(( j(8 v(P(X l(8 j(Ϡ (Ϭ l( ( l( (T(V("(&܏(X j(h v(Ѐ(Ј l(\ j( ( l( ( l( (&T(*V(6(:܏(x j(҈ v(Ҡ(Ҩ l(t j( ( l( ( l($ (Ԭ)((( j(V( v((T(0 x(8 l((( j((T(V( ( l(֬)((((($ j(.(2T(:V(H (P l(x j(ׂV(׌ v(ז(ךT(װ x(׸ l(6((D j(NV(X v(b(fT(x x(؀ l(ل)((((( j((T(&V(4 (< l(l j(vV(ڀ v(ڊ(ڎT(ڤ x(ڬ l(.((< j(FV(P v(Z(^T(p x(x l()(l)(ݪ((ݸ j(V( v((T( x( l(^((ހ j(ފ(ގT(ޖV(ޤ (ެ l(L)(ߊ((ߘ j(ߢV(߬ v(߶(ߺT( x( l(>((` j(j(nT(vV( ( l(VV(dƙ(ƙ(ƙ(ƙ(ƙ(D)(ƙ(ƙ(<ƙ(ƙ(ƙ(ƙ(ƙ(ƙ(lƙ(ƙ()((( j(V( v((T( x( l(rV((( j((T(V( ( l(`(!("x((0((( j(V( v(&(*T(8(@ l("n("x("x(((&((8 j(BV(L v(V(ZT(l x(t l(P((( j(܏((T("V(8 (H l(ԙ(ԙ(ԙ("}((( j(V( v((T(, x(4 l(J(P((( j(܏((T(V( ($ l((( j(܏((T(ڙ(ڙ(ڙ(.V(@ (P l(V( ( l(֙(֙( ֙(<ؙ(Pؙ(hؙ(| j(܏((T(V( ( l((((( j(܏((T(P(V( (( l(P((( j(*(.T(6V(D (L l(ؙ((( j(܏((T(ڙ(ڙ(ڙ(FV(X (f܏(l l(V( (܏( l("V(4 (B܏(H l(ؙ(((ؙ((( j(܏((T(P(V( ( l(B((ԙ(ԙ(ԙ((( j(܏((T(V(( (8 l(P(((< j(F(JT(RV(` (h l(`ؙ(pؙ(ؙ(ؙ(ؙ(ؙ((( j(܏((T(V(, (< l((( j(܏((T(P(V( ( l(ԙ(ԙ(ԙ(P(J((($ j(.܏(6(:T(>V(P (` l(ԙ(ԙ(ԙ(P(J(((>(x(((((((,ܙ(h j(r܏(z(~T(V( ( l( j(V( v(( T($(@ x(H l( j((T(V( ( l( j((T(V) ) l)4 j)>)BT)JV)X )` l)p j)z܏))T)V) ) l)().()2V)6T):)|ڙ)ڙ)ڙ)() j)܏)&)*T).V)@ )P l)^~)l) j)܏) )܏) l) j)܏)ڙ)ڙ)0ڙ) )܏) l)()V)T))~)ڙ)Hڙ)tڙ)4)H j)R܏)lڙ)ڙ)ڙ) )܏) l)"()&V)*T).)2~)xڙ)ڙ)ڙ) ) j) ܏) ڙ) ڙ) ڙ) < ) F܏) P l) r() vV) ~T) ) ~) ڙ) ڙ) ڙ) ) j) ܏) ڙ) ڙ) 0ڙ) ) ܏) l) () V) T) ) ~) ڙ) 8ڙ) \ڙ) )4 j)>܏)Xڙ)lڙ)ڙ) )܏) l)()V)T)")&~)hڙ)|ڙ)ڙ)d)x j)܏)ڙ)ڙ)ڙ) )&܏)0 l)P)() j))T)"V)0 )8 l)ڙ)ڙ)ڙ)<ڙ)|ڙ)() j)܏))T)P)V) ) l)()P)() j))T)V) ) l)N~)d)ڙ)ڙ)ڙ)Dڙ)ڙ)() j)܏))T)P)V) ) l) ()P)() j))T)V) ) l)n~))ڙ)$ڙ)Lڙ)|ڙ)ڙ)() j)܏))T)P)V) )$ l)2()P)P)() j))T)V) ) l)^()l j)v܏)~)T)P)V) ) l)()fP)() j))T)V) ) l)()( j)2܏):)>T)BP)FV)` )p l)()6V)Hƙ)ƙ)ƙ)ƙ)ƙ) P) pڙ) ڙ) ڙ) ڙ) ڙ) ڙ)!xƙ)!ƙ)"P)#FP)#r()# j)#)#T)#V)# )# l)#()$ j)$܏)$)$T)$P)$"V)$< )$L l)$n()$b)%"n)%P"x)%R)%()& j)&܏)&)&&T)&*V)&@ )&P l)&ԙ)&ԙ)&ԙ)&)&()'"})'()', j)'6V)'@ v)'J)'NT)'` x)'h l)'V)')'()' j)' v)')(T)( x)( l)(`)(r()( j)( v)()(T)( x)( l))4 j))>܏))F))NT))RV))h ))t l))"}))()) j))V)) v))))T)) x)) l)*))*()+ j)+܏)+")+.T)+@ڙ)+Tڙ)+hڙ)+V)+ )+܏)+ l),V), ),.܏),4 l),lؙ),ؙ),ؙ),֙),֙),֙)-()-l j)-v܏)-~)-T)-V)- )- l).Z().h j).r܏).z).~T).V). ). l).V)/`%)/r()/ j)/V)/ v)/)/T)/ x)/ l)0$%)0N()0\ j)0fV)0p v)0z)0~T)0 x)0 l)1()1 j)1&܏)1.)12T)16V)1L )1\ l)2))2()2D j)2N)2RT)2ZV)2h )2p l)2ؙ)2()2 j)2܏)2)2T)2ڙ)3ڙ)3$ڙ)3ZV)3l )3z܏)3 l)3V)3 )4܏)4 l)46V)4H )4V܏)4\ l)4ؙ)4()4ؙ)58ԙ)5Dԙ)5Pԙ)5Z()5| j)5܏)5)5T)5V)5 )5 l)6h))6z()6 j)6)6T)6V)6 )6 l)7 ')7()70 j)7:V)7D v)7N)7RT)7d x)7l l)7V)8.()8Hؙ)8Xؙ)8hؙ)8xؙ)8ؙ)8ؙ)8 j)8܏)8)8T)8V)9 )9$ l)9 j)9܏)9)9T)9V)9 )9 l):ԙ):ԙ):ԙ):):(): j):V); v); );T); x);( l);|);(); j);܏););T);V); ); l)<()<, j)<6V)<@ v))=x)=)=)=()>,ܙ)>h j)>r܏)>z)>~T)>V)> )> l)> j)>V)> v)?)? T)?$)?@ x)?H l)? j)?)?T)?V)? )? l)? j)?)?T)?V)@ )@ l)@4 j)@>)@BT)@JV)@X )@` l)@p j)@z܏)@)@T)@V)@ )@ l)A()B.()B2V)B6T)B:)B>܏)Bxڙ)Bڙ)Bڙ)C()D j)D܏)D)DT)D"V)D4 )DD l)DR~)D`)D| j)D )D l)D j)Dڙ)Eڙ)Eڙ)Ex )E l)E()EV)ET)E)E܏)Eڙ)F$ڙ)FPڙ)F~)G )G j)GDڙ)GXڙ)Glڙ)G )G l)G()G~)GV)HT)H)H ܏)HHڙ)Htڙ)Hڙ)IT)Ih j)Iڙ)Iڙ)Iڙ)J )J l)JBV)JF~)JJ()JNT)JR)JV܏)Jڙ)Jڙ)Jڙ)K)K j)Kڙ)Kڙ)Lڙ)L\ )Ll l)L()LV)LT)L)L܏)Lڙ)Lڙ)Mڙ)M~)M)M j)Nڙ)N(ڙ)N<ڙ)N )N l)N()NV)NT)N)N܏)Oڙ)ODڙ)Ohڙ)P"~)P0)PD j)Phڙ)P|ڙ)Pڙ)P )P l)Q()Q"V)Q&T)Q*)Q.܏)Q2~)Qdڙ)Qxڙ)Qڙ)R`)Rt j)Rڙ)Rڙ)Rڙ)S )S, l)S))S()T j)T)TT)T"V)T0 )T8 l)Tpڙ)Tڙ)Tڙ)U$ڙ)Udڙ)U))V~)V()VJ()Vl j)Vv)VzT)VV)V )V l)Vڙ)Vڙ)W$ڙ)WLڙ)W|ڙ)X<))Xb~)Xx)X()X j)X)XT)XV)X )X l)Y$ڙ)YLڙ)Yxڙ)Yڙ)Yڙ)[))[))[()[ j)[)[T)\V)\ )\ l)\))\()], j)]6)]:T)]BV)]P )]X l)^^V)^lƙ)_,ƙ)_<ƙ)_Lƙ)_ƙ)`))`ڙ)`ڙ)aڙ)aڙ)a0ڙ)aDڙ)aƙ)b8ƙ)c))c()d j)d)dT)d"V)d0 )d8 l)drV)e)eR)e)e!)e"x)f"x)fP"n)f"x)f)f()f j)fV)f v)f)fT)g x)g l)gl j)gv܏)g~)gT)gV)g )g܏)g l)h0 j)h:܏)hB)hFT)hJV)h\ )hl l)h j)h܏)i)iT)i V)i )i, l)mNd)nf)qjd)th)wd)PF)d)ƙ)d)d)d) >)$ƙ)P!L)lƙ)ƙ)ƙ))d)F)pF)d)d)ƙ)ƙ)P!L)lƙ)ƙ)ƙ) ƙ)ƙ)\y?)v)x)z)|)):))љ)))() j) v)( x)0 l))1)() j)) v)) x) l)*)0Й)))))()N:)R)`љ)v))() j)) v)) x) l)J)`)() j)) v)) x) l) )),)F:)J)Xљ)f)n))() j) v)) x) l)<)`T)j()|) j)܏)))) ) l) )N)X)xB)T)() j)܏))) ) l)*:).)<љ)J)R)l)v() j) v)) l)‚)p)äF)F)LF)hF)ƴF)F)(F)F)F)|N)ʸЙ)))L)dN))$N)T)̘N)b) M)l)))Ӝ)$)4)t)ڐF) ?)ۼ ę)) ) Ι) ) ʙ)()H j)R)V)` )h l)| j)܆)܌ ę)ܚ)ܰ )ܸ l) j))) ) l) Ι)( )0 ʙ):()N)p ę)݂)ݘ ę)) Й)()0 j):)D v)N)\ x)d l) ș))0J)ߐ)ߠJ)߮()߼ j)) v)) x) l):) ƙ)),)HJ)^^)V)) J).()< j)F)P v)Z)h x)p l)^) )B)؏))^)6)L )X!)!)) )!) V)XJ))v)" )" )8 ))() j))܏)) )( l)X)f()n)) ))`)() j) v)) x) l) j)0 v)>)L x)T l))؏))() j)&)0 v):)H x)P l)|)).^)(V))؏))B)))()P j)^)b)x ) l) j))) ) l)) )<)L!8))>)R)l)|!8)))F)^)2)Z) ))F)` ) ) )( ) ) )) ) ) )))J)")N**j**8 *P *p * * ******:*@*nv*r*ƙ* * *b*f***Z*j***"*&*B** * Z* r* * * * &* ** * * * f* j* *!8******T*^********V^****ș*"*,*^*hn*z****V*j** r***@*N*d*r***ʙ*****Ι** 0p* @* T*"*"*"*$$*%*%*%*&*'2*'>*'*)P**L*+*+B*+F*-.*-V*.&*.*/*/*/*0*0*0,*0@*0T*0h*0|*0*0*1*1*7*7*7*7*8*>V*>*?*B*Cz*E*G*L6*U*X?*X*h*s*u?*v*w*w*w*x**b*N* *v *R *?* *v *R *?****R******* d* f* d*$ d*< f*T d*******D n***p f* d* f* f* d* f*H*l***** n*R* f* f+PR+h f+ f+J+r+t f+ d+f+++ f+ f+ + +2"+: +^+ +V+2 +z"+.$+v + * +  +*~"++6"+,"+2"+4$+5D+6P+6$+7$+80+8+9p+:+;0+<.$+<+>l+>+?R$+?+A`+A+C+D+DL+DdJ+D+D+D+DJ+Il+Jd+Jx+J+K@+L<+LP+L+L+M+M+N +O+O(+OP+Pd+P+Q+Q+R<+RX+Rx+R+R&+S+S4+S+U H?+U,+Vtș+VΙ+Vʙ+V+V>+Vș+WΙ+WΙ+W(ʙ+Wj0+Wtʙ+W0+Wʙ+W0+Xʙ+X20+X8ʙ+Xb0+Xpʙ+X0+Xʙ+Y, H?+Y6+Y+Z +[D W+[d ٙ+[ W+[ ٙ+[ W+[ ٙ+\ W+\ ٙ+\H +\ +\˙+]p+]|+]+]+] +]˙+^>6+^D ٙ+^T ٙ+^d ٙ+^t ٙ+^? D?(Z?0?xj?H?}?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {? {? {? {? {? ({? 0{? 8{? @{? H{? P{? X{? `{? h{? p{? x{? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {?!{?!{?!{?!{?! {?!({?!0{?!8{?!@{?!H{?!P{?!X{?!`{?!h{?!p{?!x{?!{?!{?!{?!{?!{?!{?!{?!{?!{?!{?!{?!{?!{?!{?!{?!{?"{?"{?"{?"{?" {?"({?"0{?"8{?"@{?"H{?"P{?"X{?"`{?"h{?"p{?"x{?"{?"{?"{?"{?"{?"{?"{?"{?"{?"{?"{?"{?"{?"{?"{?"{?#{?#{?#{?#{?# {?#({?#0{?#8{?#@{?#H{?#P{?#X{?#`{?#h{?#p{?#x{?#{?#{?#{?#{?#{?#{?#{?#{?#{?#{?#{?#{?#{?#{?#{?#{?${?${?${?${?$ {?$({?$0{?$8{?$@{?$H{?$P{?$X{?$`{?$h{?$p{?$x{?${?${?${?${?${?${?${?${?${?${?${?${?${?${?${?${?%{?%{?%{?%{?% {?%({?%0{?%8{?%@{?%H{?%P{?%X{?%`{?%h{?%p{?%x{?%{?%{?%{?%{?%{?%{?%{?%{?%{?%{?%{?%{?%{?%{?%{?%{?&{?&{?&{?&{?& {?&({?&0{?&8{?&@{?&H{?&P{?&X{?&`{?&h{?&p{?&x{?&{?&{?&{?&{?&{?&{?&{?&{?&{?&{?&{?&{?&{?&{?&{?&{?'{?'{?'{?'{?' {?'({?'0{?'8{?'@{?'H{?'P{?'X{?'`{?'h{?'p{?'x{?'{?'{?'{?'{?'{?'{?'{?'{?'{?'{?'{?'{?'{?'{?'{?'{?({?({?({?({?( {?(({?(0{?(8{?(@{?(H{?(P{?(X{?(`{?(h{?(p{?(x{?({?({?({?({?({?({?({?({?({?({?({?({?({?({?({?({?){?){?){?){?) {?)({?)0{?)8{?)@{?)H{?)P{?)X{?)`{?)h{?)p{?)x{?){?){?){?){?){?){?){?){?){?){?){?){?){?){?){?){?*{?*{?*{?*{?* {?*({?*0{?*8{?*@{?*H{?*P{?*X{?*`{?*h{?*p{?*x{?*{?*{?*{?*{?*{?*{?*{?*{?*{?*{?*{?*{?*{?*{?*{?*{?+{?+{?+{?+{?+ {?+({?+0{?+8{?+@{?+H{?+P{?+X{?+`{?+h{?+p{?+x{?+{?+{?+{?+{?+{?+{?+{?+{?+{?+{?+{?+{?+{?+{?+{?+{?,{?,{?,{?,{?, {?,({?,0{?,8{?,@{?,H{?,P{?,X{?,`{?,h{?,p{?,x{?,{?,{?,{?,{?,{?,{?,{?,{?,{?,{?,{?,{?,{?,{?,{?,{?-{?-{?-{?-{?- {?-({?-0{?-8{?-@{?-H{?-P{?-X{?-`{?-h{?-p{?-x{?-{?-{?-{?-{?-{?-{?-{?-{?-{?-{?-{?-{?-{?-{?-{?-{?.{?.{?.{?.{?. {?.({?.0{?.8{?.@{?.H{?.P{?.X{?.`{?.h{?.p{?.x{?.{?.{?.{?.{?.{?.{?.{?.{?.{?.{?.{?.{?.{?.{?.{?.{?/{?/{?/{?/{?/ {?/({?/0{?/8{?/@{?/H{?/P{?/X{?/`{?/h{?/p{?/x{?/{?/{?/{?/{?/{?/{?/{?/{?/{?/{?/{?/{?/{?/{?/{?/{?0{?0{?0{?0{?0 {?0({?00{?08{?0@{?0H{?0P{?0X{?0`{?0h{?0p{?0x{?0{?0{?0{?0{?0{?0{?0{?0{?0{?0{?0{?0{?0{?0{?0{?0{?1{?1{?1{?1{?1 {?1({?10{?18{?1@{?1H{?1P{?1X{?1`{?1h{?1p{?1x{?1{?1{?1{?1{?1{?1{?1{?1{?1{?1{?1{?1{?1{?1{?1{?1{?2{?2{?2{?2{?2 {?2({?20{?28{?2@{?2H{?2P{?2X{?2`{?2h{?2p{?2x{?2{?2{?2{?2{?2{?2{?2{?2{?2{?2{?2{?2{?2{?2{?2{?2{?3{?3{?3{?3{?3 {?3({?30{?38{?3@{?3H{?3P{?3X{?3`{?3h{?3p{?3x{?3{?3{?3{?3{?3{?3{?3{?3{?3{?3{?3{?3{?3{?3{?3{?3{?4{?4{?4{?4{?4 {?4({?40{?48{?4@{?4H{?4P{?4X{?4`{?4h{?4p{?4x{?4{?4{?4{?4{?4{?4{?4{?4{?4{?4{?4{?4{?4{?4{?4{?4{?5{?5{?5{?5{?5 {?5({?50{?58{?5@{?5H{?5P{?5X{?5`{?5h{?5p{?5x{?5{?5{?5{?5{?5{?5{?5{?5{?5{?5{?5{?5{?5{?5{?5{?5{?6{?6{?6{?6{?6 {?6({?60{?68{?6@{?6H{?6P{?6X{?6`{?6h{?6p{?6x{?6{?6{?6{?6{?6{?6{?6{?6{?6{?6{?6{?6{?6{?6{?6{?6{?7{?7{?7{?7{?7 {?7({?70{?78{?7@{?7H{?7P{?7X{?7`{?7h{?7p{?7x{?7{?7{?7{?7{?7{?7{?7{?7{?7{?7{?7{?7{?7{?7{?7{?7{?8{?8{?8{?8{?8 {?8({?80{?88{?8@{?8H{?8P{?8X{?8`{?8h{?8p{?8x{?8{?8{?8{?8{?8{?8{?8{?8{?8{?8{?8{?8{?8{?8{?8{?8{?9{?9{?9{?9{?9 {?9({?90{?98{?9@{?9H{?9P{?9X{?9`{?9h{?9p{?9x{?9{?9{?9{?9{?9{?9{?9{?9{?9{?9{?9{?9{?9{?9{?9{?9{?:{?:{?:{?:{?: {?:({?:0{?:8{?:@{?:H{?:P{?:X{?:`{?:h{?:p{?:x{?:{?:{?:{?:{?:{?:{?:{?:{?:{?:{?:{?:{?:{?:{?:{?:{?;{?;{?;{?;{?; {?;({?;0{?;8{?;@{?;H{?;P{?;X{?;`{?;h{?;p{?;x{?;{?;{?;{?;{?;{?;{?;{?;{?;{?;{?;{?;{?;{?;{?;{?;{?<{?<{?<{?<{?< {?<({?<0{?<8{?<@{?{?>{?>{?>{?> {?>({?>0{?>8{?>@{?>H{?>P{?>X{?>`{?>h{?>p{?>x{?>{?>{?>{?>{?>{?>{?>{?>{?>{?>{?>{?>{?>{?>{?>{?>{??{??{??{??{?? {??({??0{??8{??@{??H{??P{??X{??`{??h{??p{??x{??{??{??{??{??{??{??{??{??{??{??{??{??{??{??{??{?@{?@{?@{?@{?@ {?@({?@0{?@8{?@@{?@H{?@P{?@X{?@`{?@h{?@p{?@x{?@{?@{?@{?@{?@{?@{?@{?@{?@{?@{?@{?@{?@{?@{?@{?@{?A{?A{?A{?A{?A {?A({?A0{?A8{?A@{?AH{?AP{?AX{?A`{?Ah{?Ap{?Ax{?A{?A{?A{?A{?A{?A{?A{?A{?A{?A{?A{?A{?A{?A{?A{?A{?B{?B{?B{?B{?B {?B({?B0{?B8{?B@{?BH{?BP{?BX{?B`{?Bh{?Bp{?Bx{?B{?B{?B{?B{?B{?B{?B{?B{?B{?B{?B{?B{?B{?B{?B{?B{?C{?C{?C{?C{?C {?C({?C0{?C8{?C@{?CH{?CP{?CX{?C`{?Ch{?Cp{?Cx{?C{?C{?C{?C{?C{?C{?C{?C{?C{?C{?C{?C{?C{?C{?C{?C{?D{?D{?D{?D{?D {?D({?D0{?D8{?D@{?DH{?DP{?DX{?D`{?Dh{?Dp{?Dx{?D{?D{?D{?D{?D{?D{?D{?D{?D{?D{?D{?D{?D{?D{?D{?D{?E{?E{?E{?E{?E {?E({?E0{?E8{?E@{?EH{?EP{?EX{?E`{?Eh{?Ep{?Ex{?E{?E{?E{?E{?E{?E{?E{?E{?E{?E{?E{?E{?E{?E{?E{?E{?F{?F{?F{?F{?F {?F({?F0{?F8{?F@{?FH{?FP{?FX{?F`{?Fh{?Fp{?Fx{?F{?F{?F{?F{?F{?F{?F{?F{?F{?F{?F{?F{?F{?F{?F{?F{?G{?G{?G{?G{?G {?G({?G0{?G8{?G@{?GH{?GP{?GX{?G`{?Gh{?Gp{?Gx{?G{?G{?G{?G{?G{?G{?G{?G{?G{?G{?G{?G{?G{?G{?G{?G{?H{?H{?H{?H{?H {?H({?H0{?H8{?H@{?HH{?HP{?HX{?H`{?Hh{?Hp{?Hx{?H{?H{?H{?H{?H{?H{?H{?H{?H{?H{?H{?H{?H{?H{?H{?H{?I{?I{?I{?I{?I {?I({?I0{?I8{?I@{?IH{?IP{?IX{?I`{?Ih{?Ip{?Ix{?I{?I{?I{?I{?I{?I{?I{?I{?I{?I{?I{?I{?I{?I{?I{?I{?J{?J{?J{?J{?J {?J({?J0{?J8{?J@{?JH{?JP{?JX{?J`{?Jh{?Jp{?Jx{?J{?J{?J{?J{?J{?J{?J{?J{?J{?J{?J{?J{?J{?J{?J{?J{?K{?K{?K{?K{?K {?K({?K0{?K8{?K@{?KH{?KP{?KX{?K`{?Kh{?Kp{?Kx{?K{?K{?K{?K{?K{?K{?K{?K{?K{?K{?K{?K{?K{?K{?K{?K{?L{?L{?L{?L{?L {?L({?L0{?L8{?L@{?LH{?LP{?LX{?L`{?Lh{?Lp{?Lx{?L{?L{?L{?L{?L{?L{?L{?L{?L{?L{?L{?L{?L{?L{?L{?L{?M{?M{?M{?M{?M {?M({?M0{?M8{?M@{?MH{?MP{?MX{?M`{?Mh{?Mp{?Mx{?M{?M{?M{?M{?M{?M{?M{?M{?M{?M{?M{?M{?M{?M{?M{?M{?N{?N{?N{?N{?N {?N({?N0{?N8{?N@{?NH{?NP{?NX{?N`{?Nh{?Np{?Nx{?N{?N{?N{?N{?N{?N{?N{?N{?N{?N{?N{?N{?N{?N{?N{?N{?O{?O{?O{?O{?O {?O({?O0{?O8{?O@{?OH{?OP{?OX{?O`{?Oh{?Op{?Ox{?O{?O{?O{?O{?O{?O{?O{?O{?O{?O{?O{?O{?O{?O{?O{?O{?P{?P{?P{?P{?P {?P({?P0{?P8{?P@{?PH{?PP{?PX{?P`{?Ph{?Pp{?Px{?P{?P{?P{?P{?P{?P{?P{?P{?P{?P{?P{?P{?P{?P{?P{?P{?Q{?Q{?Q{?Q{?Q {?Q({?Q0{?Q8{?Q@{?QH{?QP{?QX{?Q`{?Qh{?Qp{?Qx{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?R{?R{?R{?R{?R {?R({?R0{?R8{?R@{?RH{?RP{?RX{?R`{?Rh{?Rp{?Rx{?R{?R{?R{?R{?R{?R{?R{?R{?R{?R{?R{?R{?R{?R{?R{?R{?S{?S{?S{?S{?S {?S({?S0{?S8{?S@{?SH{?SP{?SX{?S`{?Sh{?Sp{?Sx{?S{?S{?S{?S{?S{?S{?S{?S{?S{?S{?S{?S{?S{?S{?S{?S{?T{?T{?T{?T{?T {?T({?T0{?T8{?T@{?TH{?TP{?TX{?T`{?Th{?Tp{?Tx{?T{?T{?T{?T{?T{?T{?T{?T{?T{?T{?T{?T{?T{?T{?T{?T{?U{?U{?U{?U{?U {?U({?U0{?U8{?U@{?UH{?UP{?UX{?U`{?Uh{?Up{?Ux{?U{?U{?U{?U{?U{?U{?U{?U{?U{?U{?U{?U{?U{?U{?U{?U{?V{?V{?V{?V{?V {?V({?V0{?V8{?V@{?VH{?VP{?VX{?V`{?Vh{?Vp{?Vx{?V{?V{?V{?V{?V{?V{?V{?V{?V{?V{?V{?V{?V{?V{?V{?V{?W{?W{?W{?W{?W {?W({?W0{?W8{?W@{?WH{?WP{?WX{?W`{?Wh{?Wp{?Wx{?W{?W{?W{?W{?W{?W{?W{?W{?W{?W{?W{?W{?W{?W{?W{?W{?X{?X{?X{?X{?X {?X({?X0{?X8{?X@{?XH{?XP{?XX{?X`{?Xh{?Xp{?Xx{?X{?X{?X{?X{?X{?X{?X{?X{?X{?X{?X{?X{?X{?X{?X{?X{?Y{?Y{?Y{?Y{?Y {?Y({?Y0{?Y8{?Y@{?YH{?YP{?YX{?Y`{?Yh{?Yp{?Yx{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Z{?Z{?Z{?Z{?Z {?Z({?Z0{?Z8{?Z@{?ZH{?ZP{?ZX{?Z`{?Zh{?Zp{?Zx{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?[{?[{?[{?[{?[ {?[({?[0{?[8{?[@{?[H{?[P{?[X{?[`{?[h{?[p{?[x{?[{?[{?[{?[{?[{?[{?[{?[{?[{?[{?[{?[{?[{?[{?[{?[{?\{?\{?\{?\{?\ {?\({?\0{?\8{?\@{?\H{?\P{?\X{?\`{?\h{?\p{?\x{?\{?\{?\{?\{?\{?\{?\{?\{?\{?\{?\{?\{?\{?\{?\{?\{?]{?]{?]{?]{?] {?]({?]0{?]8{?]@{?]H{?]P{?]X{?]`{?]h{?]p{?]x{?]{?]{?]{?]{?]{?]{?]{?]{?]{?]{?]{?]{?]{?]{?]{?]{?^{?^{?^{?^{?^ {?^({?^0{?^8{?^@{?^H{?^P{?^X{?^`{?^h{?^p{?^x{?^{?^{?^{?^{?^{?^{?^{?^{?^{?^{?^{?^{?^{?^{?^{?^{?_{?_{?_{?_{?_ {?_({?_0{?_8{?_@{?_H{?_P{?_X{?_`{?_h{?_p{?_x{?_{?_{?_{?_{?_{?_{?_{?_{?_{?_{?_{?_{?_{?_{?_{?_{?`{?`{?`{?`{?` {?`({?`0{?`8{?`@{?`H{?`P{?`X{?``{?`h{?`p{?`x{?`{?`{?`{?`{?`{?`{?`{?`{?`{?`{?`{?`{?`{?`{?`{?`{?a{?a{?a{?a{?a {?a({?a0{?a8{?a@{?aH{?aP{?aX{?a`{?ah{?ap{?ax{?a{?a{?a{?a{?a{?a{?a{?a{?a{?a{?a{?a{?a{?a{?a{?a{?b{?b{?b{?b{?b {?b({?b0{?b8{?b@{?bH{?bP{?bX{?b`{?bh{?bp{?bx{?b{?b{?b{?b{?b{?b{?b{?b{?b{?b{?b{?b{?b{?b{?b{?b{?c{?c{?c{?c{?c {?c({?c0{?c8{?c@{?cH{?cP{?cX{?c`{?ch{?cp{?cx{?c{?c{?c{?c{?c{?c{?c{?c{?c{?c{?c{?c{?c{?c{?c{?c{?d{?d{?d{?d{?d {?d({?d0{?d8{?d@{?dH{?dP{?dX{?d`{?dh{?dp{?dx{?d{?d{?d{?d{?d{?d{?d{?d{?d{?d{?d{?d{?d{?d{?d{?d{?e{?e{?e{?e{?e {?e({?e0{?e8{?e@{?eH{?eP{?eX{?e`{?eh{?ep{?ex{?e{?e{?e{?e{?e{?e{?e{?e{?e{?e{?e{?e{?e{?e{?e{?e{?f{?f{?f{?f{?f {?f({?f0{?f8{?f@{?fH{?fP{?fX{?f`{?fh{?fp{?fx{?f{?f{?f{?f{?f{?f{?f{?f{?f{?f{?f{?f{?f{?f{?f{?f{?g{?g{?g{?g{?g {?g({?g0{?g8{?g@{?gH{?gP{?gX{?g`{?gh{?gp{?gx{?g{?g{?g{?g{?g{?g{?g{?g{?g{?g{?g{?g{?g{?g{?g{?g{?h{?h{?h{?h{?h {?h({?h0{?h8{?h@{?hH{?hP{?hX{?h`{?hh{?hp{?hx{?h{?h{?h{?h{?h{?h{?h{?h{?h{?h{?h{?h{?h{?h{?h{?h{?i{?i{?i{?i{?i {?i({?i0{?i8{?i@{?iH{?iP{?iX{?i`{?ih{?ip{?ix{?i{?i{?i{?i{?i{?i{?i{?i{?i{?i{?i{?i{?i{?i{?i{?i{?j{?j{?j{?j{?j {?j({?j0{?j8{?j@{?jH{?jP{?jX{?j`{?jh{?jp{?jx{?j{?j{?j{?j{?j{?j{?j{?j{?j{?j{?j{?j{?j{?j{?j{?j{?k{?k{?k{?k{?k {?k({?k0{?k8{?k@{?kH{?kP{?kX{?k`{?kh{?kp{?kx{?k{?k{?k{?k{?k{?k{?k{?k{?k{?k{?k{?k{?k{?k{?k{?k{?l{?l{?l{?l{?l {?l({?l0{?l8{?l@{?lH{?lP{?lX{?l`{?lh{?lp{?lx{?l{?l{?l{?l{?l{?l{?l{?l{?l{?l{?l{?l{?l{?l{?l{?l{?m{?m{?m{?m{?m {?m({?m0{?m8{?m@{?mH{?mP{?mX{?m`{?mh{?mp{?mx{?m{?m{?m{?m{?m{?m{?m{?m{?m{?m{?m{?m{?m{?m{?m{?m{?n{?n{?n{?n{?n {?n({?n0{?n8{?n@{?nH{?nP{?nX{?n`{?nh{?np{?nx{?n{?n{?n{?n{?n{?n{?n{?n{?n{?n{?n{?n{?n{?n{?n{?n{?o{?o{?o{?o{?o {?o({?o0{?o8{?o@{?oH{?oP{?oX{?o`{?oh{?op{?ox{?o{?o{?o{?o{?o{?o{?o{?o{?o{?o{?o{?o{?o{?o{?o{?o{?p{?p{?p{?p{?p {?p({?p0{?p8{?p@{?pH{?pP{?pX{?p`{?ph{?pp{?px{?p{?p{?p{?p{?p{?p{?p{?p{?p{?p{?p{?p{?p{?p{?p{?p{?q{?q{?q{?q{?q {?q({?q0{?q8{?q@{?qH{?qP{?qX{?q`{?qh{?qp{?qx{?q{?q{?q{?q{?q{?q{?q{?q{?q{?q{?q{?q{?q{?q{?q{?q{?r{?r{?r{?r{?r {?r({?r0{?r8{?r@{?rH{?rP{?rX{?r`{?rh{?rp{?rx{?r{?r{?r{?r{?r{?r{?r{?r{?r{?r{?r{?r{?r{?r{?r{?r{?s{?s{?s{?s{?s {?s({?s0{?s8{?s@{?sH{?sP{?sX{?s`{?sh{?sp{?sx{?s{?s{?s{?s{?s{?s{?s{?s{?s{?s{?s{?s{?s{?s{?s{?s{?t{?t{?t{?t{?t {?t({?t0{?t8{?t@{?tH{?tP{?tX{?t`{?th{?tp{?tx{?t{?t{?t{?t{?t{?t{?t{?t{?t{?t{?t{?t{?t{?t{?t{?t{?u{?u{?u{?u{?u {?u({?u0{?u8{?u@{?uH{?uP{?uX{?u`{?uh{?up{?ux{?u{?u{?u{?u{?u{?u{?u{?u{?u{?u{?u{?u{?u{?u{?u{?u{?v{?v{?v{?v{?v {?v({?v0{?v8{?v@{?vH{?vP{?vX{?v`{?vh{?vp{?vx{?v{?v{?v{?v{?v{?v{?v{?v{?v{?v{?v{?v{?v{?v{?v{?v{?w{?w{?w{?w{?w {?w({?w0{?w8{?w@{?wH{?wP{?wX{?w`{?wh{?wp{?wx{?w{?w{?w{?w{?w{?w{?w{?w{?w{?w{?w{?w{?w{?w{?w{?w{?x{?x{?x{?x{?x {?x({?x0{?x8{?x@{?xH{?xP{?xX{?x`{?xh{?xp{?xx{?x{?x{?x{?x{?x{?x{?x{?x{?x{?x{?x{?x{?x{?x{?x{?x{?y{?y{?y{?y{?y {?y({?y0{?y8{?y@{?yH{?yP{?yX{?y`{?yh{?yp{?yx{?y{?y{?y{?y{?y{?y{?y{?y{?y{?y{?y{?y{?y{?y{?y{?y{?z{?z{?z{?z{?z {?z({?z0{?z8{?z@{?zH{?zP{?zX{?z`{?zh{?zp{?zx{?z{?z{?z{?z{?z{?z{?z{?z{?z{?z{?z{?z{?z{?z{?z{?z{?{{?{{?{{?{{?{ {?{({?{0{?{8{?{@{?{H{?{P{?{X{?{`{?{h{?{p{?{x{?{{?{{?{{?{{?{{?{{?{{?{{?{{?{{?{{?{{?{{?{{?{{?{{?|{?|{?|{?|{?| {?|({?|0{?|8{?|@{?|H{?|P{?|X{?|`{?|h{?|p{?|x{?|{?|{?|{?|{?|{?|{?|{?|{?|{?|{?|{?|{?|{?|{?|{?|{?}{?}{?}{?}{?} {?}({?}0{?}8{?}@{?}H{?}P{?}X{?}`{?}h{?}p{?}x{?}{?}{?}{?}{?}{?}{?}{?}{?}{?}{?}{?}{?}{?}{?}{?}{?~{?~{?~{?~{?~ {?~({?~0{?~8{?~@{?~H{?~P{?~X{?~`{?~h{?~p{?~x{?~{?~{?~{?~{?~{?~{?~{?~{?~{?~{?~{?~{?~{?~{?~{?~{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?€{?ˆ{?{?˜{? {?¨{?°{?¸{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?À{?È{?Ð{?Ø{?à{?è{?ð{?ø{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?Ā{?Ĉ{?Đ{?Ę{?Ġ{?Ĩ{?İ{?ĸ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?ŀ{?ň{?Ő{?Ř{?Š{?Ũ{?Ű{?Ÿ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?ƀ{?ƈ{?Ɛ{?Ƙ{?Ơ{?ƨ{?ư{?Ƹ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?ǀ{?Lj{?ǐ{?ǘ{?Ǡ{?Ǩ{?ǰ{?Ǹ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?Ȁ{?Ȉ{?Ȑ{?Ș{?Ƞ{?Ȩ{?Ȱ{?ȸ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?ɀ{?Ɉ{?ɐ{?ɘ{?ɠ{?ɨ{?ɰ{?ɸ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?ʀ{?ʈ{?ʐ{?ʘ{?ʠ{?ʨ{?ʰ{?ʸ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?ˀ{?ˈ{?ː{?˘{?ˠ{?˨{?˰{?˸{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?̀{?̈{?̐{?̘{?̠{?̨{?̰{?̸{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?̀{?͈{?͐{?͘{?͠{?ͨ{?Ͱ{?͸{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?΀{?Έ{?ΐ{?Θ{?Π{?Ψ{?ΰ{?θ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?π{?ψ{?ϐ{?Ϙ{?Ϡ{?Ϩ{?ϰ{?ϸ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?Ѐ{?Ј{?А{?И{?Р{?Ш{?а{?и{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?р{?ш{?ѐ{?ј{?Ѡ{?Ѩ{?Ѱ{?Ѹ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?Ҁ{?҈{?Ґ{?Ҙ{?Ҡ{?Ҩ{?Ұ{?Ҹ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?Ӏ{?ӈ{?Ӑ{?Ә{?Ӡ{?Ө{?Ӱ{?Ӹ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?Ԁ{?Ԉ{?Ԑ{?Ԙ{?Ԡ{?Ԩ{?԰{?Ը{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?Հ{?Ո{?Ր{?՘{?ՠ{?ը{?հ{?ո{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?ր{?ֈ{?֐{?֘{?֠{?֨{?ְ{?ָ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?׀{?׈{?א{?ט{?נ{?ר{?װ{?׸{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?؀{?؈{?ؐ{?ؘ{?ؠ{?ب{?ذ{?ظ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?ـ{?و{?ِ{?٘{?٠{?٨{?ٰ{?ٸ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?ڀ{?ڈ{?ڐ{?ژ{?ڠ{?ڨ{?ڰ{?ڸ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?ۀ{?ۈ{?ې{?ۘ{?۠{?ۨ{?۰{?۸{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?܀{?܈{?ܐ{?ܘ{?ܠ{?ܨ{?ܰ{?ܸ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?݀{?݈{?ݐ{?ݘ{?ݠ{?ݨ{?ݰ{?ݸ{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?ހ{?ވ{?ސ{?ޘ{?ޠ{?ި{?ް{?޸{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?߀{?߈{?ߐ{?ߘ{?ߠ{?ߨ{?߰{?߸{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {? {? {? {? {? ({? 0{? 8{? @{? H{? P{? X{? `{? h{? p{? x{? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? ({? 0{? 8{? @{? H{? P{? X{? `{? h{? p{? x{? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? ({? 0{? 8{? @{? H{? P{? X{? `{? h{? p{? x{? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? ({? 0{? 8{? @{? H{? P{? X{? `{? h{? p{? x{? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? ({? 0{? 8{? @{? H{? P{? X{? `{? h{? p{? x{? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {? {?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{? ? ? ?( ?0 ?8 ?@ ?H ?P ?X ?` ?h ?p ?x ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?( ?0 ?8 ?@ ?H ?P ?X ?` ?h ?p ?x ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?( ?0 ?8 ?@ ?H ?P ?X ?` ?h ?p ?x ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?( ?0 ?8 ?@ ?H ?P ?X ?` ?h ?p ?x ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?( ?0 ?8 ?@ ?H ?P ?X ?` ?h ?p ?x ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?  ?  ?  ? ? ( ? 0 ? 8 ? @ ? H ? P ? X ? ` ? h ? p ? x ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?! ?!{?!{?! {?!({?!0{?!8{?!@{?!H{?!P{?!X{?!`{?!h{?!p{?!x{?!{?!{?!{?!{?!{?!{?!{?!{?!{?!{?!{?!{?!{?!{?!{?!{?"{?"{?"{?"{?" {?"({?"0{?"8{?"@{?"H{?"P{?"X{?"`{?"h{?"p{?"x{?"{?"{?"{?"{?"{?"{?"{?"{?"{?"{?"{?"{?"{?"{?"{?"{?#{?#{?#{?#{?# {?#({?#0{?#8{?#@{?#H{?#P{?#X{?#`{?#h{?#p{?#x{?#{?#{?#{?#{?#{?#{?#{?#{?#{?#{?#{?#{?#{?#{?#{?#{?${?${?${?${?$ {?$({?$0{?$8{?$@{?$H{?$P{?$X{?$`{?$h{?$p{?$x{?${?${?${?${?${?${?${?${?${?${?${?${?${?${?${?${?%{?%{?%{?%{?% {?%({?%0{?%8{?%@{?%H{?%P{?%X{?%`{?%h{?%p{?%x{?%{?%{?%{?%{?-{?3{?3 ?4 ?4 ?4 ?4 ?4 ?4 ?4 ?4 ?4 ?4 ?4 ?4 ?5 ?5 ?5 ?5 ?5 ?5( ?50 ?58 ?5@ ?5H ?5P ?5X ?5` ?5h ?5p ?5x{?5{?5{?5{?5{?5{?5{?5{?5{?5{?5{?5{?5{?5{?5{?5{?5{?6{?6{?6{?6{?6 {?6({?60{?68{?6@{?6H{?6P{?6X{?6`{?6h{?6p{?6x{?6{?6{?6{?6{?6{?6{?6{?6{?6{?6{?6{?6{?6{?6{?6{?6{?7{?7{?7{?7{?7 {?7({?70{?78{?7@{?7H{?7P{?7X{?7`{?7h{?7p{?7x{?7{?7{?7{?7{?7{?7{?7{?7{?7{?7{?7{?7{?7{?7{?7{?7{?8{?8{?8{?8{?8 {?8({?80{?88{?8@{?8H{?8P{?8X{?8`{?8h{?8p{?8x{?8{?8{?8{?8{?8{?8{?8{?8{?8{?8{?8{?8{?8{?8{?8{?8{?9{?9{?9{?9{?9 {?9({?90{?98{?9@{?9H{?9P{?9X{?9`{?9h{?9p{?9x{?9{?9{?9{?9{?9{?9{?9{?9{?9{?9{?9{?9{?9{?9{?9{?9{?:{?:{?:{?:{?: {?:({?:0{?:8{?:@{?:H{?:P{?:X{?:`{?:h{?:p{?:x{?:{?:{?:{?:{?:{?:{?:{?:{?:{?:{?:{?:{?:{?:{?:{?:{?;{?;{?;{?;{?; {?;({?;0{?;8{?;@{?;H{?;P{?;X{?;`{?;h{?;p{?;x{?;{?;{?;{?;{?;{?;{?;{?;{?;{?;{?;{?;{?;{?;{?;{?;{?<{?<{?<{?<{?< {?<({?<0{?<8{?<@{?{?>{?>{?>{?> {?>({?>0{?>8{?>@{?>H{?>P{?>X{?>`{?>h{?>p{?>x{?>{?>{?>{?>{?>{?>{?>{?>{?>{?>{?>{?>{?>{?>{?>{?>{??{??{??{??{?? {??({??0{??8{??@{??H{??P{??X{??`{??h{??p{??x{??{??{??{??{??{??{??{??{??{??{??{??{??{??{??{??{?@{?@{?@{?@{?@ {?@({?@0{?@8{?@@{?@H{?@P{?@X{?@`{?@h{?@p{?@x{?@{?@{?@{?@{?@{?@{?@{?@{?@{?@{?@{?@{?@{?@{?@{?@{?A{?A{?A{?A{?A {?A({?A0{?A8{?A@{?AH{?AP{?AX{?A`{?Ah{?Ap{?Ax{?A{?A{?A{?A{?A{?A{?A{?A{?A{?A{?A{?A{?A{?A{?A{?A{?B{?B{?B{?B{?B {?B({?B0{?B8{?B@{?BH{?BP{?BX{?B`{?Bh{?Bp{?Bx{?B{?B{?B{?B{?B{?B{?B{?B{?B{?B{?B{?B{?B{?B{?B{?B{?C{?C{?C{?C{?C {?C({?C0{?C8{?C@{?CH{?CP{?CX{?C`{?Ch{?Cp{?Cx{?C{?C{?C{?C{?C{?C{?C{?C{?C{?C{?C{?C{?C{?C{?C{?C{?D{?D{?D{?D{?D {?D({?D0{?D8{?D@{?DH{?DP{?DX{?D`{?Dh{?Dp{?Dx{?D{?D{?D{?D{?D{?D{?D{?D{?D{?D{?D{?D{?D{?D{?D{?D{?E{?E{?E{?E{?E {?E({?E0{?E8{?E@{?EH{?EP{?EX{?E`{?Eh{?Ep{?Ex{?E{?E{?E{?E{?E{?E{?E{?E{?E{?E{?E{?E{?E{?E{?E{?E{?F{?F{?F{?F{?F {?F({?F0{?F8{?F@{?FH{?FP{?FX{?F`{?Fh{?Fp{?Fx{?F{?F{?F{?F{?F{?F{?F{?F{?F{?F{?F{?F{?F{?F{?F{?F{?G{?G{?G{?G{?G {?G({?G0{?G8{?G@{?GH{?GP{?GX{?G`{?Gh{?Gp{?Gx{?G{?G{?G{?G{?G{?G{?G{?G{?G{?G{?G{?G{?G{?G{?G{?G{?H{?H{?H{?H{?H {?H({?H0{?H8{?H@{?HH{?HP{?HX{?H`{?Hh{?Hp{?Hx{?H{?H{?H{?H{?H{?H{?H{?H{?H{?H{?H{?H{?H{?H{?H{?H{?I{?I{?I{?I{?I {?I({?I0{?I8{?I@{?IH{?IP{?IX{?I`{?Ih{?Ip{?Ix{?I{?I{?I{?I{?I{?I{?I{?I{?I{?I{?I{?I{?I{?I{?I{?I{?J{?J{?J{?J{?J {?J({?J0{?J8{?J@{?JH{?JP{?JX{?J`{?Jh{?Jp{?Jx{?J{?J{?J{?J{?J{?J{?J{?J{?J{?J{?J{?J{?J{?J{?J{?J{?K{?K{?K{?K{?K {?K({?K0{?K8{?K@{?KH{?KP{?KX{?K`{?Kh{?Kp{?Kx{?K{?K{?K{?K{?K{?K{?K{?K{?K{?K{?K{?K{?K{?K{?K{?K{?L{?L{?L{?L{?L {?L({?L0{?L8{?L@{?LH{?LP{?LX{?L`{?Lh{?Lp{?Lx{?L{?L{?L{?L{?L{?L{?L{?L{?L{?L{?L{?L{?L{?L{?L{?L{?M{?M{?M{?M{?M {?M({?M0{?M8{?M@{?MH{?MP{?MX{?M`{?Mh{?Mp{?Mx{?M{?M{?M{?M{?M{?M{?M{?M{?M{?M{?M{?M{?M{?M{?M{?M{?N{?N{?N{?N{?N {?N({?N0{?N8{?N@{?NH{?NP{?NX{?N`{?Nh{?Np{?Nx{?N{?N{?N{?N{?N{?N{?N{?N{?N{?N{?N{?N{?N{?N{?N{?N{?O{?O{?O{?O{?O {?O({?O0{?O8{?O@{?OH{?OP{?OX{?O`{?Oh{?Op{?Ox{?O{?O{?O{?O{?O{?O{?O{?O{?O{?O{?O{?O{?O{?O{?O{?O{?P{?P{?P{?P{?P {?P({?P0{?P8{?P@{?PH{?PP{?PX{?P`{?Ph{?Pp{?Px{?P{?P{?P{?P{?P{?P{?P{?P{?P{?P{?P{?P{?P{?P{?P{?P{?Q{?Q{?Q{?Q{?Q {?Q({?Q0{?Q8{?Q@{?QH{?QP{?QX{?Q`{?Qh{?Qp{?Qx{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?Q{?R{?R{?R{?R{?R {?R({?R0{?R8{?R@{?RH{?RP{?RX{?R`{?Rh{?Rp{?Rx{?R{?R{?R{?R{?R{?R{?R{?R{?R{?R{?R{?R{?R{?R{?R{?R{?S{?S{?S{?S{?S {?S({?S0{?S8{?S@{?SH{?SP{?SX{?S`{?Sh{?Sp{?Sx{?S{?S{?S{?S{?S{?S{?S{?S{?S{?S{?S{?S{?S{?S{?S{?S{?T{?T{?T{?T{?T {?T({?T0{?T8{?T@{?TH{?TP{?TX{?T`{?Th{?Tp{?Tx{?T{?T{?T{?T{?T{?T{?T{?T{?T{?T{?T{?T{?T{?T{?T{?T{?U{?U{?U{?U{?U {?U({?U0{?U8{?U@{?UH{?UP{?UX{?U`{?Uh{?Up{?Ux{?U{?U{?U{?U{?U{?U{?U{?U{?U{?U{?U{?U{?U{?U{?U{?U{?V{?V{?V{?V{?V {?V({?V0{?V8{?V@{?VH{?VP{?VX{?V`{?Vh{?Vp{?Vx{?V{?V{?V{?V{?V{?V{?V{?V{?V{?V{?V{?V{?V{?V{?V{?V{?W{?W{?W{?W{?W {?W({?W0{?W8{?W@{?WH{?WP{?WX{?W`{?Wh{?Wp{?Wx{?W{?W{?W{?W{?W{?W{?W{?W{?W{?W{?W{?W{?W{?W{?W{?W{?X{?X{?X{?X{?X {?X({?X0{?X8{?X@{?XH{?XP{?XX{?X`{?Xh{?Xp{?Xx{?X{?X{?X{?X{?X{?X{?X{?X{?X{?X{?X{?X{?X{?X{?X{?X{?Y{?Y{?Y{?Y{?Y {?Y({?Y0{?Y8{?Y@{?YH{?YP{?YX{?Y`{?Yh{?Yp{?Yx{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Y{?Z{?Z{?Z{?Z{?Z {?Z({?Z0{?Z8{?Z@{?ZH{?ZP{?ZX{?Z`{?Zh{?Zp{?Zx{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?Z{?[{?[{?[{?[{?[ {?[({?[0{?[8{?[@{?[H{?[P{?[X{?[`{?[h{?[p{?[x{?[{?[{?[{?[{?[{?[{?[{?[{?[{?[{?[{?[{?[{?[{?[{?[{?\{?\{?\{?\{?\ {?\({?\0{?\8{?\@{?\H{?\P{?\X{?\`{?\h{?\p{?\x{?\{?\{?\{?\{?\{?\{?\{?\{?\{?\{?\{?\{?\{?\{?\{?\{?]{?]{?]{?]{?] {?]({?]0{?]8{?]@{?]H{?]P{?]X{?]`{?]h{?]p{?]x{?]{?]{?]{?]{?]{?]{?]{?]{?]{?]{?]{?]{?]{?]{?]{?]{?^{?^{?^{?^{?^ {?^({?^0{?^8{?^@{?^H{?^P{?^X{?^`{?^h{?^p{?^x{?^{?^{?^{?^{?^{?^{?^{?^{?^{?^{?^{?^{?^{?^{?^{?^{?_{?_{?_{?_{?_ {?_({?_0{?_8{?_@{?_H{?_P{?_X{?_`{?_h{?_p{?_x{?_{?_{?_{?_{?_{?_{?_{?_{?_{?_{?_{?_{?_{?_{?_{?_{?`{?`{?`{?`{?` {?`({?`0{?`8{?`@{?`H{?`P{?`X{?``{?`h{?`p{?`x{?`{?`{?`{?`{?`{?`{?`{?`{?`{?`{?`{?`{?`{?`{?`{?`{?a{?a{?a{?a{?a {?a({?a0{?a8{?a@{?aH{?aP{?aX{?a`{?ah{?ap{?ax{?a{?a{?a{?a{?a{?a{?a{?a{?a{?a{?a{?a{?a{?a{?a{?a{?b{?b{?b{?b{?b {?b({?b0{?b8{?b@{?bH{?bP{?bX{?b`{?bh{?bp{?bx{?b{?b{?b{?b{?b{?b{?b{?b{?b{?b{?b{?b{?b{?b{?b{?b{?c{?c{?c{?c{?c {?c({?c0{?c8{?c@{?cH{?cP{?cX{?c`{?ch{?cp{?cx{?c{?c{?c{?c{?c{?c{?c{?c{?c{?c{?c{?c{?c{?c{?c{?c{?d{?d{?d{?d{?d {?d({?d0{?d8{?d@{?dH{?dP{?dX{?d`{?dh{?dp{?dx{?d{?d{?d{?d{?d{?d{?d{?d{?d{?d{?d{?d{?d{?d{?d{?d{?e{?e{?e{?e{?e {?e({?e0{?e8{?e@{?eH{?eP{?eX{?e`{?eh{?ep{?ex{?e{?e{?e{?e{?e{?e{?e{?e{?e{?e{?e{?e{?e{?e{?e{?e{?f{?f{?f{?f{?f {?f({?f0{?f8{?f@{?fH{?fP{?fX{?f`{?fh{?fp{?fx{?f{?f{?f{?f{?f{?f{?f{?f{?f{?f{?f{?f{?f{?f{?f{?f{?g{?g{?g{?g{?g {?g({?g0{?g8{?g@{?gH{?gP{?gX{?g`{?gh{?gp{?gx{?g{?g{?g{?g{?g{?g{?g{?g{?g{?g{?g{?g{?g{?g{?g{?g{?h{?h{?h{?h{?h {?h({?h0{?h8{?h@{?hH{?hP{?hX{?h`{?hh{?hp{?hx{?h{?h{?h{?h{?h{?h{?h{?h{?h{?h{?h{?h{?h{?h{?h{?h{?i{?i{?i{?i{?i {?i({?i0{?i8{?i@{?iH{?iP{?iX{?i`{?ih{?ip{?ix{?i{?i{?i{?i{?i{?i{?i{?i{?i{?i{?i{?i{?i{?i{?i{?i{?j{?j{?j{?j{?j {?j({?j0{?j8{?j@{?jH{?jP{?jX{?j`{?jh{?jp{?jx{?j{?j{?j{?j{?j{?j{?j{?j{?j{?j{?j{?j{?j{?j{?j{?j{?k{?k{?k{?k{?k {?k({?k0{?k8{?k@{?kH{?kP{?kX{?k`{?kh{?kp{?kx{?k{?k{?k{?k{?k{?k{?k{?k{?k{?k{?k{?k{?k{?k{?k{?k{?l{?l{?l{?l{?l {?l({?l0{?l8{?l@{?lH{?lP{?lX{?l`{?lh{?lp{?lx{?l{?l{?l{?l{?l{?l{?l{?l{?l{?l{?l{?l{?l{?l{?l{?l{?m{?m{?m{?m{?m {?m({?m0{?m8{?m@{?mH{?mP{?mX{?m`{?mh{?mp{?mx{?m{?m{?m{?m{?m{?m{?m{?m{?m{?m{?m{?m{?m{?m{?m{?m{?n{?n{?n{?n{?n {?n({?n0{?n8{?n@{?nH{?nP{?nX{?n`{?nh{?np{?nx{?n{?n{?n{?n{?n{?n{?n{?n{?n{?n{?n{?n{?n{?n{?n{?n{?o{?o{?o{?o{?o {?o({?o0{?o8{?o@{?oH{?oP{?oX{?o`{?oh{?op{?ox{?o{?o{?o{?o{?o{?o{?o{?o{?o{?o{?o{?o{?o{?o{?o{?o{?p{?p{?p{?p{?p {?p({?p0{?p8{?p@{?pH{?pP{?pX{?p`{?ph{?pp{?px{?p{?p{?p{?p{?p{?p{?p{?p{?p{?p{?p{?p{?p{?p{?p{?p{?q{?q{?q{?q{?q {?q({?q0{?q8{?q@{?qH{?qP{?qX{?q`{?qh{?qp{?qx{?q{?q{?q{?q{?q{?q{?q{?q{?q{?q{?q{?q{?q{?q{?q{?q{?r{?r{?r{?r{?r {?r({?r0{?r8{?r@{?rH{?rP{?rX{?r`{?rh{?rp{?rx{?r{?r{?r{?r{?r{?r{?r{?r{?r{?r{?r{?r{?r{?r{?r{?r{?s{?s{?s{?s{?s {?s({?s0{?s8{?s@{?sH{?sP{?sX{?s`{?sh{?sp{?sx{?s{?s{?s{?s{?s{?s{?s{?s{?s{?s{?s{?s{?s{?s{?s{?s{?t{?t{?t{?t{?t {?t({?t0{?t8{?t@{?tH{?tP{?tX{?t`{?th{?tp{?tx{?t{?t{?t{?t{?t{?t{?t{?t{?t{?t{?t{?t{?t{?t{?t{?t{?u{?u{?u{?u{?u {?u({?u0{?u8{?u@{?uH{?uP{?uX{?u`{?uh{?up{?ux{?u{?u{?u{?u{?u{?u{?u{?u{?u{?u{?u{?u{?u{?u{?u{?u{?v{?v{?v{?v{?v {?v({?v0{?v8{?v@{?vH{?vP{?vX{?v`{?vh{?vp{?vx{?v{?v{?v{?v{?v{?v{?v{?v{?v{?v{?v{?v{?v{?v{?v{?v{?w{?w{?w{?w{?w {?w({?w0{?w8{?w@{?wH{?wP{?wX{?w`{?wh{?wp{?wx{?w{?w{?w{?w{?w{?w{?w{?w{?w{?w{?w{?w{?w{?w{?w{?w{?x{?x{?x{?x{?x {?x({?x0{?x8{?x@{?xH{?xP{?xX{?x`{?xh{?xp{?xx{?x{?x{?x{?x{?x{?x{?x{?x{?x{?x{?x{?x{?x{?x{?x{?x{?y{?y{?y{?y{?y {?y({?y0{?y8{?y@{?yH{?yP{?yX{?y`{?yh{?yp{?yx{?y{?y{?y{?y{?y{?y{?y{?y{?y{?y{?y{?y{?y{?y{?y{?y{?z{?z{?z{?z{?z {?z({?z0{?z8{?z@{?zH{?zP{?zX{?z`{?zh{?zp{?zx{?z{?z{?z{?z{?z{?z{?z{?z{?z{?z{?z{?z{?z{?z{?z{?z{?{{?{{?{{?{{?{ {?{({?{0{?{8{?{@{?{H{?{P{?{X{?{`{?{h{?{p{?{x{?{{?{{?{{?{{?{{?{{?{{?{{?{{?{{?{{?{{?{{?{{?{{?{{?|{?|{?|{?|{?| {?|({?|0{?|8{?|@{?|H{?|P{?|X{?|`{?|h{?|p{?|x{?|{?|{?|{?|{?|{?|{?|{?|{?|{?|{?|{?|{?|{?|{?|{?|{?}{?}{?}{?}{?} {?}({?}0{?}8{?}@{?}H{?}P{?}X{?}`{?}h{?}p{?}x{?}{?}{?}{?}{?}{?}{?}{?}{?}{?}{?}{?}{?}{?}{?}{?}{?~{?~{?~{?~{?~ {?~({?~0{?~8{?~@{?~H{?~P{?~X{?~`{?~h{?~p{?~x{?~{?~{?~{?~{?~{?~{?~{?~{?~{?~{?~{?~{?~{?~{?~{?~{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?X{?`{?h{?p{?x{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{?{? {?({?0{?8{?@{?H{?P{?{?{?{?{?{?{?{?({?8{?H{?X{?h{?x{?{?{?{?{?{?{?{?{?{?{?({?8{?H{?X{?h{?x{?{?{?{?{?{?{?{?{?{?{?({?8{?H{?X{?h{?x{?{?{?{?{?{?{?{?{?{?{?({?8{?H{?X{?h{?x{?{?{?{?{?{?{?{?{?{?{?({?8{?H{?X{?h{?x{?{?{?{?{?{?{?{?{?{?}? ? ?( ?H?P?????????? ?(?0?8?߀ }?߈ }?ߐ }?ߘ }?ߠ }?ߨ }?߰ }?߸ }? }? }? }? }? }? }? }? }? }? }? }? }? }?( }?0 }?8 }?@ }?H }?P }?X }? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2?( 2?0 2?8 2?@ 2?H 2?P 2?X 2?` 2?h 2?p 2?x 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2?( 2?0 2?8 2?@ 2?H 2?P 2?X 2?` 2?h 2?p 2?x 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2? 2?h?p? ,?` ,??? )?? ?~??(?? ?(D?0?8?@?H?P,?X*?`?h?pp?x"? ??2?6???t?????4????? ??$? ? \?(v?0?8?H~?P|?Xx?`V?hO?pM?xQ? ? ? ??U?S???????v??[?_?G??%?? #?(!?0E?8)?@-?H+?P?X?`?hg?pe?x???i?????????}?{???????w? {?(}?0I?8K?@M?HS?PQ?XO?`?h?p?x?U?a?m?o?q???? ??k????Y??]???? ,?(W?0?8?@?H?P?X?`?h?p'?x/?1?3?5?7?9?;?=???A?C??? 2? ? ?.? ? ? ? ?H B?P D?X ?`?hb?p`?xd??????v??? ? ? ??? ? ? ? ? r? t? p? F?( 4?0 6?8?@ 8?H F?P :?X?`?    % + 1 ; @ F K Z f v                   1=JUamz              $ , 3 ; B N V ] b m s {                         ' . 3 : D P ] d k r z                       % / 9 @ H O U ] o v ~                          $ , 5 = F O W d j q w ~                    * 6 ? H U g {      & 0 : EOk0k8Sk@EkH:kP]kX]k`Ukh]kpfkxk~kgkkkkk{kkk kkkkkkkkkkk sk(k0k8k@kHkPkXk` khkpkx k]k(kdk1k7k]kkBkMkkSkkkk kkk\k]kik ok(yk0k8k@kHkPkXk`kh;kpkx3kkOkkkkkkkkk.kkk k kkNk k k !k Vk( +k0 0k8 :k@okHkP EkX=k`khkpkxk,k Mk Uk ^k ekrk/kkkkkk ok |kk kBkbkk k k(,k01k8k@~kHvkPkXk`Fkh kp kxk%kkkk{kkk@kkkkk;kkvkk kkkk k($k0k8k@ kH kP kX k` kh kpHkxkk kHkkk kk]k\kkk k k3kkk k !k ,k 5k Ak( Jk0 Vk8Wk@ dkH mkP vkX k` kh kpkx k'k kk k]k k k kk k k k k\kk]kk k kk ]k(k0k8 k@ &kHkPkX]k`]khkp]kxkk$kk 6kkk @k]k Kk\k]kk Uk]k\k fk rk ~k k k \k(k0]k8k@ kH kPkXk`khkp]kxkkkkk]kkk k kk]k k kkk kkkkmk jk(qk0k8\k@]kHFkPkXk`khkp]kxkkkUk]k k]kk\k kkk%kkOkk@kkzk *kk <k(k0 @k8]k@ PkHkPkX]k` \kh bkp skx\kk]k k k k k]k]k]kk\k k k k k k k k k ,k @k( Nk0 ck8 xk@ kH kP kX]k`khkpkxkkkkkkk?kkdkk6kkkkkkkkDk:k 5k(0k0&k8]k@kH kP kX k` kh kp kxk kk]kkk~kk]kk+k7kCkRkikk]kkk]kk ]k(k0k8k@kH*kPkX k`wkhkpkxkk]kk0kDk]krk]kkkkkkkkk kk)k6k Dk(Qk0`k8ok@kHkP\kXk`khkpkxk]k]kkkkk kk'k8kTk]kkpk|kkkkkk \k(k0k8 k@kH#kP/kX:k`KkhZkpfkxPkEkPkjk}kkkkkkk0kCkOkZkjk{kk]kk\k k(k0k8k@kHkPkXk` khkp'kx3k@kSkgk|kkkkkkkk7kJk\k]kk]kkjk]k k(]k0xk8k@kHkPkXk`kh]kpkx\k]kkkk]k]kkk]kkkk9k+k]kkk]k\kk k(k0k8kk@kHkP,kXMk`k~k@!;gNU g_k_<qX`  Skhh p(x,dg@k`)@9 RI kR]keqh: _q g@k)@A mhU phn =*sh kvh kyhP]kqk qk qf qo H g4 Vk g0) gk9 gl) g$m) g%) gA)(19 gBbHR\fpz$.8BLV`jt~ (2< F P Z d,mb,s,},000444888<<<@ @@D'D1D;HEHOHYLcLmLwPPPTTTXXX\\\``` dd!d+h5h?hIlSl]lgpqp{ppgsapversion.c+Yk9n+Y 6c kq]kU -gbrtools.c kV9n5 ! ; kcM =*lX k=+e ks k  k_  ku k} k k k k@ k k k k  k` k+ k< k-N k3@\ k;m kCy kI kO kh kx  k} k` k k k` k k  k  k@  k , k = k I k U k @ e k4@ u kE@  kL  ks  k  k  k  k٠  k  k  k !  k! k.!, k?!; kK`!J kW !X kb`!j kn`!{ kz ! k! k ! k! k! k! k! k"  k`" k". k`"@ k"Q k-"c k;"w kI" kW`" ke@" ks`" k" k" k" k " k#  k## k0 #( kB@#7 kO#F kX#U kc #e km#u kz# k`# k# k # k# k# kӀ# k# k# k$  k`$ k@$+ k($: k2 $I k<$X kF$g kP`$v k[$ +_kf]k\k@(0@h%B (hM! 1-P -\ +   $ -p M %i83x - ^3 !(!75x 83X o` ` 3 -X ! ` --0pM --d :-| U-)` <-h E-(3 3 X K` @-` 03 3 h 5 --3  v3P eX 3 ` !   x dd , mp A3 -  %S,o3p 3 -H -8-@ 3` |mx 7 gbrcopy.c$$k9n$  2$  2 $ k 2$  2 $  2%  21%  2R`%$  2g%3  2~ %C  2 %S  2%a  2`%o  2%|  2۠%  2%  2`%  2)%  27 %  2=@%  2C%  2O %  2\@%  2f@&   2&  2/`&#  28&0  2L&?  2_&L  2m&Y  2v&e  2~`&t  2&  2`&  2& k 2&  24kAh]k 0nݘ\k r( Uk gbrxxsub.c&&_k G9 tn_&  r'  v '  `'   ',   '9  `'J  'X  'g   'v  :'  M'  Z'  s'  v'  '   '  '  @'  (  @(  `(  (*  @(9  (D  (T   (`  `(p  (|  (  (  (  (  (  (  @(  (  @(  )  )  )  @))  )4  @)C  ŀ)N  ɠ)]  )h  )w  )  `)  Ҡ)   )  `)  )  )  `)  ݠ)   )  `*   *  `*   */   *:  @*J  *V  *f  *r  *  *  `*  *  *  @*   *   *   `*   *   +    @+   +*   @+6   +F   +R   @+b   +n    +z   %+   4+   A@+   O+   ^+   d@+   t+   @+   @+   ,   ,    ,   ,(   Ơ,3   +,@   9,P   W,[   p,f   @,q   ,|   ,    ,   ,   ,   ,   ,   ,  ,  ,  -   @- k !@-% k %@-: k )-N k -`-c k 1-x k 4- k 8- k <@- k @ - k D- k G- k K .  k N.  k R@.5 k U.I k Y.] k ^`.q k b. k e. k i@. k m@. k q@. k u@. k y@. k }@/ k @/& k @/: k /N k /b k /v k / k / k / k / k 3Phksh3]kn@\kq    gbruxsub.c//k?9n0   0  0'  06  f@0D  r 0S =+: t0[ k |0i  @0w  0   0  0   0  ;0  D`0  I0   0  40  =0  F@1  P 1  m 1  t`1&  `12  1@  1N  `1^  1m  @1{  `1   1  1   1  1   1  1  1  1  2   %2  02%  922  I@2@  R@2M  \2Y  e2g  l2s  u`2  2  2   2  2  2  2   2   2   2  Ϡ3  @3   @3  3   3)  31  3<   3J  @3Y  `3h  @3u  %3  /@3  ;3  B3  G`3  L@3  \`3  ``3  b3  e3  h@4  z4  4  4)  48   4G  /@4V  ;`4e  N4t  Z 4  d4  j4  o4  t4  z4  ~4  4   4  5  3kF]kHnh\kTPx  gbrntsub.c55,0]kK(  <grsecssfs.c5A5[k9Tn5q  5 k `5  5  @5  5  `5 k 5 k 6 k 6+ k @6F k 6` k 6 k  `6   6   6   6 k  6 k 7 k 7 k `7+ k `7G k %7y k &@7 k -7 k 2 7 k 7 8 k ;8, k > 8G  @@8Z k B@8 k C`8  J8 k K8  L8  M8  O9  O94  P@9K  Q9f k X@9  f9 k j9  k`9  k9  o:  p`:!  q :@  s:U  t :o  t:  v: k v: k v:  x :  x`:  x;  y;*  z;I k {;X  ;m k `; k @; k 4Uk&]kݨ\keJpk k k ,k Jgrseckey.c;<+Vk9Hn+V<  A6akLp]k vgrsecdes.c<3  {*>  {*>'  {*`>5  {*>H  {+@>d k {+> k {+> k {6a kHlH]km grngxx.c>>)ۀk 9$n)ۀ>  )?   )?  ) ?;  )@?K  6_kl]k)ejlD grngxxi.c>?])k9xn)?q  )?  )`?  )?  )?  )?  )?  )@  )@@  6PPkje]k9 \k( grngxxtim.c@3@M)k9 n)@c  )@z  6QkeX]k! Fgpfclock.c@@)k9 0n)@  )@@  )@  ) @  )@  ) @  )A  )@A  )A4  ) AH  )A`  *Av  *`A  * A k *A  *A  *A k *A k *A  *`A k *A  * B  *`B  *B$  *B6  * BK  *B`  * @Bp  * B  * B  * B  * @B  * B  * `B  * B  *B  *B  6RkBe]k@  xX fXgdptrace.cCC*k9"nC?  K`CT  KCl k KC  KC k K C k K@C k K`C  KC  KC k K`C  KC  KD  K D  KD(  K D0  KD:  K@DK  KDY k KDg  K Dt  KD  K`D k KD  KD  K`D  KD k KD  K`D  KE  KE  K E  KE*  KE6 k K ED  KER  KEf  KE~  KE  K E k KE  K`E k K@E  KE  KE  KF  K@F  KF/  KFE  KFW  KFl  KF}  KƠF  KF  K`F  K F  K`F  KϠF  K F  KF  K@G k KG   K G k K`G- k KؠG: k KGB  K`GN  KGX  KGg  K`Gp  KG~  K G  K`G  KG  K G  KG  KG  K G  KG  K H  K`H  KH' k K`H7 k K HF k KHX k KHc  K Hp  KH  K H  KH  K H  KH  KH  K H  KH  K H  K`I  KI k KI$  K I3  KI?  K IP  KIY  K Id  K@Il k KIz  K`I  K @I  K @I  K`I  KI  K I  KI k KI  KI  KI  K@J   KJ& k KJ= k K4|0k]kݸ\kd0 f r ~  ,y   @ ( <@ gsapxxpr.cJ]Jw$k9)n$J ]$J ]$J ]$@J ]$J k]$J ]$J k]$@J ]$J k]$J ]$ J ]$K k]$K k]5kB`]k| k\k@rp  r  r  )X *gerr.cK$K>$/ke9*n$/KO k$2KZ $3 Kl $3`K~ $7K k$9K k$IK $MK $MK $NK k$[K $\K k$\`K k$\K $^K $`L $aL $j L k$mL$ $o L0 $r@L9 $xLE $z`LP $~L_ $~Li $Lx $L $L $@L $`L k$L $@L $L $L $ L $`L $L $M  $@M $M% $ M7 k$MK k$ Mb k$Mx k$@M k5k:@]k-n j\kHrXKPk V O*BV O6Tkf]k \k xghaxxcrc32.cVV*k95n*V k*@V k*V k6YPk7g]k  gnixx.cVWW> k96 n WP } Wc } Wv } W } W } W } W } @W } W } `W } W } @W } W } X } X } X0 } XJ } @Xa } X{ } @X } X } X } X } X } X } X } @X } `Y } @Y# } Y8 } YM } Ye } Yq } ˀY } Y } Y } Y } @Y } ՠY } Y } Y } @Y } `Y } Z  } @Z } Z } Z) } Z7 } ZB } ZL } Z\ } @Zl } Zy }! Z }!Z }! Z }! Z }!Z }! Z }!@Z }!$ Z }!&Z }!+[  }!-[  }!/[2 }!2[@ }!6[O }!>[^ }!A [q }!B[ }!C[ }!D@[ }!D[ }!E[ }!E`[ }!H`\ }!I\ }!K\ }!L\. }!O\: }!Q\F }!T\U }!X\e }!Z \o }!\@\w }!\\ }!]\ }!]`\ }!a\ }!f\ }!j\ }!m\ }!o\ }!r] }!t] }!v] }!v]. }!w@]? }!y@]J }!|]V }!|`]d }! ]s }!] }!] }!@] }!] }!`] }!`] }!] }!] }! ] }!^ }! ^$ }!^1 }!^A }!^N }!^\ }!͠^m }!^~ }!^ }!@^ }!ؠ^ }! ^ }!߀^ }!^ }!^ }!_ }!_ }!_& }!_3 }"_B }" @_S }"_a }"@_ }"_ }"!_ }"%@_ }")`_ }",_ }"0@` }"3` }"7``+ }":`= }"=`P }"A `c }"D``s }"G`` }"J@` }"M` }"P` }"S` }"\`` }"^` }"d`a }"ia }"na }"ta, }"u@a; }"w@aG }"y`aS }"ya^ k}51k=)p]k@4n gnixxi.cppawWa"{k9@n"{a "`a " a k"@a "b "bP "@b k"@b "`b " b "c "c* "cC " c[ "c k"`c "Àc "d" "@dC "Ƞdb " d k"рd "ؠd "ݠd "e "e< "en "`e #e # e k#e #f+ k#fa #*f #1 f #Cf #Ff #I`g% #SgF #Xge k#Y g #^g #_ g #bg #gg #jg #k`h #o h/ #rhB #v hW k#whx #zh #h #`h #h k#@h #h #h # i #i- k#`iJ #ii #i k#`i k#i #`i #i #`i # j  #j #@j' #j3 #jJ #`jX #Ԡjf # ju #ՠj # j #֠j #j #`j #j k#ڠk k#k #@k, #kT #ka #@ko #k #`k k#k #k #k #`l  #l k$@lD $lV $lf k$l $ @l $l k$ l $l $ m k$@m* $ m: $#m\ k$&mu k$'m k$(@m k$(m k$)m k$* m k$*n  k5opkM0H]k Gn kH\k)h @: \:( b:8 s0@ PD D D D E E ,E @E NE cE( xE0 E8 E@ M+M75ShSxPd`S`dhCk (  5066d7 gnibuf.cppn3WnM&k9HPn&nb & n k&n k&@n k&o k&oI k&@oo &o{ &o k&`o & o & o &o & o &`o &@o &Ѐp &p &ҀpS & p &`p &p k& q &q+ &qX k&q &q k&q k' q 'r 'rD 'rr k' @r k' @r 'r k'r k'`s( k'sc '&@s '+s k'/s k'1s '?t* 'E`tY 'Lt k'Yt ']t ']t '^ u '^`u1 'aug 'cu 'fu 'h v 'iv@ 'j vv 'nv 'n`v 'nw 'w`w k'xwD '} wU k'@w 'w k'w k'@x k'x@ k'`xi k'x k'x k'x k'y- k6 k'S]kHLnvoJk vok vnk vxnk v`nk vHnc O v0  gnixxri.cppyBWy\%~k9Mn%~yr %~y} %y % y %y %y %z %z8 %`z_ k% z k5kL]kd{ gnixxlh.cppzWz)k 9Mn)z )z )z ){ 6N@kd]k1 `\k@W gnixxhs.cppzW{8%kQ9Mn%{N %{a %@{t %{ %{ %{ %@{ %| %| %|1 %|M %`|_ %|q %`| %| %@| %| %`| %} %`}4 %@}I %}w %@} %@} %} %~ %~ %~9 %@~T %~r %`~ %~ %~ %`~ %`~ %@ %Ǡ %. k%Y k5k ]N]kPMCoHr{u r{b MRops|` NHiohs0| s| 55Q8R]R@DH gnixxsl.cppW%؀k"9Pdn%؀ \% \%ܠ \% \%* \%`J \%`w \% \% \% \%@ \%* \% S \58kPp]kAPohtx sK s s+ s s sx s` sH  gnixxhl.cppuW&lk19Q8n&l &l &p  &p &q@ &q< &|`w & & &@ & / &`J &l & & 5kS]kYRropv v ux u= u u um upK uX0 u@ u( % gnixxhl6.cppW&)kB9R,n&)  &* ' &.@F &.l &/  &1 &2` &3` &7+ &;`n &B &E@ &L + &Pp &R &V &W &`" &bP &dl &d` &d &i 5kQ]kQ@opu t# t t t( t t thm tPQ t8 t  G gniuxi.cW%k-9Sn%1 *& ` *&@ *& *& *& k*&  k*&7 *& @h *&# k*&$ *5(kP]k gnixxsel.cppW'k9TTn(9x oL(9 oL(9; oL(9[ oL(9{ oL(9 oL(9 oL' L'J L'W L'e L' L'  L' L' L' L'` L' L' L' L' L' L'  L'à( L'> L'ȠU L'ˠt L'Ӏ L'  L' L'` L' L'! L'`< L'@] L' L' L' L'  L' L(, L(H L(`f L( L( L(%  L(&@ oL(& oL(& L(( L(,`I L(.@w L(0` L(2 L(4 L(6@* L(6X L(9@ oL6(kW]k0wo vo v b0o boXo @o (|o \o <o o o cpo =  o    g xI `- H 0   "    u p? doHY +   h Px 8J 6N4Z] gnixxacl.cppW%@k=9Wn%@  %A  %B   %C<  %D@Q  %G`o  %K   %L  %S@  %U@  %Y  %Y@  %Y.  %^M  %a`e  %d  %g`  %j  %m`  %p  %r  %u  %w  %y"  %|@2 k 5Рk dK]kK Kz gsixx.cppsW%9k9Yn%9 b%:  b%;@ b%; b%<@ b%< b%=  b%? kb5ʐkH]kYna gsiux.cpp3WM$kr9Yn$a $  $ $ $ŀ $ $ $@ $  $# $@, $ 6 $ @ $`K $`V $b $j $܀s $} $ $` $` $ $ $@ $ $ $ $ $ $  $ % , %`< % J % `Y %g %`v %` % % % %  % % %@ % k%  %  k%% %. %7 %@@ %I %Q % a %#q %&  %( %/  %1 %3  5kEH]k]nrb 65Ј 5Ќ 5А 5Д 5И 5М 6P6P 6P6P666P 6P6Q6D6)6P '6o66 6P$36P(@6P,S6P0g6P4|6P86P<6P@6PD6PH6PL6`6 6N6N  6N6N:6N/6N#6N E6P6N8j66N<6s gsixxsel.cppW(:k09]n(: f(;w f(<@ f(>  f(> f(? f(? f(@ f(@ f(A f(A f(B f(B f(C) f(C4 f(D? f(DM f(EW f(E` f(Fi f(F`o f(F f(G  f(G f(H f(H f(I@ f(I f(J`@ f(Kb f(K| f(L  f(L f(M  f(M f(N@ f(N? f(Od f(P f(P f(Q  f(Q f(R@  f(U+ f(V`A f(WX f(Wp f(X f(]` f(a  f(d f(g f(h" f(l`E f(qb f(s} f(v f(w f(` f(@ f(' f(] f({ f(@ f( f( f( f(" f(@L f( b f(z f( f(  of( f(% f(@ f(d f(À f( f(  f(Ԁ f(ր  f(@/ f(܀f f( f(@ f(  f( f( f(`1 f(`\ f(s f(@ f( f( f( f(` f( 5 f)R f)`o f) f)` f)` f)! f)A f)f f)@ f) f)" f)#  f)$ f)%6 f)*@O f). v f)1 f)5  f)6  f):@ f)=  f)A; f)A`X f)S f)U f)X f)Z  f)[* f)[O f)\w f)^ f)c@ f)c f)e f)e f)g`7 kf)h ^ kf)h kf)i kf6<kY]kw  YHYPYX Y`Yh'Yp8YxT]@pow8 ]|owP ^oy  xq x x x x xpe xX@ x@ x( x w w w} wc wA w wh _(oz( z# z zM z zh zP z8| z ^ z y y y y~ yc yx# y`  yH y0 y _o|0 |2 | |x] |` |H |0 | |g {  { { { { {pe {XA {@& {( {{ zc `o~ ~ ~p ~X ~@ ~( ~g }B }" } } }p }S }h6 }P }8 }  } | |t ~7 ~P   0 H ` x< Y      + P  x 8 h  aPoP  666<6N006N$j6N(}6N,gsapstr.c)k9fn) x) x)Š x)ǀ  x) x)ɠ x) ) x)2 x)< x)`E x)N x)`X x)Ϡ_ x)g x)@p x)z x)Ҁ x)@ x) x) x) x)@ x)@ x)@ kxd]kFgsappar0.cڀk9hnڀ  -  9 `E ۠V b  s `| ܠ    @ k4Uk`]kjgcscompr.ck 9hn     % 5 @? M X f v  4hk@]kAgcsinterf.ck89in k` k k  k   `      ,  ?  L k`X * g k*`q * +  k+ + ,@ , - 2  5 7` 8 k9( k:= k4 kd]k'@  r 6 [gcsrlzc.cOik9k`n} F kF F kF kF F  kF  kF]k)gcsrlzh.c>kA9kn> k`>@ k`@. k`B< k`EH k`FQ k`K[ k`Oe k`Q q k`R{ k`[ k`\ k`] k`^` k`` k`e@ k`i k`k k`n  k`q k`r k`u  k`w k`x`" k`y , `|9 k`4 k]k xx &|gcsrulzh.cKek.9mnz k k@ k k  k  kҠ k kր 48k0@]knngcscrc32.ck9n0n * `4 E `U k@i k(]k gcontloct.c Pk49nn P  Q` k R@ k T k T  U  k W" k ^; k ^`H  bf  cs k e k f  g  g@ k g k h k k`  k k l   m`   m  m. k s`D k sY k x@p k | k   `   5-k(]k i\k)P gnlsui1.ckI9pxn %  %@, %ɠ8 %ʀC %`P %a % w %̀ %΀ % %@ %Ϡ k=+XC%@ %Ѐ % ! %@; %F %ӠP %@\ %f %@o %׀y %؀ %  k%܀ k%@ % % %@ % % % %` % %( %2 %@< k=+lv%S % f %`w % % %  %` %@ % % % %  %  %( %6 %`F %S %a %q k%  k% ` k% ` k% @ k% @ k%   k%  k% `/ k% G k% `^ k%4kH]kn A\k(gnlsui5.cyk9tn     ` `    k5 k@K k b k]kFgrscpsc2.cx$k9upn$ k=+$ $  $ $ $` $ $ >]kgrscpsc4.cx)X$k9un$m $` $ $ k>]kK$grscpsc6.c>$k9v8n$ $` $  $ $! $8 B]kQDgrscpsca7.c>Q Kk9vn Kg ) K@o ) Kw ) K ) L ) L` ) L ) M@ ) M ) N` ) O )(X]kTRgrscpscb7.c&k9wPn&% I&`/ IS]kL~grscpsce8.c9$k9wtn$O W$@W W$_ W$g W$o W$@ W$ W$ W$@ W$ W$@ W$ W$  W$ W$ W$ W$ W>P]kTgu16_aux.c9k9xnN ^ ks    `  `     `* @8  L ` t       k k k k@8 k4@kP]kr@_k x  $gu16_str.cUo<k29zn< < = @ C C D` E F G  G G H@ H J  M' Q@4 Q> RJ R@S R^ S h Ut W Z@ Z \ \ _@ b f` f g  g` g h  h i! j, j5 k@ lK m X 4Pk`]kLgu16_mem.cek 9|n )@ ) )@ ) ) ) )  ) ) )@ ) )@  ) )' )]kqgu16_cty.c5O k<9}n d Q q Q  } Q  Q  Q @ Q  Q  Q  Q   Q  Q 3 Q4k@]k>~ngu16_put.c3k9n3$ v46 v5> v5H v5P v6Z v9@n v9u v:~ v;@Ž v;™ v;¨ v4k>]kgu16_get.cµ  gu16_prnt.c k9`n    !` !# "0 "@< "G #@S #` $ l $z ]kgu16_OutCon.cÇok 9noß oõ p@ p s  u 4kQ]kgu16_FldWd.c1Kk9xnb r Ă `Ĕ kĨ kĹ  @   6 k40kH]k gu16_LenMod.cOik9,nŁ ŕ ũ ſ k @ k  ) E @e ƃ Ɵ ƾ @  @]k4gu16_FrmOut.c8%k9 n%P %& e %&z %'@ǝ %* Ǵ k%]kegu16_OutCS.ck9tn 9` 9  9= k9`c 9ȃ k9Ȱ 9@ 9 9 9`6 k9S k9p k9ɀ k9ɝ 9ɼ k9@ 9 94xkX]k ngu16_OutFlg.c+Ezk9nz] jzn j{ j{`ʦ j{ j| j|` j|4 j|U j} w j}`ː j}˳ j} j]kgu16_OutStr.c++k9n+ +@ + +; ,Y k-@} k. ̣ / 0 k1 k3 3@: 4k@]kgu16_OutPrc.cXrk9Dn͊ ͟ ʹ ` k k  k(]kg1pk`)Ί ]kUq΋ Ιά gζk(ζά g μk( μά gHk(Hά gpk(pά gk(ά gk(ά gk(ά g H0k( H0ά g p8k( p8ά g?k(? ά g0Fk(0Fά g*Mk(*M ά gTk(Tά g_k(_ά gHek(He#ά glk(l(ά g)rk()r$-ά g)ςk()ς)2ά g)Ϗk()Ϗ.7ά g`Ϡk(`Ϡ3<ά gϪk(Ϫ8Aά gϲk(ϲ=Fά gtϹk(tϹBKά gk(GPά gk(LUά gxk(xQZά gk(V_ά g)€k()€[dά g%4k(%4`iά g%4k(%4enά g%4k(%4jsά g%6k(%6oxά g%7x k(%7x t}ά g%7Pk(%7Pyά g%7"k(%7"~ά g%7(0k(%7(0ά g&(>k(&(>ά g&(Kk(&(Kά gXXk(XXά g`k(`ά ghk(hά gqk(qά gwk(wά g*k(*ά gЏk(Џά gЗk(Зά gpТk(pТά g Ыk( Ыά gPгk(Pгά gмk(мά g8k(8ά gk(ά g(k((ά gk(ά gdk(dά gk(ά gPk(Pά g k( ά g k( ά gk( ά g%4k(%4  ά g'k('  ά g/k(/  ά g 5k( 5  ά g?k(?  ά gFk(F  "ά gHTk(HT  'ά g%7\k(%7\ # ,ά g*ck(*c ( 1ά g(kk((k - 6ά gvk(v 2 ;ά gxрk(xр 7 @ά g,ъk(,ъ < Eά gpђk(pђ A Jά gpњk(pњ F Oά g Jѣk( Jѣ K Tά gѪk(Ѫ P Yά gѰk(Ѱ U ^ά g<ѹk(<ѹ Z cά gk( _ hά gk( d mά gk( i rά gk( n wά gk( s |ά g0k(0 x ά g%7k(%7 } ά g%7k(%7  ά g)k()  ά gk(  ά gk(  ά g+U$k(+U$  ά g,k(,  ά g p5k( p5  ά g=k(=  ά g8Ek(8E  ά gNk(N  ά gUk(U  ά gh\k(h\  ά gHek(He  ά g Jnk( Jn  ά gtk(t  ά g~k(~  ά g҅k(҅  ά gxҌk(xҌ  ά gҔk(Ҕ  ά g%}қk(%}қ  ά gңk(ң  ά g HҬk( HҬ  ά gҵk(ҵ  ά gҽk(ҽ  ά gXk(X !ά gnk(n !ά gnk(n!! ά g k( ! !ά g k( !!ά g k( !!ά gk(!!!ά g* k(* !!&ά g k( !"!+ά g@k(@!'!0ά g &k( &!,!5ά g J-k( J-!1!:ά g*6k(*6!6!?ά gIk(I!;!Dά g@Qk(@Q!@!Iά gZk(Z!E!Nά gTak(Ta!J!Sά g%5jk(%5j!O!Xά g%6`rk(%6`r!T!]ά g%6}k(%6}!Y!bά gӄk(ӄ!^!gά g ӊk( ӊ!c!lά gӒk(Ӓ!h!qά gӘk(Ә!m!vά gӠk(Ӡ!r!{ά g8Ӧk(8Ӧ!w!ά gӯk(ӯ!|!ά g`ӹk(`ӹ!!ά gk(!!ά ghk(h!!ά g)k()!!ά g$k($!!ά gk(!!ά gk(!!ά gk(!!ά g`k(`!!ά g k( !!ά gxk(x!!ά g k( !!ά g%5k(%5!!ά gPk(P!!ά g"k("!!ά g%8,k(%8,!!ά g 5k( 5!!ά g ?k( ?!!ά gIk(I!!ά gdRk(dR!!ά g%68`k(%68`!!ά g gk( g!!ά g ok( o!!ά g&)Hvk(&)Hv!!ά g%}~k(%}~!"ά g<Ԅk(<Ԅ!"ά g(ԓk((ԓ"" ά g(ԛk((ԛ""ά g%5pԢk(%5pԢ" "ά g%5HԨk(%5HԨ""ά g%5 Աk(%5 Ա"" ά g%6Ժk(%6Ժ""%ά gLk(L"!"*ά gk("&"/ά gk("+"4ά gk("0"9ά gPk(P"5">ά g