NbTx  1Ls-1L.texts f .data- L@.bss((1L.loadern (.except ~.info( ,BH= ,&2 PБ8A(A | S*~CxN!A(b9}{x~xH `@,AbDHA(| @__start, M H4N @__threads_init!|A(d| DN!A(b,#Ac| CN!A(b ,#Atc| CN!A(b(,#Ac| CN!A(b0,#Ac| CN!A(8!p}N b(,#AK A__threads_init@AF2_1p|X!|HMA(8!p}N A, call_pth_inith`A( L| N N @__User_sinit_begin|!HA(8!p}N A$__C_runtime_termination|8b8X8!a`?xpH5A(8bsHIA(!}N 8`HQA(|p88`sHaA(K8`cHyA(8`HA(!}N (ap__C_runtime_startupKdN @__4KTN @__3xA( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N |!|`y8apxA|`8HW]`8(#|(@AH8V8`@8!}N 8apxHlA(8!}N 8`8!}N 8`HlA(8!}N AstatU16;,|8P!18ap, A(H`8a, 8`AH`b8cH`b8cH`, AH8pb88cH`b8cH`88!}N 8pb88chH`b8cHy`88!}N 8tH `b8cH=`b8cH-`, AK88!N A\ SystemHeader`8f;,8-|!q, @~HjA(8-ؐ~,bAH `H`W bWx{e|8cxeHa`8-b`8c4 xƲ|0,$@eHm`,#A8eLH `b8-8cdH `X,$@ 8!}N b8c|H `8!}N 8-b8cdH `X,$AKH m`8b-؀cHm`,#AK88!}N 8!N AIpcShm||c!qH)````axcH8`H9`cxH98!}N A`main;``|8,|aA}&!;8aA!xp!}H`,#A88b,88b,. @D8;b,````!|x$|}*,#@\8b,8 |A8b,*c.|x,@8b,8,(8~H ]`8~$x.xd}0P|*|4|H}A(,8,dd A|d| , *@88,8T>y>$y.`}'0Py d,c }A(8~H `8b,2 ,AX`8<|H8b,:<@ D|A B0"8@HPX`8b,|8| 88|t|8xA88b,c:B,:",:,9,HhL,8b,,@,,A`c@(, ALP```!8|X8x$|: `x>$x.}@*xd}jHP}+:|B|4|2|H|A(,8,dAK88~6`H`8~RH`8rhK8b,D, 8DA\88, |AlHcA(,8,eAPdbcH;]``e8~bdH`8~H}`8b,LP8P,c@88b,T>(LAt8cPH,,Ab_:",:,bG9,````!88|2 `x>$x.xd}I@P} :|4|2|HzA(,8,dAXKM8 8~6`H`8~RH`8b,D, 8D@8~Ha`8b,,P,8PA ,c@888b,HP(, Ac:",:,b@9,`!88|:|: x>$x.xd}I@P} :|4|2|HyA(,8,dAXKM8 8~6`H`8~RH`8b,D, 8D@(8~Ha`8b,(P, 8P`A ,c@48b,,,88b,HPA b@c:",:,9,```!88|:|: x>$x.xd}I@P} :|4|2|HxA(,8,dAXK=8 $8~6`H`8~RHy`8b,D, 8D@ 8~HQ`8b,,P, 8P`A `,c@488b,c:",:,9,HP````!88/ |2|2y'ly(]$}GBy+Ey'&} PP}(:| 4|J|HwA(,8,dAXK58 $8~6`H`8~RHq`8b,D, 8D@ 8~HI`8b,,P, 8P`A ,'@,88b,8H x>$x.}(Pxd|:||2884|Hv}A(8,,dALK]8,8~8 <6`H`8b,D, 8D@ 8~H}`8b,8 x>$x.}(Pxd|:|4|HuA(8,,dALK8,8~8 <6`H`8b,D, 8D@8~H`88b,88H y>$y.}'0Pyd|B|`884|HuA(8,,dALK%8,8~8 X6`Hm`8b,D, 8D@8~HE`8b,88 y>$y.}'0Pyd|B|`884|HtA(8,,dALK8,8~8 X6`H`8b,D, 8D@8~H`88b,88H |2`8d9d4|Ht9A(8,,dAK8,8~8 |6`H9`8~H)`8b,8chK98b,D, 8DA\, A8|8H[A(8,,dAbcbcH3}``e8~bdH`8~H`88b,88H |2`89ȑ4|HsYA(8,,dALK8,8~8 6`H1`8b,D, 8D@d8~H `8b,88 |`8,9,4|HrA(8,,dALK]8,8~8 6`H`8b,D, 8D@h8~H}`8b,h, @8,d <8 |@ 8~HE`8,8~ $FH1`8b,, @8b,p, @8`H=`,#@x8,d2 H c8!|px} !Aa!AaN ca 8ax8 $H1`8ax H`a HY5`8axHei`a 8 A8/, ,/Ac@, AH!`,#(A88,%@8c8|#@8cA4````!|#@8c,/@8@8/cH`(#@ c8!}N 8c8!}N @K A( basenameU16H @linkU|`,#!@,$;@,8cH A(8!}N 8apcB888h9 T9*L9JKc8pHA(8!}N `dB;p8ap88h89 T9*D9JKu,?@KT AlinkU16H@ @symlinkU|`,#!@,$;@,8cHA(8!}N 8apcB888h9 89*L9JKc8pHA(8!}N `dB;p8ap88h89 89*D9JK5,?@KT A symlinkU16H@ @ readlinkU|`B|`y!a8apx@xd;|eP8|}|HuA(||y@<88d8hH58`8!}N cccHmA(,B8Acc88h|ax9 9*(9J0K`~cHMA(|>@8`|@AxAt8!}Kl;p`88h89 9*9JK{d|P8|}|HqA(||yAK4 Ad readlinkU16|!|H1`8!p}N A(nlsui_malloc_errorT>T>H8 @ chownU|T>,#BT>!@08`ccHA(8!}N `d8ap88h89 9*9JK 8apccHA(8!}N AchownU16T>H< @mkfifoU|BT>,#!AL`d8ap88h8W9 9*9JK!8apcHA(8!}N 8`cHA(8!}N A mkfifoU16H @utimeU!,#B|xAH`d8ap88h8h9 9*9JKE8apxH%A(8!}N 8`H A(8!}N A|utimeU16T>H< @creatU|BT>,#!AL`d8ap88h8z9 9*9JKa8apcHiA(8!}N 8`cHEA(8!}N AcreatU16H@ @perrorU|!qaxbcH0a8axH`b88cHA(8aH`8` 8HeA(8!}N A perrorU16||c!HA(,#`dA89" 88h98i<9>(9^|K89" |#@8i9^K}8apc88h8J99^9>KY8p8|#@cAHA(|~y@K;B8a`88h8C9 9*9JK,?@\KH A tempnamU16H@ @mktempU,#@ 8`N HL @ mktempU16H@ @mkstempU,#@ 8`N HK0 @ mkstempU16|cH< @ttynameU|!|cHIA(,#`dAX8b B888c<8h9 d9*p9JK8(#|@A 8b 8cHG @nlsui_wcsar2mbsar8,#8A(%@@``!x$,'Ax$,(@$8c88|&(@A`N 9,)9F8ATT>TѾa+yI|((@Ta*`A$cC#a8c|&(@@Kp`N |*(@TѾATaFa`#8cK`N 8d`!8cx$, ADx$,$@ 8K, @ 8K8K @@ U2sToUtf8s`8;aA|!}&.=!AA88, A(````!8c8, @8|x$H{A(||yAAp;`c:;\; ``!HI`x`dP8xH{MA(z;Zc8,#AK|#@Al;;,=c@{d$8c|!*|8!} !AaN ,;A,;``!w:H A(;|>@A8`|K8b8h8c0KA;,@````!w:HA(;|?@A8`|K,88c|!*8!} |N 8b8h8c0K,=AK< C lnlsui_alloc_mbsar|`!qax`HG`8{| @a`d@(axHy`c8!}N HG]`;ax{HyQ`c8!}N Awcstowcs,#A`8($@48c|`!8cx$x%A(,$@8C `N 8C K8C K8`N @l UcnToFileLenR8,U >9aA9 !A}9`|cx}v|c`8(#@89?``c&X@```!|(0@a @|) @/@L@9asW4cA4,9~0@W6@0@e@9 W W|2y{0,,<@~`@ky|,@HA c8c9),;@t@pa#!AaN ?AVp8c@=k,#9)U|}|Ac8cK9`;@A(a[, 9|g@H@P9K<,#A8t8`!AaKP9`;@AK,<;@T|<0@@E@cW[2,;@h9 W{[5,W2,+@ {d,K9`;@AhK@W8;k,<@x|;0@@@9 W2,;@E@9 W[2,;@%@WZ52{9 9`W;2W9,;{c@\x|<{ @$;@AK9`;@AKb8"9 K$ @ Utf8snToU2n,#A(%``@T8|`!8Tx$x%A`TѾ,)|6pT>@$``8cC |`PN `y``8cC KԘ8cC K8`N @ U2nToUtf8x,$88}%BA,#9@A9|P@`!|' @%H@A8@t9,&x$A,*@8c8Kx%AT8TѾTˣ>yLTaja|' @`ACc8cK8"8`N 8|' @ATѾTaKc`C8cK@A,*@t8c8K$8gN `N 8e8&@````!|%H@Aؠ8c8, @DA8x%x$,@8@8`K8A`K8gN x%x$,@K @ U2snToUtf8n|!|Ht1`8!p}N A(nlsui_set_trace|!|Hx`8!p}N A(nlsui_internalErrorMsg|!|H`8!p}N A(nlsui_array_short|!|H`8!p}N A(nlsui_utf8conv_error|8!HA(,#A88HA(8H)`,@8!}N HeA(|pH Alcast_raw2ucChkFailedp`M T>H9TN @nlsui_cast_raw2uc|H< @dlopenU|,#|!APB`d8ap88h89 9*9JKa8apcH}A(8!}N 8`cHYA(8!}N A dlopenU16H @dlsymU!,$B|axAD8ap88h8=9 9*9JKlj8paxHA(8!}N 8HA(8!}N AxdlsymU16H @dlerrorU|!HiA(,#B; `dAP88 <8Q8h9 d9*p9J|K̙8(#|@A 8 H< @chmodU|BT>,#!AL`d8ap88h8 9 9*9JK8apcHUA(8!}N 8`cH1A(8!}N AchmodU16T>H< @mkdirU|BT>,#!AL`d8ap88h8 9 9*9JK8apcH}A(8!}N 8`cHYA(8!}N AmkdirU16`,|}&aA!`y.;;aA!!A@;~L|z8|x$HPA(,#A`r,@t@; ;::c`!HmiA(`txd8dHPMA(w:8,#AK|#@A;9;|9@@u:K{$$bC|!*8!} Aa!AaN zc${$$88h8 ch|r*| *Ka,@$`!x;HoA(;|=@A8`KyA(|pcc8h8 K,@```!x;HoA(;|=@AK;; ;bW:```!;HkA(`uxd8dHNA(w8,#A\KI|#@A ;:;|8@@K88hw8 chKIwHnA(Kcc8h8 K),@;``!;HnA(;|=@AK8bC|!*Kcc8h8 K8`KxIA(|p8~h8 K8`Kx-A(|p;~4K Cpnlsui_alloc_wcsarBase|c8KX @ nlsui_alloc_wcsar,#@ 8`N H @nlsui_alloc_envbcK @ nlsui_getenvironU,#@ 8`N H @nlsui_freeenvironU, M HtN @ strtoupperU16, M HN @strntoupperU16`;|aP`|!aA(```!~;`{p`,`@`,#{@D8@<;,;@c8!}aN |;,#AKd| DN!A(|K AstrcpytoupperU16, M H N @ strtolowerU16, M H 4N @strntolowerU16`;|a`|!aA(```!~;`{p`,@@`,#[@D8 @<;,;@c8!}aN |;,#AKd| DN!A(|K AstrcpytolowerU16|H< @ecvtU|!|HA(8|dyAl8 8f@@c8!}N |,#AKHIA(|Kc8!N AstrntolowerR@AF139_137|``~c!````!p`,@@X,#[@<8 A0~;,#@c8!}N ~;,#AKHiA(~K AstrtolowerR@AF140_136|`,$!qA`~"`|c``!p`,`@h,#{@P8AD|;,#A;|>@@c8!}N |,#AKHAA(|Kc8!N AstrntoupperR@AF141_134|``~c!````!p`,`@X,#{@<8A0~;,#@c8!}N ~;,#AKHaA(~K AstrtoupperR@AF142_133||+y`a`|!aAȈcHA(T~>HA(;,>T`>Ap;`|>@d(=@\|;``!HعA(T~>;HإA(,>;{T`>A |>@|;@@|;K|P8!|}aN 8`8!N A strncasecmpR@AF143_132|;8c;!qc``!HA(T~>;H׵A(,>T`>A|>@};K|P8!|}N AstrcasecmpR@AF144_131|``~ax!aA(A`|cb```!p`,@@l,#[@T8 AH|;,#A;|>@@c8!}aN |,#AKd| DN!A(|Kc8!N AstrntolowerU16@AF145_127`|`}c!qA(`!p`,@@\,#[@@8 A4};,#@c8!}N };,#AKd| DN!A(}K AstrtolowerU16@AF146_126|``~ax!aA(A`|cbP```!p`,`@l,#{@T8AH|;,#A;|>@@c8!}aN |,#AKd| DN!A(|Kc8!N AstrntoupperU16@AF147_124`|P`}c!qA(`!p`,`@\,#{@@8A4};,#@c8!}N };,#AKd| DN!A(}K AstrtoupperU16@AF148_123``~c|,#!A$``!H[EA(~;,#@cH[)A(8`8!}N Apnlsui_freeenvironU@AF149_1228`e, A48, A$```!88, @|`d`8K @Xnlsui_alloc_env@AF150_120|`||+yaA`!aA(A<cd| DN!A(T~>d| DN!A(,>T`>A;|>@;`(=@|;Bd| ``!DN!A(T~>;d| DN!A(T`>,>;{|L3BA(|;@@ |;d| K|P8!|}AaN 8`8!N AstrncasecmpU16@AF151_105;8c;|c!qdA(| ```!DN!A(T|>;d| DN!A(T`>,<A(|<@ };d| K|P8!|}N AstrcasecmpU16@AF152_103|`888h9!9?9_a8apK8ap8d88pHj`8ap8dH``d08ap88HQAA(Kya8!}N Anlsui_cast_raw2uc@AF153_789||{d|c2;{$!q||;;e|```!K89|#@AP|,@@$};;;|K8`8!}N 8`8!}K Anlsui_wcsar2mbsar@AF154_65|!aaxH``8ap888h9|9=9]xKu8apHMA(;`~ax8pc8h89|9]9=K|#@8|@8`LFA8!}N AmkstempU16@AF155_61|!qaxH``8ap88t8h99>9^xKy8apHyA(;,#ax8pc8h8x9AD9>9^K|#@8|@8`LFAax8!}N 8`8!}N AmktempU16@AF156_59A( L| N A( L| N H@ @strlenU`dp`AD`f8p,AA(``!88p,Ah@8`!8%8|}(:8}09Ay'y(y  A`U',*U(>A<,'A ,(@| P|t|`8cN | P|t|`8cN | P|t|`8cN | P|t|`8cN @ strlenU16x,`f`AT`~AB, ``AX88p`e,AA,``!888p,Ap@xT`@|,(A@} 88B@$``!8, A,8C , A`N |0P|t|`8cK8*J}hJ} Z8}kP9A4y y yk A8U ,+U>A,,A,(A`(%A98}hB@```!Jyl9}}8}_9y~U}A,,,{ Uk>A,?A,=Ap,+A$8hC yh}+J}iJ8ylx$}IH9Ujy A(,(Uh>Al,)AD,*A,(A|pAKp|0P|t|`8cK|0P|t|`8cK||0P|t|`8cK\8*J}hJ} Z8}kP9AK|8`N @ strnlenU16x,`f`AT`~A, AP88p`e,AA(`!888p,A@xAP`(B8y *J}R} b8}H9Aly ,+y y A,+yD y yk A,,U A,+U A,,U .A`,+U>A@,,A$,(A9e`A}i````!8h9y}R}~b8},9Aly~,?{̂ yA@,,{D y~{ A,,UlU~A,?U.A,,Uk>A,>A,?A|,+A`C xx$|p8A8| 8B@ `!8, A(8C , A`N |c0P8cN |c0P8cN |c0P8cN |c0P8cN |c0P8cN |c0P8cN |c0P8cN |c0P8cN 8`N @ strnlenRFBH@ @strcatU`e8, A$```!88, @88`!88, @N @\ strcatU16|``!Kec|# @8Ax|,$A$```!8c8,$@8e888|#@@,`!e8|&@d88,A,A88!8`"}N 8`8!}N 8`"8!}N A strcat_sU16|``!K8|# @cA|*,$A(````!88c,$@88c88|$@@,`!8|&@8c8,A,A88!8`"}N 8`8!}N 8`"8!}N A strcat_sRFB|H< @strchrUx 8``!8|,%M 8c@8`N @4 strchrU16H@ @strcmpU88c88c|#,A0@,``!f88,#|AA|P|N @\ strcmpU16H@ @strcpyU`e|P|tT~88}q@09, A`88p`h,M ````!8A(88p9,@N 88````!8y }H:} R8| X9@88Ky ,)U yI AHU >,)A0,+A,*@N y"8N y"N 8N ````!88, @N @l strcpyU16x,`gA}PA@T~}t}q@9%, A88`hp)#,A4`!88A<88p,9@8`N x@hpAP8,$88,AA,`!8,$88,A@88`"KHh}R|B8}h@9Axx T Ay( T >AX,,``8A (,)A8Aa8|8B@p````!Rx|88}9xA0{ ,=TT>A,<A,?A,>A| 9)8C x$|R|*8|Bx }h898A4x,*y T A,(T >Ah,*A<,+A |bpAK\8`N x"8`gN x"8`N 8`gN `(&`88A`KHh}R|B8}h@9AK @, strcpy_sU16x,`gA}PAT~q@9, A88pH`hC,A@````!88A<88p,9@8`N xAh``b8(y KkZ}8}_9Aly,,{ yA|,,{D y y AH,?UA,,U A,?U.A,,U >A,?AT,,A089Aa%` } ```!8 9Zy}8}_9Aly,>{ yA,?{D y{ A,?UUAd,=U.A8,>U>A,?A,=A,>A8C px$|J|pAP8,$88,AXA,`!8,$88,A0@88`"K 8`N y"8`U>gN y"U>g8`N y"8`gN y"8`N y 8`gN y 8`N 8`gN @ strcpy_sRFBH@ @strcspnU8, A<8```!8|,'A@8, @`N @P strcspnU16H@ @strdupU|!qaxKmx8H!A(,#@8`8!}H(ax8H=`}a8!N Ap strdupU16H@ @strncatU8``,A$```!88c,@(%9#Ap,&A ,&A8x9F,(A,A(*@9}IB@X``!8c,'A,'A,'A,'Ap9C 8c,'ATHx$T|J,*(|"CA0,&A ,&AA8`g`N 8d`|`!8c8,&AC x|K8T(%AKa'(%AAK @ strncatU16|````!qK| P|#@A|< @@8,A$```!8c;,@(<8A},#A},#A8{8,%Aܠ,A(&@(8|B@X``!;,$A,$A,$A|,$Al8C ,$ATxc$ W|,'(A0 , A , AA088`8!}N 8}````!8c8, AC {|K;W(<AK`(<AA|KpcK|$@A88`"8!}K\8`"8!}KH Ap strncat_sU16|````!qK| P|#@A|< @@8,A$```!8c;,@(<8A},#A},#A8{8c,%A܈,A(#@$8|iB@X``!;,$Ae,#Ae,#A|e,#Al8C ,$AT{dW|,&(A0, A , AA088`8!}N 8}````!8c8, AC |"K;W(<AK`(<AAKtcK|$@A88`"8!}K`8`"8!}KL Al strncat_sRFBH@ @strncmpU(%8A, |A\@X, |AD@@, |A,@(x`iD9f8c, |A`8@a'(+a}i@``!a9`8, AH| P@Ԡ, AH| P@, AH| P@|H, |PL3BAXC x$T|dJ(%|b@<8c8|``!8cD8, |L3BAC | P|N  |P|N  |P|N |P|N T(%@Kt9@(%@Kd @ strncmpU16H@ @strncpyUp(`gA(,A9#,A`h8,Aܡdc`|8Px|t,8@T||(P,$8@N 888|(%L ```!8C Ka (8 AP| 89B@h``!9k,$A 8, A8  , A8  , AȠ98C 9k,$A yJ$8,,& 9A 8|J ,Ap8  ,A\|BM 8,&889M `!8, A8,%98M K|8P|t||(P,$8@tKl@N a'K8K8M Kp @@ strncpyU168,&| @@Ax|P|tAT~|p@8, Ap88p'`g#,A4`!8c8A888p,8@8`N xAP``i8(x Hh}Z|B8}H@9A4x,,y T A,(T>A,,A,(Apa(98cA8}B@p````!}Zx|b88h}L9xA0{ ,>T T>Ad,=A@,,A,?A98C x$|`Z|8|:x }G98hA4x,+x T A,'T >A,*A,+A|dJpAd888c,89, Al```!8A(88c9, ,A8K88`N 8`N x"88`N x"8`N 88`N |#yAK @ strncpy_sU168,&| @@Ax|PT~AT~,'@, 8At88p`g,A8``!8c8A888p,8@8`N xAl``hB8(x*J}R|b8}H9Alx,+y xA,+yD xyk Ad,,TA4,+TA ,,T.A,+T>A,,Ax,+AX8c8Aa` |````!8e9k}Rx|b8H9Alx,?{̂ xA,,{D x{ A,,TTA|,>T.AT,?T>A$,,A,>A,?A8C px$|dB|pAh888c,89, AP````!8A(88c9, ,AK88`N 8`N x"8T>8`Kx"T>8`N x"88`N x"8`N x 88`N x 8`N 88`N |#yAKl @ strncpy_sRFBH@ @strpbrkU, AH8`d```!8|,'M @8c, @8`N 8`N @X strpbrkU16|H< @strrchrU88x `!8(L& @``8c@`N 8cAK @H strrchrU16H@ @strspnU8, Al, AX8c``|'A(```!8,(|@A @,(A8,&@`N 8`N @ strspnU16H@ @strstrU, A,8`f8c| (,AA$`!88c,%|(A@蠤,%A8,'A|%8@8D|*8@`99c,*```!AG&,*|H@A|'aFaf99k,)|PAAT`f,'A 8c| 8A`8f,'@ 8`N |'A@`f,'AKN ,*AK8cK @L strstrU16H@ @strtokU"(#!q|x@IaCK=xh| B., @8`8!}N |jBxaK,#8A$88!}|jBKa8Ki|jB8!}N `jKxh| B., AxK A strtokU16H@ @ strtok_rU|!|jy`x@E}CSyAKxh| B., AT|jBxK],#8A$88!}|jBN |jB 8!}N 8`8!}iN 88`8!N aCKaxh| B., @l8`8!}iK A strtok_rU16|`|~y!ax@yAHA(|, At`}|~xHA(,#8A088!}|~N |~8!}N 8`8!}N 88`8!N cH A(|, @<8`8!}K A( strtok_rRFBA( L| N |fx|#x|3xH @bcopy @memmove A( L| N (A( L| N 8(%@H8c8|``!88c, A8C `N `N 8`N @Xascii7bitToU16|0|88!HaA(8` 8HyA(8!}N ALu16_trace_to_stderr,H!Q(|@Tff,@bP,//cpxaaaaaA@@bP88apH`8apP8q88H8!}N bP@ 8K@ 8K8apP8H}`8apP8q88H8!}N bP8Kl,bP/@D/cpxaaaaaA@TK8!N ,fAK A u16_set_trace|``P!!aA(paxHeA(`}8`H}A(`h8a8HA(8aHA(; x|g|`}:|x8|v88hF!g8D8,*A(|a:q 4|XPHy`,AtH`HA(8aHA(||c||3x |v8p4|a:|PH`,A8a8pH!`8aHA(|dH8ae| EN!A(8!}N A u16_traceMsg|x`d88!Ha`88!}N ADu16_set_cmdline|HbP!828cA(e| EN!A(8!p}N ALu16_endTraceMsg,AN T>H @u16_internalErrorMsg|=..`}``8.!pHA((#PP8`@X98p|B8at8\HQA(8at8K08! }N 8p8atp8\cHA(8at8K08! }N Au16_traceFopen;|;||}&aA!``{aA!P!8]AAApAxAAAAAA(A8apcHA(8`.,8 8 ;!sA:!a.@<8apsHA(|dH8ape| EN!A(;H@L:.: :`!:x8r`@H @u16_utf8conv_error|`8@``!8ap`H `8apP;8xH `8ap,A(b 8!8 }N H ]A(8 80|}8p|8ap8|1H YA(8p8ap8K8 b 8!}N Au16_malloc_errorT>,L HN @u16_array_short,M T>T>HN @ u16_unknownFormatStrp`M H8N @dbgAlignCheckStringU16xP|;`}a8f!, 8p;p@B@@````!8c 8 C `8"8#%C#E% x c$e$|``! |h1Ґx d8C ;`9 x |1Ґ8ap%dHA(|`c|9pB@<```!8 9 C 8(8apG|888H ( (~IKxc@8!0}a8N c (8!0N AdbgAlignCheckStringU16@AF19_18|``P;`8Y!8appxH A(8apHA(|`8o |"(@,|//.A@@4`TѾpq`d`f`eTc>x x x A @`,ap@::pap``!HQA(,AP:|6@@u:K7;Z(:A,>A>|P|`K`|P|`KT,@ ~9,>@|P|`K08`8!}K(;Z7(:@Kl@ `K@`K `TѾ@ pfr`TѾpqK`@TѾpfs``pfrK8K\8:8`#KLBBAK A fwrite_unlockedU16H @putsU|0!aa8~XHA(aKQ`88X`da98pKq,|@08~XHA(c8!}N 8b 8p8X8p8c9Kp||,@8~XHIA(8`8!}N AputsU16!Q|ax`HA(9axK]aaHA(}a8!N AlfwriteU16_impl8K\ @ fwriteU16K @ u16_fwriteU16K @ u16_fwriteUA( L| N A( L| N A( L| N (A( L| N 0A( L| N 8A( L| N @A( L| N HA( L| N PA( L| N XA( L| N `A( L| N hA( L| N pA( L| N xA( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N A( L| N |!H`8!p}N A$ vsprintfU!|a8!AH1`|c8!p}N ALsprintfU|!H`8!p}N A$ vsnprintfU!|a8!AH1`|c8!p}N AL snprintfU|!H U`8!p}N A$ vfprintfU|!H U`8!p}N A$vprintfU!|a8!AH `|c8!p}N ALprintfU!|a8!AH `|c8!p}N ALfprintfU||#y!``da!AAH88`p8pHQ`,|cA |#@A8`8!}N 8`x8!N A sprintf_sU16,$@ 8`N Hp @ vsprintf_sU16|`~|#y!aa!AA8p8`8pcHE`,|cAD{|#@@8!}N 888!}|#.K{888!}|#.K8`8!N A snprintf_sU16,$@ 8`N H0 @vsnprintf_sU16|`|#y!a8!AAxcHVA(,|c@,888`|8!}N |>@8@|, A88`8!}|K8`px8!N A sprintf_sRFB,$@ 8`N H @ vsprintf_sRFB`|#y|!a8!AAhcHTA(,8@(8|!8!}N |c8|#@A8!|!}K8`px8!N A snprintf_sRFB,$@ 8`N H0 @vsnprintf_sRFB|``!HSA(|#@,@$88|!8!}H88@8!}N 8!|!}N Avsnprintf_sRFB@AF17_16|``!HS A(,8@$888`|8!}H(|#@8@(|,%@8!}N 8`8!|}N Avsprintf_sRFB@AF18_14|`~8````!q8ppcH `|#@,@${88|#.8!}H{8@8!}N 88!}|#.N Avsnprintf_sU16@AF19_12|``d`8``!8ppH5`|#@,@8`8!}H@8!}N Alvsprintf_sU16@AF20_10,,$A$,%@88`N 8`N A ,&A4,$@ ,&@,%@K`8 8`N 8`N @t checkArgs|```!1aK5,@T8ap9H`8apHE``8apH`8!}N 8!}N A vvfprintfU16aK< @vvfprintf_sU16|!``8p88pK8!}N A8 vfprintfU160``d8fXK @ vprintfU16!|a8!AK|c8!p}N AH printfU16!|a8!AK|c8!p}N AH fprintfU16|!``8p`d8`8pK98!}N A< vsprintfU16!|a8!AKq|c8!p}N AH sprintfU16|!`a`d8``8KQ8!p}N AD vsnprintfU16!|a8!AKQ|c8!p}N AH snprintfU16|`|a`a=!qHU`( c48T08!}N ApFormattedOutputCtor|!H`8!p}N A$FormattedOutputXtor8,$M 8|&(@9AH|&8@8@}x|.N 80,&A}x|.N `}x|.N N @!OutputStream_writeNullTermination|}&aA`!!c K`;~;(#@ ;`{;@; :;, A``!|dHM:2, |Ac~H`.|}A|8C9"|@8apL1AlH Q` 8ap 8(x|2H `8(.A\98apH`c28apH``|,c.AH`,A\8apH i`,<@ |<@{@ |., @cH`,@|cK@Hc@:8!0|} !AaN cH `|c@:8!0|} K@K\| @A,|#@A cH`,ATK;cK;|}K|PcH`.|}K C FormattedOutput_parse|`;8%!Ka`|P,#A|t|c;8!}N A\FormattedOutput_findNextSpec8N @OutputStreamCtorN @OutputStreamXtor|t8xN @OutputStream_isFileOutputStream|!T>|, @HA|c8!p}N Hi|c8!p}N APOutputStream_writeSingleChar|`89!8pa8a8K`(#8`@ 88!}H8`8!}N A"OutputStream_writeSingleCharToFile8/|&@|0PAXx8,,A A,@ |+.88`N 8`N 88`N x|+.88`N @$OutputStream_writeSingleCharToString|T>,;|!Q,@|ax@H9 ca````!K9),A<axca|)@A8!}N 8!}N a@;c`!K,;Aac|=@A8!}K AOutputStream_writeMultipleChar|}&`}*%`!a, xA|ax@8Ku`,A@cxcH`8!|} N 8`8!|} K|HI`@`~ax8K`,@;}8K| COutputStream_writeString|```8!q8pK`|#@@$|"8!}H8`8!}N AxOutputStream_writeStringToFile``|c8(P8!q|%@A,(/@@|>@xfAh{@@|`2Ka`c|c|8!}N c|`2{K`K@ K{|`2K`c|cK;@|K|{xc|`K`8!|}KT AD OutputStream_writeStringToStringcN @OutputStream_getMaxLengthcN @OutputStream_getWrittenChars|`!H `8H`8$H`84H`8@H=`8cd`8!}N ApOutputConversionCtor|`!H `8H`8$Hu`84Hi`8@H`8d`8!}N AlOutputConversionXtorN @OutputConversion_setArgs|;`a`}!Q,-, +xA,;A, ,#L3AH, 0LFBAH y``|{c|.8(@ ,$*@4|8}xHa`{c|.,$.@DH ,$.@888}$x|x|H`||;{c|./$j,$lA,$L,hL3OFӂAH<,t/$zL3OFBA({`8}4|H`{c|.8(@8(@|8(@p/a,$iA$,$%,A/$XL3OFӂOAHH ,s/$u/xL3OFӂOA(;T>c8x8K`H8}@H`;|,@8!}Hc8!}aN A@OutputConversion_parse|`~!axH ``8~$H``f8~@84xH`8~@H `a,#AK|Y``8~@H/)`,A48~H `,8~@H `d||Ph8~@H.`,c@H `,a@8K`,aAl8K`,8~@ATHi`T`>8~@, xApHQ`T`>8~@, XAXH9`T`>~j, o@$8h8!}N ~h8!}N ~h8!8h}K8~@H`T`>, uA8~@H`T`>, xA8~@H`T`>, XA8~@H`88-,@`dKdcH5`,8@8`+d~`K8@, x80@axcK-``{axc8xK`C,[AcH`,A,=8@ApH`T`>axc, c@K`,AcHa`,ax@$j8 cK`,A8|8!} AaN |c8!|} K|{cc|KccK`,AK@cH`,LJBAaxj80cK`,@KH`T`>8@, X80@@axcK``{axc8XKi`C,[A, oA A K8ax80cK%``z|{.KcH`|,8 axLJBAcjK!`,`~@K`axK!`a8!}8`N C OutputConversion_output8N @OutputFlagsCtorN @OutputFlagsXtor8N @ %OutputFlags_switchOnLeftJustifiedFlag8N @ &OutputFlags_switchOnSignConversionFlag8N @ OutputFlags_switchOnSpaceFlag8 N @ 'OutputFlags_switchOnAlternativeFormFlag8N @ OutputFlags_switchOnZeroFlagcN @OutputFlags_isLeftJustifiedFlagcN @ OutputFlags_isSignConversionFlagc N @OutputFlags_isSpaceFlagcN @!OutputFlags_isAlternativeFormFlagcN @OutputFlags_isZeroFlag|!888ax`!8, +A/ ,-A, #AlA4`88,@ ,A|8!}N axK,A8`8,@KaxK}KaxK,A 8KaxKK, 0A,@paxK,A 8KaxKKaxK,AK|axK KpaxK,A 8KXaxKEKL ADOutputFlags_parse8N @FieldWidthCtorN @FieldWidthXtor, @ 8`N 8H @FieldWidth_parseTd>8`8( L 8`N @FieldWidth_isDigit|!`ed`88T>Ky,9@l9 x$````!xh8|:9|||JT>K),x$A̐aC8!p}N 8`8!p}N AFieldWidth_atoic8|48TN @FieldWidth_isDefinedcN @FieldWidth_getValuecN @FieldWidth_isStaticN @FieldWidth_setArgumentPosition N @FieldWidth_setArgumentValue|`L"Bx|``|k".`!```!K!,8Al| *.L!, *@L~|x8|k*.,#AA`8!}N , `@K|*cK`f,@$L |gx|k*.,#A@KTL K AFieldWidth_parse@AF11_38N @ OutputPrecisionCtorN @OutputPrecisionXtor, @ 8`N 8H @OutputPrecision_parseTd>8`8( L 8`N @OutputPrecision_isDigit|!`ed`88T>Ky,9@l9 x$````!xh8|:9|||JT>K),x$A̐aC8!p}N 8`8!p}N AOutputPrecision_atoicN @OutputPrecision_getValue|`L"B`x|`h`|d.!```!K!,8Ax| B.L!, *@L~|x8|kB.,#AA`8!}N 8`| B., @K|BcK`f,@$L |gx|kB.,#A@KHL K AOutputPrecision_parse@AF7_38N @ LengthModifierCtorN @LengthModifierXtor|!/%j,%l8@,tAd,%zAHi,@8!p}N A8OutputConversionSpec_setSymbolTd>8`88((AN 8@,$a(@/$i,%@$,$sA,uA,$xLFAH/$AA,XL3LFA8`N @$OutputConversionSpec_isValidSymbol__cN @OutputConversionSpec_getSymbol8N @ +OutputConversionSpec_switchOnNegativeSign__cN @OutputConversionSpec_isNegativecN @&OutputConversionSpec_getConvertedValuecK @OutputConversionSpec_isValid|``a`{`c!Q8x8(( @A0bxH8c| *| N axK`,@L~888ccHa8!}N axKy`,A~888ccKa8!N axKe``e~8@#A4ccH a8!}N ccKE PH K8`KA(,#{AP~888}cf{a8!N 88d8K`a8!}KaxK`,@x~8,$A<cc8 8Ha8!}N ccK)|8 8HKaxK`,A|~8,$AccKxg8a8!N |cc|888Ha8!}N g8,$A4|ccH a8!}N 8K[ ``~x}8}KA({,#A888K`a8!}K888*K`a8!}Khg8(>@;|,AcH )|}yA{8|KA({,#AHc8K%`88!}{|.aN 888K`8!}aKc8DKd`|`4T~KTcKY`|}yAKE818h3!Q9 79*99Kb85=`gA9LdA=i>Gp9[fA9KhA8 j=@k=`mat8 l=ox8 n=@q|8 p=`s!8 r=u8 t=@wa>I8 v>K8 x>`M8z!>@O> Q>S=U=WW>8B8xD8F8Ha8tL8Pa8pT9Jؐ,8N8Xa<Y8ap9R8V+$8Z8;@A8a,%A0,% A,%AH;!|+|} P|yA4``!|+y;9}|:.} P|y8@y|".A, xA, XA,;@@,o@ ,ALZA8}|P,o@d,@\|`P,@P8dTcKXx xT<|#y;!A0`!x x|*.;Z}CyT<8;9@;Z|*.AK;!;@|xx$y|:| P}CyA@`!x;9}yy$|*.;Zx8}J| P|;y@x|".AXK@x`xT<|#y;!A8```!x`x|*.;Z}CyT<8;9@;Z|*.AK AOutputConversionSpec_itoa__|}&9@%,NBaA88!9.9 *`8!;P;x;!xAp@9@#8`Aq,8p9@L}1}%!@ `d}E898ap|},;|M|!cd|),F/ fL3AAcc,@AX@pc# 8pAc|cKA(|Ab,@ 8b888cK`88||8|xKA(|eyAc#cDcFHe8{D|#.|9@@@cC0*|} 8! !AaN c#KA(cC0*|} K8b88cK1`8Kt`~|zK$;KA(|yy@b888cK`;!xNKtbA,,(A@TAAD,#AA0;KiA(,#A `yK8b88cKa`NK8K8`88K`"C`(OutputConversionSpec_dtoa__|``!q`x8H`|P,#A|t|c8!}Hax8!}N Ahu16_strnlenU16|8|8K @OutputConversionSpec_ptoa__8`88((AN ,$i@,A/$oA$/$XA,aL3LFA8`N ,$uA,xL0BAK @lOutputConversionSpec_isNumber8|0@T8|8x|c:|2,A,|````!8c8C |N 8`N @dconvertAsciiToWideCharcN @)OutputConversionSpec_getWriteCountPointercN @*OutputConversionSpec_getConvertedValueSize|`c!K=A(88!}N A@OutputConversionSpecXtor@AF19_2H@ @memcmpU(%8c@48|```!8c8| (@C 8`N |P|N @P memcmpU16|H< @memchrU(%8@08x |``!8|$A8C 8`N x|cN @L memchrU16|H< @memsetU(%L 8|````!8C N @0 memsetU16|!xcKyA(8!p}N A(mallocU|!xKA(8!p}N A(reallocU|!xHA(8!p}N A(callocU|!xaxKx`ax8!}N A0memcpyU|!xaxH`ax8!}N A0memmoveU|!|& @(@0A8`"8!pN H`8`"8!p}N ``Kx`8`8!p}N Ah memcpy_sRFB|!|& @(@4A8`"8!pN xH`8`"8!p}N x``KwY`8`8!p}N Ap memcpy_sU16|!|& @(@0A8`"8!pN H`8`"8!p}N ``H`8`8!p}N Ah memmove_sRFB|!|& @(@4A8`"8!pN xH`8`"8!p}N x``H`8`8!p}N Ap memmove_sU16A( L| N A( L| N A( L| N A( L| N  A( L| N (A( L| N 0A( L| N 8A( L| N @A( L| N HA( L| N |T>8`!A(HXcd| DN!A(|ct8!}N A\isalnumU_wrapper|T>8`!A(H%`cd| DN!A(|ct8!}N A\isalphaU_wrapper|T>8`!A(Hۅhcd| DN!A(|ct8!}N A\iscntrlU_wrapper|T>8`!A(Hpcd| DN!A(|ct8!}N A\islowerU_wrapper|T>8`!A(HExcd| DN!A(|ct8!}N A\isprintU_wrapper|T>8`!A(H٥cd| DN!A(|ct8!}N A\isspaceU_wrapper|T>8`!A(Hcd| DN!A(|ct8!}N A\isupperU_wrapper|T>8`!A(Hecd| DN!A(Tc>8!}N A\tolowerU_wrapper|T>8`!A(HPcd| DN!A(Tc>8!}N A\toupperU_wrapper|aA!!Aax8KA(|yA,?Ac,@08!}!AaN 0cx8~8hH=A(#O;`8,O8` @,```!K9A(;{8` 8|;@AKA(`g8~888#HA(c8!}!AaKLK%A(`~",@,?AK0x8}80HmA(#cO;@8,O8` @,```!KiA(;Z8` 8|:@AKA(`g8}888 H A((>c,A`88b08T`f@;8cHA(,O@@#O;`8` c````!KA(;{8` c|;@AKA(`gc888 HiA(K;8f8TcHMA(,O@K| A nlsui_dlopen|aA!!AaxHA(`,@8!}N K%A(`~",@4c8!}!AaN 0x8}8HMA(#cO;@8,O8` @,```!KIA(;Z8` 8|:@AKA(`g8}888AHA((>c,A@88b08 `f@;8cHA(,O@@#O;`8` c````!KA(;{8` c|;@AKA(`gc888CHIA(c8!}!K;8f8 cHA(,O@Kh A nlsui_dlclose|!QxK A(a,#A,@8!}N 0`f88HmA(#O;8,O8` @,```!KiA(;8` 8|<@AKA(`g8888H A(a8!}N ,axA@AKA(`g8|888|HIA(ax8!}K@ A nlsui_dlsym|```!axKA(`}cKA(`g|88|c| @xA(Kf`8!}N ccH8!}N Anlsui_safe_strcat|aA!!Aaxb, @,@ 8!N 08d8HA(#O;08,O8` @,0``!KA(;8` 8|>@AKA(`g088d88H1A(8!}N 8 8 8KaA(;L8 (#A`~cKA(8 (<A8d(d88 ,#c @8f(fKax8 dKyA(8 |c;C`8e(D(:Ae88 ,#x@`8f(fK=,>A , @8b cKA(b,@"088yHA(,A@;`#CO8,O8` @(``!K}A(;{8` 8|;@AK~A(`g8y888+H)A(8b cKKcKb A(,#8 e@@,@4W>b088{HA(,A@;#O8,O8` @(``!K|A(;8` 8|=@AK~A(`g8{888HiA(8b cK A nlsui_setPath|a;b !a, A{KA(,@P( @{,#A K1A(88!}aN 8` 08K{A(,A08~8HYA(#O;8,O8` @(``!K{YA(;8` 8|<@AK|A(`g8~8G88HA(( @0Kax8!N ATnlsui_resetPath|a8~\!Q, AxK}A(,#axAD8tK}`8,@488!}aN 8|axK}`8,A8axK}`8,Aax8K}m`,@8b08` 8KyA(88{HA(#O;8,O8` @(``!KyA(;8` 8|<@AKzA(`g8{888}H9A(88!}aK88!}N 8!N Anlsui_initLoadIcuTrace|b8c!q, AK{A(||ycA8tK{`,cA,8|K{`,cA8K{`,cA8K{`,8@88`8K`8!}N 8`cKa`8!}K88`8K)`8!}K88`8K`8!}K\88`8K`8!}K$88!}K8!N Anlsui_initUfuncTrace|; `e8;(8(!K:9` 8!}N ALnlsui_addIcuSearchPath|p`!q@b8c Ky!A(,#@0,A8d8 HA(,O@H;00#O8` 8````!KuyA(;8` 8|?@AKvA(`g088d88HA(8`KmA(|p8`K]A(|p,ATHA,#A,K88!}N 8!}N 08}8\HA(,A@,O@8;#O8` 8``!KtyA(;8` 8|?@AKuA(`g8}888HA(Hm,#@08!}K8 Aicu7bitFallbackOrExitbbX|`hpx "BbP,98!q;(8b@8X8pf8b8i8 @8!N 088 tHA(#O;8,O8` @,```!KrA(;8` 8|<@AKt5A(`g8888 qHA(8!}N A@ setCtype7bitb8aA|B8 c!aK%X,#dAc8 8K`,#dAc8 8Kh,#dA c8 8Kp,#dA c8 $8Kx,#dAc8 48K,#dAc8 D8Ke,#dApc8 T8KEP,#dA`c8 d8K%,#dA 8`Ap8!}N KMA(`,At,?AA08`8!}AaN 08c8~HqA(,A@,O@8;#O8` 8``!KpiA(;8` 8|?@AKqA(`g8~888@AKqA(`g8888@AKo%A(`g8888;HyA(8`8!}AKb088 T8{HIA(,AH,O@@;#O8` 8````!Km9A(;8` 8|=@AKnA(`g8{888;HA(,K0K=A(`,AD,?A@08c8~HA(,A<,O@4;#O8` 8`!KlA(;8` 8|?@AKmA(`g8~888:H)A(8`8!}AKt@\08888HA(,AD,O@<;#O8` 8```!KkA(;8` 8|>@AKm5A(`g8888:HA(8`8!}AKb088 D8{HYA(,AH,O@@;#O8` 8````!KkIA(;8` 8|=@AKlA(`g8{888:HA(,K0K}MA(`,AD,?A@08c8~HA(,A<,O@4;#O8` 8`!KjA(;8` 8|?@AKkA(`g8~8889H9A(8`8!}AK@l08888HA(,AD,O@<;#O8` 8```!KiA(;8` 8|>@AKkEA(`g88889HA(8`8!}AKb088 48{HiA(,AH,O@@;#O8` 8````!KiYA(;8` 8|=@AKjA(`g8{8889HA(,K0K{]A(`,AD,?A@08c8~HA(,A<,O@4;#O8` 8`!KhA(;8` 8|?@AKiA(`g8~8888HIA(8`8!}AK@|08888HA(,AD,O@<;#O8` 8```!Kh A(;8` 8|>@AKiUA(`g88888HA(8`8!}AKb088 $8{HyA(,AH,O@@;#O8` 8````!KgiA(;8` 8|=@AKhA(`g8{8888H A(,K0KymA(`,AD,?A@$08c8~HA(,A<,O@4;#O8` 8`!KfA(;8` 8|?@AKhA(`g8~8887HYA(8`8!}AK@08888H%A(,AD,O@<;#O8` 8```!KfA(;8` 8|>@AKgeA(`g88887HA(8`8!}AKb088 8{HA(,AH,O@@;#O8` 8````!KeyA(;8` 8|=@AKfA(`g8{8887HA(,K0Kw}A(`,AD,?A@408c8~HA(,A<,O@4;#O8` 8`!KdA(;8` 8|?@AKfA(`g8~8886HiA(8`8!}AK@08888H5A(,AD,O@<;#O8` 8```!Kd)A(;8` 8|>@AKeuA(`g88886HA(8`8!}AKb088 8{HޙA(,AH,O@@;#O8` 8````!KcA(;8` 8|=@AKdA(`g8{8886H)A(,K0KuA(`,AD,?A@D08c8~HA(,A<,O@4;#O8` 8`!KbA(;8` 8|?@AKd%A(`g8~8885HyA(8`8!}AK@08888HEA(,AD,O@<;#O8` 8```!Kb9A(;8` 8|>@AKcA(`g88885HA(8`8!}AK$088 8}HܩA(,AH,O@@;#cO8` 8````!KaA(;8` 8|<@AKbA(`g8}8885H9A(,K0KsA(`,AD,?A@T08c8}HA(,A<,O@4;#O8` 8`!K`A(;8` 8|?@AKb5A(`g8}8884HۉA(8`8!}AK@08888HUA(,AD,O@<;#O8` 8```!K`IA(;8` 8|>@AKaA(`g88884HA(8`8!}AK4088 8hHڹA(,AL,O@D;0#O8` 8```!K_A(;8` 08|>@AK`A(`g088848hHAA(,K( AmapCtypeFunctions88`h"xX`bPpB; ;(88@8X 88p 88N @useFallBackCtype|`Te>ap`!aA,A8HMA(|ct8!}aN b08{8`HؽA(,A<;#O8,O8` @$`!K]A(;8` 8|=@AK_A(`g8{8 `88HQA(,@@8{8\H1A(,A@;#O,O8` @,8``!K])A(;8` 8|>@AK^uA(`g8{8 `88HA(HA(|ct8!}aK A isalnumU_7bit|`Te>p`!qAb,A4HיA(|ct8!}N 08h8HA(,AH;0#O8,O8` @,``!K[A(;8` 08|>@AK]!A(`g0888 8hHqA(b,@808\8hHMA(,AP;0#O8,O8` @4````!K[9A(;8` 08|>@AK\A(`g0888 8hHA(H=A(|ct8!}K A isalphaU_7bit|`Te>ap`!aA,A8HսA(|ct8!}aN b08{8HA(,A<;#O8,O8` @$`!KYA(;8` 8|=@AK[%A(`g8{8 `88HqA(,@@8{8\HQA(,A@;#O,O8` @,8``!KYIA(;8` 8|>@AKZA(`g8{8 `88HA(HuA(|ct8!}aK A iscntrlU_7bit|`Te>p`!qAb,A4H A(|ct8!}N 08h8HA(,AH;0#O8,O8` @,``!KWA(;8` 08|>@AKYAA(`g0888 8hHґA(b,@808\8hHmA(,AP;0#O8,O8` @4````!KWYA(;8` 08|>@AKXA(`g0888 8hHA(HҭA(|ct8!}K A islowerU_7bit|`Te>ap`!aA,A8H-A(|ct8!}aN b08{8PHA(,A<;#O8,O8` @$`!KUA(;8` 8|=@AKWEA(`g8{8 `88HБA(,@@8{8\HqA(,A@;#O,O8` @,8``!KUiA(;8` 8|>@AKVA(`g8{8 `88HA(HA(|ct8!}aK A isprintU_7bit|`Te>p`!qAb,A4HyA(|ct8!}N 08h8 H%A(,AH;0#O8,O8` @,``!KTA(;8` 08|>@AKUaA(`g0888 8hHαA(b,@808\8hH΍A(,AP;0#O8,O8` @4````!KSyA(;8` 08|>@AKTA(`g0888 8hHA(HA(|ct8!}K A isspaceU_7bit|`Te>ap`!aA,A8HΝA(|ct8!}aN b08{8HA(,A<;#O8,O8` @$`!KRA(;8` 8|=@AKSeA(`g8{8 `88H̱A(,@@8{8\H̑A(,A@;#O,O8` @,8``!KQA(;8` 8|>@AKRA(`g8{8 `88H!A(HUA(|ct8!}aK A isupperU_7bit|`T~>a,@p`!a@`@8,[8 @,8!T>}aN c8!}aKb,A,@@Kcb08h8HA(,AD;0#O8,O8` @(`!KOA(;8` 08|=@AKQAA(`g0888 8hHʑA(b,@\08\8hHmA(,AP;0#O8,O8` @4````!KOYA(;8` 08|=@AKPA(`g0888 8hHA(K A tolowerU_7bit|`T}>aA,`p`!a@d@<,{8@08!T>}AaN c8!}AaKԃ,A,`@KcB08z8HA(,AH;#cO8,O8` @0````!KMA(;8` 8|<@AKO5A(`g8z8 `88HȁA(,@X8z8\HaA(,A@;#O,O8` @,8``!KMYA(;8` 8|>@AKNA(`g8z8 `88HA(K A toupperU_7bit|b!8 Ki8`8!p}N A0 useICUCtypeb8cN @ getIcuLibList|aA!!QK`",@,@8~KO9A(,A(#@8~P0`e88}HơA(,O@@;#cO8` 8````!KKA(;8` 8|<@AKLA(`g8}888H9A(8KI|}yA܀,@0!x8!c}aN 088|HA(,O@D;`|`8` #O8````!KJA(;{8` 8|;@AKLA(`g8|888HiA(c!x8!}aKP; ,%A,@P`K%8K9|}yAĀ,@8Kc8!}!AaN 088|HĽA(,O@<;`|`8` #O8``!KIA(;{8` 8|;@AKKA(`g8|888HYA(KPK-,A8~KLA(,@(#@8~P0`e88|H A(,AH,O@@;#O8` 8````!KHA(;8` 8|?@AKJEA(`g8|888 HÙA(8`8!}!AaK08$ 8|HUA(,AD,O@<;|`8` #O8``!KHIA(;8` 8|=@AKIA(`g8|888HA(K088|HA(,O@@;`#CO8` 8````!KGA(;{8` 8|;@AKIA(`g88|88HiA( K408~8HIA(,O@8;#cO8` 8``!KGIA(;8` 8|<@AKHA(`g8~888HA(K08d8THA(,O@H;00|`8` #O8```!KFA(;8` 8|>@AKHA(`g088d88HQA(,A`0 8|8~H!A(,O@@;`|`8` #O8```!KFA(;{8` 8|;@AKGeA(`g8~888HA(,A08` 8KEA(K A openLibIcuUc|aA!a, AbB88cK5H,#dAc88KP,#dAc88KX,#dAc88K`,#dA@c88Kh,#dApc8$8Kp,#dAc8@8Kux,#dAc8T8KU,#dA c8l8K5,#dA 0c88K,#@A dc88K,#0Ac88K,#8Ac88K,#dAc88K,#dA,c88K,#dA488`Ap8!}N KUA(`~,A8,>AA08`8!}AaN 08c8HA(,A<,O@4;#O8` 8`!KBA(;8` 8|>@AKDA(`g8888ZHYA(8`8!}AKX@@08888H%A(,A,O@;#O8` 8```!KBA(;8` 8|>@AK`b0888{HA(,A@,O@8;#O8` 8``!KAA(;8` 8|=@AKCA(`g8{888ZHYA(,KDKSA(`~,A,>A@,08c8HA(,A@,O@8;#O8` 8``!KA A(;8` 8|>@AKBUA(`g8888YHA(8`8!}AK@08888HuA(,A,O@;#O8` 8```!K@iA(;8` 8|>@AK`b0888{HA(,A@,O@8;#O8` 8``!K@ A(;8` 8|=@AKAUA(`g8{888YHA(,KlKR A(`~,A,>A@|08c8HaA(,A@,O@8;#O8` 8``!K?YA(;8` 8|>@AK@A(`g8888XHA(8`8!}AK@08888HA(,A,O@;#O8` 8```!K>A(;8` 8|>@AK`b0888{HaA(,A@,O@8;#O8` 8``!K>YA(;8` 8|=@AK?A(`g8{888XHA(,KlKP]A(`~,A,>A@08c8HA(,A@,O@8;#O8` 8``!K=A(;8` 8|>@AK>A(`g8888WHIA(8`8!}AKH@008888HA(,A,O@;#O8` 8```!K= A(;8` 8|>@AK`b0888{HA(,A@,O@8;#O8` 8``!KA@08c8HA(,A@,O@8;#O8` 8``!K;A(;8` 8|>@AK=EA(`g8888VHA(8`8!}AK@08888HeA(,A,O@;#O8` 8```!K;YA(;8` 8|>@AK`b0888{HA(,A@,O@8;#O8` 8``!K:A(;8` 8|=@AKA@l08c8HQA(,A@,O@8;#O8` 8``!K:IA(;8` 8|>@AK;A(`g8888UHA(8`8!}AK@08888HA(,A,O@;#O8` 8```!K9A(;8` 8|>@AK`b0888{HQA(,A@,O@8;#O8` 8``!K9IA(;8` 8|=@AK:A(`g8{888UHA(,KlKKMA(`~,A,>A@08c8HA(,A@,O@8;#O8` 8``!K8A(;8` 8|>@AK9A(`g8888TH9A(8`8!}AK8@ 08888HA(,A,O@;#O8` 8```!K7A(;8` 8|>@AK`b088l8{HA(,A@,O@8;#O8` 8``!K7A(;8` 8|=@AK8A(`g8{888TH9A(,KlKIA(`~,A,>A@ 08c8HA(,A@,O@8;#O8` 8``!K6A(;8` 8|>@AK85A(`g8888SHA(8`8!}AK@p08888HUA(,A,O@;#O8` 8```!K6IA(;8` 8|>@AK`b088T8{HA(,A@,O@8;#O8` 8``!K5A(;8` 8|=@AK75A(`g8{888SHA(,KlKGA(`~,A,>A@\08c8HAA(,A@,O@8;#O8` 8``!K59A(;8` 8|>@AK6A(`g8888RHA(8`8!}AK@08888HA(,A,O@;#O8` 8```!K4A(;8` 8|>@AK`b088@8{HAA(,A@,O@8;#O8` 8``!K49A(;8` 8|=@AK5A(`g8{888RHA(,KlKF=A(`~,A,>A@08c8HA(,A@,O@8;#O8` 8``!K3A(;8` 8|>@AK4A(`g8888QH)A(8`8!}AK(@08888HA(,A,O@;#O8` 8```!K2A(;8` 8|>@AK`b088$8{HA(,A@,O@8;#O8` 8``!K2A(;8` 8|=@AK3A(`g8{888QH)A(,KlKDA(`~,A,>A@08c8HA(,A@,O@8;#O8` 8``!K1A(;8` 8|>@AK3%A(`g8888PHyA(8`8!}AKx@`08888HEA(,A,O@;#O8` 8```!K19A(;8` 8|>@AK`b0888{HA(,A@,O@8;#O8` 8``!K0A(;8` 8|=@AK2%A(`g8{888PHyA(,KlKBA(`~,A,>A@L08c8H1A(,A@,O@8;#O8` 8``!K0)A(;8` 8|>@AK1uA(`g8888OHA(8`8!}AK@08888HA(,A,O@;#O8` 8```!K/A(;8` 8|>@AK`b0888{H1A(,A@,O@8;#O8` 8``!K/)A(;8` 8|=@AK0uA(`g8{888OHA(,KlKA-A(`~,A,>A@08c8HA(,A@,O@8;#O8` 8``!K.yA(;8` 8|>@AK/A(`g8888NHA(8`8!}AK@08888HA(,A,O@;#O8` 8```!K-A(;8` 8|>@AK`b0888{HA(,A@,O@8;#O8` 8``!K-yA(;8` 8|=@AK.A(`g8{888NHA(,KlK?}A(`~,A,>A@08c8HA(,A@,O@8;#O8` 8``!K,A(;8` 8|>@AK.A(`g8888MHiA(8`8!}AKh@P08888H5A(,A,O@;#O8` 8```!K,)A(;8` 8|>@AK`b0888{HA(,A@,O@8;#O8` 8``!K+A(;8` 8|=@AK-A(`g8{888MHiA(,KlK=A(`~,A,>A@<08c8H!A(,A@,O@8;#O8` 8``!K+A(;8` 8|>@AK,eA(`g8888?HA(8`8!}AK@08888HA(,A,O@;#O8` 8```!K*yA(;8` 8|>@AK`0888}H!A(,A@,O@8;#cO8` 8``!K*A(;8` 8|<@AK+eA(`g8}888?HA(,Kl8`8!N AmapIcuUtilFunctionsb8ab|8 c!aKI,#dAHc8 8K),#dHA(c8 8K ,#dA c8 (8K,#dA c8 <8K,#dAc8 X8K,#dAc8 p8K,#dAc8 8Ki,#dAhc8 8KI,#dA,88`ax8!}N K:eA(`b,Al,?AA,8`8!}aN 08c8~HA(,A<,O@4;#O8` 8`!K'A(;8` 8|?@AK(A(`g8~888tH)A(8`8!}aK\@D08888HA(,AD,O@<;#O8` 8```!K&A(;8` 8|>@AK(5A(`g8888tHA(8`8!}aK088 8~HYA(,AH,O@@;#O8` 8````!K&IA(;8` 8|=@AK'A(`g8~888tHA(b,KK8IA(`b,AP,?A@08c8}HA(,AH,O@@;#O8` 8````!K%A(;8` 8|?@AK&A(`g8}888sH)A(8`8!}aK\@D08888HA(,AD,O@<;#O8` 8```!K$A(;8` 8|>@AK&5A(`g8888sHA(8`8!}aK088 8|HYA(,AH,O@@;#O8` 8````!K$IA(;8` 8|>@AK%A(`g8|888sHA(b,K K6IA(`b,AP,?A@08c8}HA(,AH,O@@;#O8` 8````!K#A(;8` 8|?@AK$A(`g8}888rH)A(8`8!}aK\@D08888HA(,AD,O@<;#O8` 8```!K"A(;8` 8|>@AK$5A(`g8888rHA(8`8!}aK088 p8|HYA(,AH,O@@;#O8` 8````!K"IA(;8` 8|>@AK#A(`g8|888rHA(b,K K4IA(`b,AP,?A@08c8}HA(,AH,O@@;#O8` 8````!K!A(;8` 8|?@AK"A(`g8}888qH)A(8`8!}aK\@D08888HA(,AD,O@<;#O8` 8```!K A(;8` 8|>@AK"5A(`g8888qHA(8`8!}aK088 X8|HYA(,AH,O@@;#O8` 8````!K IA(;8` 8|>@AK!A(`g8|888qHA(b,K K2IA(`b,AP,?A@08c8}HA(,AH,O@@;#O8` 8````!KA(;8` 8|?@AK A(`g8}888pH)A(8`8!}aK\@D08888HA(,AD,O@<;#O8` 8```!KA(;8` 8|>@AK 5A(`g8888pHA(8`8!}aK088 <8|HYA(,AH,O@@;#O8` 8````!KIA(;8` 8|>@AKA(`g8|888pHA(b,K K0IA(`b,AP,?A@08c8}HA(,AH,O@@;#O8` 8````!KA(;8` 8|?@AKA(`g8}888oH)A(8`8!}aK\@D08888HA(,AD,O@<;#O8` 8```!KA(;8` 8|>@AK5A(`g8888oHA(8`8!}aK088 (8|HYA(,AH,O@@;#O8` 8````!KIA(;8` 8|>@AKA(`g8|888oHA(b,K K.IA(`b,AP,?A@08c8}HA(,AH,O@@;#O8` 8````!KA(;8` 8|?@AKA(`g8}888nH)A(8`8!}aK\@D08888HA(,AD,O@<;#O8` 8```!KA(;8` 8|>@AK5A(`g8888nHA(8`8!}aK088 8|HYA(,AH,O@@;#O8` 8````!KIA(;8` 8|>@AKA(`g8|888nHA(b,K K,IA(`b,AP,?A@08c8}HA(,AH,O@@;#O8` 8````!KA(;8` 8|?@AKA(`g8}888mH)A(8`8!}aK\@D08888HA(,AD,O@<;#O8` 8```!KA(;8` 8|>@AK5A(`g8888mHA(8`8!}aK088 8|HYA(,AH,O@@;#O8` 8````!KIA(;8` 8|>@AKA(`g8|888mHA(b,K K*IA(`~b,A,>A@08c8}HA(,AH,O@@;#O8` 8````!KA(;8` 8|?@AKA(`g8}888lH)A(8`8!}aK\@D08888}HA(,A,O@;#O8` 8```!KA(;8` 8|?@AK`088 8hHA(,AD,O@<;0#O8` 8`!KA(;8` 08|?@AKA(`g0888l8hH!A(b,KX AXmapUbidiFunctions|8ba!a8 cK8,#eA8`8!}N K'A(|y,A@AA,8`8!}aN c088HA(,AH;#O8,O8` @0````!K A(;8` 8|>@AKUA(`g8888HA(8`8!}aKH@008888HmA(,A;#O8,O8` @`!KiA(;8` 8|>@AK`b0b`e88{8 H A(,AH;#O,O8` @48````!KA(;8` 8|=@AKEA(`g8{888HA(,?,AAP8`8!}K$ A|mapUshapingFunctionsb8aA|8 c!aK,#BdAc8 8K,#zPAc8 08K,#zXA c8 P8K,#dA c8 h8K,#z`Ac8 8Km,#zhAc8 8KQ,#zpAc8 8K5,#zxAtc8 8K,#dA088` Ap8!}N K$1A(`~,A|,>AA08`8!}AaN 08c8|HYA(,AH,O@@;#O8` 8````!KIA(;8` 8|>@AKA(`g8|888HA(8`8!}AKL@408888~HA(,AD,O@<;#O8` 8```!KA(;8` 8|=@AKA(`g8~888HIA(8`8!}AKb088 8{HA(,AH,O@@;#O8` 8````!K A(;8` 8|=@AKUA(`g8{888HA(,KK" A(`~,AH,>A@08c8|HaA(,A@,O@8;#O8` 8``!KYA(;8` 8|>@AKA(`g8|888HA(8`8!}AK\@D08888~HA(,AD,O@<;#O8` 8```!KA(;8` 8|=@AKA(`g8~888HYA(8`8!}AKb088 8{H)A(,AH,O@@;#O8` 8````!KA(;8` 8|=@AKeA(`g8{888HA(,K,K A(`~,AH,>A@08c8|HqA(,A@,O@8;#O8` 8``!K iA(;8` 8|>@AKA(`g8|888H A(8`8!}AKl@T08888~HA(,AD,O@<;#O8` 8```!K A(;8` 8|=@AKA(`g8~888HiA(8`8!}AKb088 8{H9A(,AH,O@@;#O8` 8````!K )A(;8` 8|=@AK uA(`g8{888HA(,K,K-A(`~,AH,>A@08c8|HA(,A@,O@8;#O8` 8``!K yA(;8` 8|>@AK A(`g8|888HA(8`8!}AK|@d08888~HA(,AD,O@<;#O8` 8```!K A(;8` 8|=@AK %A(`g8~888HyA(8`8!}AKb088 8{HIA(,AH,O@@;#O8` 8````!K 9A(;8` 8|=@AK A(`g8{888HA(,K,K=A(`~,AH,>A@08c8|HA(,A@,O@8;#O8` 8``!K A(;8` 8|>@AK A(`g8|888H)A(8`8!}AK@t08888~HA(,AD,O@<;#O8` 8```!KA(;8` 8|=@AK 5A(`g8~888HA(8`8!}AKb088 h8{HYA(,AH,O@@;#O8` 8````!KIA(;8` 8|=@AK A(`g8{888HA(,K,KMA(`~,AH,>A@ 08c8|HA(,A@,O@8;#O8` 8``!KA(;8` 8|>@AKA(`g8|888H9A(8`8!}AK@08888~HA(,AD,O@<;#O8` 8```!KA(;8` 8|=@AKEA(`g8~888HA(8`8!}AKb088 P8{HiA(,AH,O@@;#O8` 8````!KYA(;8` 8|=@AKA(`g8{888HA(,K,K]A(`~,AH,>A@008c8|HA(,A@,O@8;#O8` 8``!KA(;8` 8|>@AKA(`g8|888HIA(8`8!}AK@08888~HA(,AD,O@<;#O8` 8```!K A(;8` 8|=@AKUA(`g8~888HA(8`8!}AK b088 08{HyA(,AH,O@@;#O8` 8````!KiA(;8` 8|=@AKA(`g8{888H A(,K,KmA(`~,AH,>A@@08c8}H~A(,A@,O@8;#O8` 8``!KA(;8` 8|>@AKA(`g8}888H~YA(8`8!}AK@08888~H~%A(,AD,O@<;#O8` 8```!KA(;8` 8|=@AKeA(`g8~888H}A(8`8!}AK088 8}H}A(,AH,O@@;#cO8` 8````!KyA(;8` 8|<@AKA(`g8}888H}A(,K,K}A(`|,A,<A@P08c8}H|A(,A@,O@8;#O8` 8``!KA(;8` 8|>@AKA(`g8}888H|iA(8`8!}AK@08888}H|5A(,A,O@;#O8` 8```!K)A(;8` 8|>@AK`088 8hH{A(,AD,O@<;0#O8` 8`!KA(;8` 08|>@AKA(`g08888hH{aA(,Kd AmapUnormFunctionsb88 |c!qK| (,#dA$c88 K{0,#dA"c88 K{8,#dA hc88 K{@,#dADc88 K{},#dA c88 K{Y,#dAc88 K{5H,#dAc88 K{P,#dAc88 0KzX,#dAc88 @Kz`,#dAlc88 PKz,#dAHc88 dKzh,#dA $c88 xKz]p,#dA c88 Kz9x,#dAc88 Kz,#dAc88 Ky,#dAc88 Ky,#dApc88 Ky,#dA(88!8`}N KA(`b,At,?AA(8`8!}N 0c8}8HwA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888HwA(8`8!}KT@<08888HwMA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKA(`g8888HvA(8`8!}K0`8|88 HvA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888HvEA(b,KK A(`b,AP,?A@0c8}8HuA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888HuA(8`8!}KT@<08888HuMA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKA(`g8888HtA(8`8!}K0`8|88 HtA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888HtEA(b,K K A(`b,AP,?A@0c8}8HsA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888HsA(8`8!}KT@<08888HsMA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKA(`g8888HrA(8`8!}K0`8|88 HrA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888HrEA(b,K K A(`b,AP,?A@0c8}8HqA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888HqA(8`8!}KT@<08888HqMA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKA(`g8888HpA(8`8!}K0`8|88 HpA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888HpEA(b,K KA(`b,AP,?A@0c8}8HoA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888HoA(8`8!}KT@<08888HoMA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKA(`g8888HnA(8`8!}K0`8|88 HnA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888HnEA(b,K KA(`b,AP,?A@0c8}8HmA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888HmA(8`8!}KT@<08888HmMA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKA(`g8888HlA(8`8!}K0`8|88 xHlA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888HlEA(b,K KA(`b,AP,?A@0c8}8HkA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888HkA(8`8!}KT@<08888HkMA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKA(`g8888HjA(8`8!}K0`8|88 dHjA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888HjEA(b,K KA(`b,AP,?A@0c8}8HiA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888HiA(8`8!}KT@<08888HiMA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKA(`g8888HhA(8`8!}K0`8|88 PHhA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888HhEA(b,K KA(`b,AP,?A@0c8}8HgA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888HgA(8`8!}KT@<08888HgMA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKA(`g8888HfA(8`8!}K0`8|88 @HfA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888HfEA(b,K KA(`b,AP,?A@0c8}8HeA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888HeA(8`8!}KT@<08888HeMA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKA(`g8888HdA(8`8!}K0`8|88 0HdA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888HdEA(b,K KA(`b,AP,?A@0c8}8HcA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888HcA(8`8!}KT@<08888HcMA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKA(`g8888HbA(8`8!}K0`8|88 HbA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888HbEA(b,K KA(`b,AP,?A@0c8}8HaA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888HaA(8`8!}KT@<08888HaMA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKA(`g8888H`A(8`8!}K0`8|88 H`A(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888H`EA(b,K KA(`b,AP,?A@0c8}8H_A(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888H_A(8`8!}KT@<08888H_MA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKA(`g8888H^A(8`8!}K0`8|88 H^A(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888H^EA(b,K KA(`b,AP,?A@0c8}8H]A(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888H]A(8`8!}KT@<08888H]MA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKA(`g8888H\A(8`8!}K0`8|88 H\A(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888H\EA(b,K KA(`b,AP,?A@0c8}8H[A(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888H[A(8`8!}KT@<08888H[MA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKA(`g8888HZA(8`8!}K0`8|88 HZA(,A<,O@4;#O8` 8`!KߩA(;8` 8|>@AKA(`g8|888HZEA(b,K KA(`b,AP,?A@0c8}8HYA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888HYA(8`8!}KT@<08888HYMA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKߕA(`g8888HXA(8`8!}K0`8|88 HXA(,A<,O@4;#O8` 8`!KݩA(;8` 8|>@AKA(`g8|888HXEA(b,K KA(`b,AP,?A@0c8}8HWA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888HWA(8`8!}KT@<08888HWMA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKݕA(`g8888HVA(8`8!}K޴0`8|88 HVA(,A<,O@4;#O8` 8`!K۩A(;8` 8|>@AKA(`g8|888HVEA(b,K KA(`b,AP,?A@0c8}8HUA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AK5A(`g8}888HUA(8`8!}KT@<08888HUMA(,A<,O@4;#O8` 8`!KIA(;8` 8|>@AKەA(`g8888HTA(8`8!}Kܴ0`8|88 HTA(,A<,O@4;#O8` 8`!K٩A(;8` 8|>@AKA(`g8|888HTEA(b,K A&mapUbrkFunctionsb8aA|B8 0c!aKT,#dAc8 D8KT,#dAc8 X8KT,#dAc8 p8KT,#dApc8 8KTe,#dA,88`Ap8!}N KA(`,Ax,?AA08`8!}AaN 08c8~HRA(,AD,O@<;#O8` 8```!KיA(;8` 8|?@AKA(`g8~888HR9A(8`8!}AKP@808888HRA(,AD,O@<;#O8` 8```!KA(;8` 8|>@AKEA(`g8888HQA(8`8!}AKb088 8{HQiA(,AH,O@@;#O8` 8````!KYA(;8` 8|=@AKץA(`g8{888HPA(,KK]A(`,AD,?A@08c8~HPA(,A<,O@4;#O8` 8`!KթA(;8` 8|?@AKA(`g8~888HPIA(8`8!}AK`@H08888HPA(,AD,O@<;#O8` 8```!K A(;8` 8|>@AKUA(`g8888HOA(8`8!}AKb088 p8{HOyA(,AH,O@@;#O8` 8````!KiA(;8` 8|=@AKյA(`g8{888HO A(,K0KmA(`,AD,?A@08c8~HNA(,A<,O@4;#O8` 8`!KӹA(;8` 8|?@AKA(`g8~888HNYA(8`8!}AKp@X08888HN%A(,AD,O@<;#O8` 8```!KA(;8` 8|>@AKeA(`g8888HMA(8`8!}AKb088 X8{HMA(,AH,O@@;#O8` 8````!KyA(;8` 8|=@AKA(`g8{888HMA(,K0K}A(`,AD,?A@08c8~HLA(,A<,O@4;#O8` 8`!KA(;8` 8|?@AKA(`g8~888HLiA(8`8!}AK@h08888HL5A(,AD,O@<;#O8` 8```!K)A(;8` 8|>@AKuA(`g8888HKA(8`8!}AK088 D8}HKA(,AH,O@@;#cO8` 8````!KЉA(;8` 8|<@AKA(`g8}888HK)A(,K0KA(`,AD,?A@08c8}HJA(,A<,O@4;#O8` 8`!KA(;8` 8|?@AK%A(`g8}888HJyA(8`8!}AK@x08888HJEA(,AD,O@<;#O8` 8```!K9A(;8` 8|>@AKЅA(`g8888HIA(8`8!}AK088 08hHIA(,AL,O@D;0#O8` 8```!KΙA(;8` 08|>@AKA(`g08888hHI1A(,K( A mapUidnaFunctions88|(c!qKI,#dA`c88KI,#dA@AK̥A(`g8888HEA(8`8!}K0`8|88tHEA(,A<,O@4;#O8` 8`!KʹA(;8` 8|>@AKA(`g8|888HEUA(b,KKܵA(`b,AP,?A@0c8}8HEA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AKEA(`g8}888HDA(8`8!}KT@<08888HD]A(,A<,O@4;#O8` 8`!KYA(;8` 8|>@AKʥA(`g8888HCA(8`8!}K0`8|88`HCA(,A<,O@4;#O8` 8`!KȹA(;8` 8|>@AKA(`g8|888HCUA(b,K KڵA(`b,AP,?A@0c8}8HCA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AKEA(`g8}888HBA(8`8!}KT@<08888HB]A(,A<,O@4;#O8` 8`!KYA(;8` 8|>@AKȥA(`g8888HAA(8`8!}K0`8|88PHAA(,A<,O@4;#O8` 8`!KƹA(;8` 8|>@AKA(`g8|888HAUA(b,K KصA(`b,AP,?A@0c8}8HAA(,A@,O@8;#O8` 8``!KA(;8` 8|?@AKEA(`g8}888H@A(8`8!}KT@<08888H@]A(,A<,O@4;#O8` 8`!KYA(;8` 8|>@AKƥA(`g8888H?A(8`8!}K0`8|88@AKA(`g8|888H?UA(b,K KֵA(`b,AP,?A@0c8}8H?A(,A@,O@8;#O8` 8``!KA(;8` 8|?@AKEA(`g8}888H>A(8`8!}KT@<08888H>]A(,A<,O@4;#O8` 8`!KYA(;8` 8|>@AKĥA(`g8888H=A(8`8!}K0`8|88,H=A(,A<,O@4;#O8` 8`!K¹A(;8` 8|>@AKA(`g8|888H=UA(b,K KԵA(`b,AP,?A@0c8}8H=A(,A@,O@8;#O8` 8``!KA(;8` 8|?@AKEA(`g8}888H@AK¥A(`g8888H;A(8`8!}K0`8|88H;A(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888H;UA(b,K KҵA(`b,AP,?A@0c8}8H;A(,A@,O@8;#O8` 8``!KA(;8` 8|?@AKEA(`g8}888H:A(8`8!}KT@<08888H:]A(,A<,O@4;#O8` 8`!KYA(;8` 8|>@AKA(`g8888H9A(8`8!}K0`8|88 H9A(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888H9UA(b,K KеA(`b,AP,?A@0c8}8H9A(,A@,O@8;#O8` 8``!KA(;8` 8|?@AKEA(`g8}888H8A(8`8!}KT@<08888H8]A(,A<,O@4;#O8` 8`!KYA(;8` 8|>@AKA(`g8888H7A(8`8!}K0`8|88H7A(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8|888H7UA(b,K KεA(`~b,A,>A@0c8}8H7A(,A@,O@8;#O8` 8``!KA(;8` 8|?@AKEA(`g8}888H6A(8`8!}KT@<08}888H6]A(,A,O@;#O8` 8`!KYA(;8` 8|?@AK`0`8d88H5A(,AH,O@@;00#O8` 8``!KA(;8` 8|?@AK5A(`g088d88H5A(b,KL AxmapUcalFunctionsP8`|d!q| A(DN!A((8`@ȃ,A8!}N 08}8 H4A(,A@;#O8,O8` @(``!KA(;8` 8|?@AKA(`g8}888H4UA(8`8!}N 8`8!}N A( checkIcuDataaAB|!A,A(@8apXd| DN!A(8tH8ape| EN!A(,@$8ap`d| DN!A(8t8ape| EN!A(,@,8!}AaN 8t088 H2A(#O;8,O8` @0````!KA(;8` 8|<@AKA(`g88889H2YA(8!}AaKT8t08~8H2A(#O;`8,O8` @,```!KA(;{8` 8|;@AKeA(`g8~8885H1A(K`0`8}8H1A(#O;8,O8` @(``!KA(;8` 8|>@AKA(`g8}8188H15A(K Anlsui_traceIcuVersionT>b|!, @( , @Ki,#dAKp],@XKCq,@Ke,@K9,@K,@(Ka,@KU,@Ki,A,8`88!}d N KU88`8!}d dK8`88!} dKcK?8`88!}d Kcx8!N AX initIcuUcD8,8T>8,Al99 @`9`#8yG ,*9@|```!}F@@9)98,,Ay |(,,9IA|1`N 9Ih9)9}F8,,AK @nlsui_cpy_cmdline_par8`|aA%8!Q|p8my' `!& }ґ&y' 8C & ,|ґ&@;8d;8;p;` ;C``! |fKI;|`,|,@$@ ;Z@;|1K8ap8|1K9`8!}AaN 8ap8|!K`8!}N A`nlsui_store_cmdline8`H< @nlsui_initialize|}&a`{!aK6K8b,@Wc>, @K=b,@,8!8`}aN 088H+A(#O;8,O8` @,```!KA(;8` 8|<@AKEA(`g8888 ?H+A(8`8!}aK\Ky.H%Ab,A8H8`8!|} aN 088H+A(,AD;#O8,O8` @,```!K A(;8` 8|>@AKUA(`g8888 HH*A(KH8`8!|} KH8` 08KA(08~8H*]A(#O;8,O8` @,```!KYA(;8` 8|<@AKA(`g8~888 :H)A(K C loadIcuDo|!qK48,@8!}N 08h8H)eA(#O;08,O8` @4````!KYA(;8` 08|<@AKA(`g08888hH(A(88!}N Anlsui_set7bitUnicodeb8 "B N @HunsetIcu|}&aAБ!aK`u`b.@X,@@  B8K#|}yb; AȀ,@8c|8!} AaN 80 8~H'AA(;|`#O8,O8` @,```!K9A(;8` 8|<@AKA(`g8~888$H&A(KL ,%A܀,@`K*8 K"|~yA,@$K/ic8!|} K880 8}H&YA(;|`#O8,O8` @$`!KYA(;8` 8|<@AKA(`g8}8887H%A(KhK.b,A8`|KT8P08}H%A(,AH;#O8,O8` @0````!KA(;8` 8|?@AKA(`g8}888vH%IA(8`|K808}H%!A(#O;`8,O8` @0````!KA(;{8` 8|;@AKeA(`g88}88.H$A( K8~K A(8b0(#@8~P`e8{H$}A(,O,A@;#O@48` 8```!KiA(;8` 8|=@AKA(`g8{888H$ A(KP08|8H#A(#O;8,O8` @,```!KA(;8` 8|=@AK5A(`g8|888H#A(b.@K8` 08KA(K CopenLibIcuI18n|!q,AHd(,#A0K!8b8!}(N 8!N 08d84H"A(,AD;0#O8,O8` @(0`!KA(;8` 8|?@AKA(`g088d88H"1A(bc(,#@08!}K< AcloseLibIcuI18n88D|(c!qK" ,#dA c88TK"(,#dAc88hK"0,#dAc88xK"a8,#dAc88K"=@,#dApc88K"H,#dA(88!8`}N K9A(`b,At,?AA(8`8!}N 0c8}8H aA(,A@,O@8;#O8` 8``!KYA(;8` 8|?@AKA(`g8}888HA(8`8!}KT@<08888HA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8888HUA(8`8!}K0`8|88HA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKeA(`g8|888HA(b,KKA(`b,AP,?A@0c8}8HaA(,A@,O@8;#O8` 8``!KYA(;8` 8|?@AKA(`g8}888HA(8`8!}KT@<08888HA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8888HUA(8`8!}K0`8|88HA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKeA(`g8|888HA(b,K KA(`b,AP,?A@0c8}8HaA(,A@,O@8;#O8` 8``!KYA(;8` 8|?@AKA(`g8}888HA(8`8!}KT@<08888HA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8888HUA(8`8!}K0`8|88xHA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKeA(`g8|888HA(b,K KA(`b,AP,?A@0c8}8HaA(,A@,O@8;#O8` 8``!KYA(;8` 8|?@AKA(`g8}888HA(8`8!}KT@<08888HA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8888HUA(8`8!}K0`8|88hHA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKeA(`g8|888HA(b,K KA(`b,AP,?A@0c8}8HaA(,A@,O@8;#O8` 8``!KYA(;8` 8|?@AKA(`g8}888HA(8`8!}KT@<08888HA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKA(`g8888HUA(8`8!}K0`8|88THA(,A<,O@4;#O8` 8`!KA(;8` 8|>@AKeA(`g8|888HA(b,K KA(`~b,A,>A@0c8}8HaA(,A@,O@8;#O8` 8``!KYA(;8` 8|?@AKA(`g8}888HA(8`8!}KT@<08}888HA(,A,O@;#O8` 8`!KA(;8` 8|?@AK`0`8d88DHYA(,AH,O@@;00#O8` 8``!KIA(;8` 8|?@AKA(`g088d88HA(b,KL A mapUcolFunctions8aAB|8(!acKP,#dA c88Ke,#A 4c88KIX,#dA dc88K),#Ac88K ,#Ac88K,#Ac88K`,#dA0c8,8Kh,#dA088`Ap8!}N KA(`~,A@,>AA08`8!}AaN 08c8HA(,AD,O@<;#O8` 8```!KA(;8` 8|>@AK5A(`g8888HA(8`8!}AKP@808888HUA(,A,O@;#O8` 8```!KIA(;8` 8|>@AK`b088,8{HA(,A@,O@8;#O8` 8``!KA(;8` 8|=@AK5A(`g8{888HA(,KA@$08c8HAA(,A@,O@8;#O8` 8``!K9A(;8` 8|>@AKA(`g8888HA(8`8!}AK@08888HA(,A,O@;#O8` 8```!KA(;8` 8|>@AK`b0888{HAA(,A@,O@8;#O8` 8``!K9A(;8` 8|=@AKA(`g8{888HA(,KlK=A(`~,A,>A@t08c8HA(,A@,O@8;#O8` 8``!KA(;8` 8|>@AKA(`g8888H)A(8`8!}AK@08888HA(,A,O@;#O8` 8```!KA(;8` 8|>@AK`b0888{HA(,A@,O@8;#O8` 8``!KA(;8` 8|=@AKA(`g8{888H)A(,KlKA(`~,A,>A@08c8H A(,A@,O@8;#O8` 8``!KA(;8` 8|>@AK%A(`g8888H yA(8`8!}AK@@(08888H EA(,A,O@;#O8` 8```!K9A(;8` 8|>@AK`b0888{H A(,A@,O@8;#O8` 8``!KA(;8` 8|=@AK%A(`g8{888H yA(,KlKA(`~,A,>A@08c8H 1A(,A@,O@8;#O8` 8``!K)A(;8` 8|>@AKuA(`g8888H A(8`8!}AK@x08888H A(,A,O@;#O8` 8```!KA(;8` 8|>@AK`b0888{H 1A(,A@,O@8;#O8` 8``!K)A(;8` 8|=@AKuA(`g8{888H A(,KlK-A(`~,A,>A@d08c8H A(,A@,O@8;#O8` 8``!KyA(;8` 8|>@AKA(`g8888H A(8`8!}AK@08888H A(,A,O@;#O8` 8```!KA(;8` 8|>@AK`b0888{H A(,A@,O@8;#O8` 8``!KyA(;8` 8|=@AKA(`g8{888H A(,KlK}A(`~,A,>A@08c8HA(,A@,O@8;#O8` 8``!KA(;8` 8|>@AKA(`g8888HiA(8`8!}AK0@08888H5A(,A,O@;#O8` 8```!K)A(;8` 8|>@AK`b0888{HA(,A@,O@8;#O8` 8``!KA(;8` 8|=@AKA(`g8{888HiA(,KlKA(`~,A,>A@08c8H!A(,A@,O@8;#O8` 8``!KA(;8` 8|>@AKeA(`g8888HA(8`8!}AK@h08888HA(,A,O@;#O8` 8```!KyA(;8` 8|>@AK`0888}H!A(,A@,O@8;#cO8` 8``!KA(;8` 8|<@AKeA(`g8}888HA(,Kl AmapUtransFunctionsb!|,A, AKU,#d(AXKD,@LKU,@@K,@4K=,8@$8`8!p}dN K8`8!p}dK8`d8`8!p(dN c8!pN A initIcuI18nTc>K @loadIcux`Tc>|!dA(| DN!A(( ,A 8`@8`8!}N AhisgraphUx`T~>|c!dA(| DN!A(,XcA4d| DN!A(( ,@ 8`@8`8!}N AispunctU(0+a@0(AA (F@(f8`LXBAN 8`N (9(A@AK @L isxdigitU```aA!|^!A,xAX|P|x8KlQ`888!}|!AaN 8b0`T>8{8HA(,AD;@##O8,O8` @,```!KA(;Z8` 8|:@AKA(`g8{888H9A(,@W>8{8@cHA(,AD;#CO8,O8` @,```!K A(;8` 8|>@AKUA(`g88{88HA(|P|x8Kj`888!}|K Anlsui_safe_strcat@AF60_13A( L| N A( L| N A( L| N A( L| N  A( L| N (A( L| N 0A( L| N 8A( L| N @A( L| N pA( L| N xA( L| N A( L| N A( L| N A( L| N A( L| N A( L| N H@ @ getpwnamU|`d"88a*a&!q9 8ap9)9J K`8apHuA(|y;.XA8,$@  ,$@8(0}4,$@ 88 ,$@8@(,$A;/@8}/@88`9 9*9JK1`(#8|@A,8} A$H8!}N 8`8!}N 88} 8!}HK;'@8}'@88`9 9*|9JKđ`(#8|@LFA@(,$AK;@8}@88`9 9*\9JlK=`(#8|@LFA48 ,$AK\;@8}@88`9 9*<9JLK`(#8|@LFA(0}4,$A4KL8}@;@88a a9(09 9J KÁ`(#8|@A|Ax ,$AKH A getpwnamU16Tc>H< @ getpwuidU|Tc>!HA(|~yA8.X8,$@$P,$@88b.XX`d,$@,88b.Xh ,$@88b.Xp(,$A89.X878hW@;W@9d9&9FK`8(#|@A,8.XA$8!8dP}xN 8`8!}N 88.X8!8dP}xK89.X8/8hO@;O@9d9&|9FKy`88.X(#|@LFAp(,$AK 89.X8&8hG@;G@9d9&\9FlK!`88.X(#|@LFA,h ,$AKT89.X88h?@;?@9d9&<9FLK`88.X(#|@LFAX`~dd,$A KD89.X88h7@;7@9d9&09F Ka`88.X(#|@ApAlP,$AKD A getpwuidU16||H8 @ gethostbyaddrU|!||HA(,#@8`8!p}HHI8!p}N ALgethostbyaddrU16`|aA;.X!8!Q,$@ 08|#yA88~@8s`;; 0,$A`;``;@;>@99)9J`!K`;|#@;{(``A8yA<;,@;9`988s9$A9J|#yA|*,$@x$88|~ 8,A$;; 8;`|#yAxc;^08c0,$A``!K_=`8\;{T>;{&|;Z|g,@|:At8f0|#yA|*,$@x$8|8!8~ 0}!Aa @ 8 o@9)T9JD```!K`8|#@;{( ``A<;8y@A0<;,@;9@`98 89$TA9JD|*,$@8|x$|~* ,$A`;8~8899&x9F K!`(#8|@A8~A(8! }K88~8!}( Kdb8`e`f8c88KE`8`8!}!AaK,8c ,$AK ;8~8 899&89FDK=`(# 8|@AA,$AKc8HA(|yAK AgetservbyportU16|`~`aT>!Q,,Ax8x@Lc, @H%A(xcKpA(`}xd8dKSiA(`|88:c99&9FK!`8|#@bA<xHA(8`8!}aN ccKsaA(8`8!}aKHYA(xcKoA(8c8L`99F9&Ke`|#@x8|@bLFAH!A(K@8`8!}aK8!}x0,|N 8~8t8`#8!}N 8!}N 8`8!}N Agetc_unlockedU16_errnoH @fgetcU|`!KuA(8pc8tK`~cKuA(,Aap8{,A`8a|8t,@L.KgyA(8a|888KNA`8autKR`cKY`KP`c8!}N ,t@K|p,t@Kl AfgetcU16|H< @fgetsU|``aA``}!`!Kt A(8;c8t8pp,@K`y,A8``````!x`8,@08`Aа~4p @KAK|T|8p;K ,`{A, x`AK| AgetsU16,$@ 8`N H0 @ gets_sU16,$@ 8`N Hp @ gets_sRFBH @freadU,$@ 8`N H0 @freadU16|``aA``!`|`!KniA(8`}(;p@\````!c8t8pKecd;{,x`A8<,|Vp(@X`AcKnA(|P 8!|t}!A|a|`N |;d@ T|;(;@KH`Kp,t@x8a|b8,@`.K_A(8a|888 KFI`8atccKP`KH`K AfreadU16@AF13_120($|``~aA`}!a@ `4;pT`@а4(8(,Ab08d,Ax;}B0```!, 0;Ad{;{;| @@L`4pT`@4(8(,A8d,@,A8b04p @0c8!}AaN (?8A8`8!}KȘ8`8!}AaK|=@b08A4p ApKb0HA(,A8K0d(48(,AK,AKb0HA(,AKl0d(48(,AK08`K ALgets_sRFB@AF14_10|``aAc!!!b0KjA(8(>pAd; b0KjA(p,tA,A8b04p @4c8!}!AaN (>8A8`8!}Kİ8`8!}!AaK|=@b08A4p AlK8a|888'Gg ,@H|A!aKA`8atccKL`KDI`K,A\K;b08t8pK`y,A8```!8, ADxf8,8t@L=``| @@8pb0Ke,`y@b0KhAA(p,t@,KT>9(| @ 8`N H| @( reallocbuf|``8!qKu,8`@(88H8`8!}N A copytobuffer|8c !, /,@A,,A/A;; Ax;;APH^`T`>, p@ 8!}N 8!}N ;H^y`T`>, p@KK;;@K;;K|;;Kp,//@;;KTA;;@K@@K8 A$ getLengthType|``!qH``}c,AKe|` AlAHA$8!}N 8!}N 8!}N 8!}N AgetCount|}&aA``!`T>!-a8`@K.A(,#AL8`y8K``}H\yA(,;-8pcA ,;+;`AAp;@a8pK88@,,A<@8aKNA(8`|%@A8` 8!|} !AaN K8H[YA(a@Kd@\8"8@0$@\,|@ALP@K88HZA(a@,K8"8@@@,|@A P@ K>K8HZA(a@Kc#KLA(8` 8!|!A} aN 8dNy!8`@t!axK{%!:t!; xA;.;:0.````!8ap8,%0A,%9A`8x8t8pKe,@dAt||@@a8pH`,A(apHI`,Aa8pH`8aK$aKKA(8` 8!|} K 4T~|9A0,7eA ,7E@ ,%-A ,%+@;`K(,9A$,%eA ,%E@; :`K,6AP|<(@H:`KaApH`,AK ;`K8` Aa8!|} N "C  getFloating|}&aA``!`T>`U>aA!a8`@K)uA(|yy8;A<:8}::::@KA``s8} HV`,<0pT`>,pLFAH:pa8pHa`,Aa8pp, X,xLFAH5`8!8`@!tax`!,p:/ +, -A<.:,7A0-A,0,LRBAAh@ ;@ :A, 9,/ 7A OFAa8pH`ta, 8p,A @@, +,-LFBA,He`,8} AHU`T`>, pA,8A8aa,-, A@, +LFBA, A(cK9`a.8EA,HUA(`ta|#@AW>| ,$@A@haKGA(8`0*8! |} Aa!AaN @aKAaKaK|@^aKl@^aK\A^aKL^aK@KFA(8`0*8! |} KH`,:p,A$,0@$K,0@K@KH`,pA pKt80pKh80pK\8`08! }!AaN C getNumberT`>T>T>|@A |@@ |@A8`AN 8`N 8`N @@ isBetween|}&aA``!``;;`a!a8dK``z>, ^@c#;9>NBc3, ]@c#;9>, Ad, ]@p8}3@;:|P:|t-~:bf8@b````!xp8h9,-|$A@,],%@|8|'@Az|`|#@@H@08{T{>, @;p;A|a@8pH%`,@H,;@`8`8|8!} a!AaN , A$8`8|K8`8|Kt,;APKa8pH M`,A,KlAK8paH)`K8{T{>, AK, LFAhK,@8|'@@pK,A|&@@@Kl, LB3BAh,#]A@K8`a8!|} !AaN , -@TK@Nc3, ]A0K C | getCharClass|}&aA``!``;`;@!1; a8dKi``xp.;````!ap, A;9@,A`a8pH y`,AapH`,A,@8paH E`, @,@]8!|!} AaN ,;A, @K8paH `Ka|8p@H `,AK8;9~;;@,A`K C getString|`|``a!qH5`( c48T08!}N ApFormattedInputCtor|!H`8!p}N A$FormattedInputXtor`;|}&aA!;;b !;cxd,#,%A@, %@8xdH a`,A,ax8xc,#A4``!H 1`,axA8xc,#@c8pKc8pH U`ax, ,%A@, %@8x, AcH`,Aax8xKc8pH`,Apax| @c8xKc8pH`,@c |8!} !AaN ,8@c| |K,%@,8aHI`x8a8(8xHJ`,A|d8a, xx|@8;@xHH9`Ty>(8(,9nA8,9[A ,9c@c8pH`cHQ`,@(c8T8|{*(A<|iN pc8cK,:A,@ c;,.A\8aHIe`@ xK(,<@ |KpcH`|`4T~h||K@cH`|`4T~||8T|>K. Kpc8c8Kq,:~A\c;KPpc8c89 KT`>,:A. A8aHH`K(pc8c89KT`>,:AdKc8cK8aHH5`xKpc8c89KT`>,:AKppc8c89KaT`>,:AKDpc8c8KY,:~ADc;K8pc8c89 KT`>,:AK,9F/9A,GA(,EL3LFA8aHGM`xK,9X/9[AA8@@pc8c8xKT`>,:. AKtc8pKUKcxHE`Ty>cK@|KTax, K CFormattedInput_input|```!qx(x|KA(,#@8`8!}HDccK`c|K6A(8`8!}N Areallocbuf@AF16_48N @ InputStreamCtorN @InputStreamXtor`|,|8!AH,@ 88!}N 8!8}KKQ`,|c@K A"InputStream_readSingleCharFromFile88,$A8`N 8`N @<$InputStream_readSingleCharFromString|`e`!H,@X`, A(K|``8!}N K)|`8!`}K8`8!}N AInputStream_readSingleChar|48TN @InputStream_EOF, L HN @InputStream_unreadSingleCharcN @InputStream_successfullyRead|`c!, 8ALdxe%@THA(88c8!}N 8cx8!N x8!N A"InputStream_unreadSingleChar@AF9_7A( L| N ,0/A@,F8`LX A8`N ,9,a@A,fA8`N @D isxdigitU16, ,Al, @\A`, ,LF BAH,,AN 8`,@A(AA@$8`CN 8`AN 8`?N 8`=N ,D/LA<,F/HA(AA@8`KN 8`IN 8`GN 8`EN ,N/PA(AA@8`SN 8`QN 8`ON 8`MN ,Z/jA,T/\AN 8`?N 8`@N 8`AN 8`BN 8`CN 8`DN 8`EN 8`FN 8`GN 8`HN 8`IN 8`JN 8`KN 8`LN 8`MN 8`NN 8`ON 8ޠ,!o(AbxH8c4X| *| N 8`!pN 8`!qN 8`!rN 8`!sN 8`!tN 8`!uN 8`!vN 8`!wN 8`!xN 8`!yN 8`!zN 8`!{N 8`!|N 8`!}N 8`!~N 8`!N A08(AdbxH8c4|c *|iN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8`!N 8`"N 8`#N 8`$N 8`%N 8`&N 8`'N 8`0N 8`1N 8`2N 8`3N 8`4N 8`5N 8`6N 8`7N 8`@N 8`AN 8`BN 8`CN 8`DN 8`EN 8`QN 8`SN 8`UN 8`WN 8``N 8`aN 8`bN 8`cN 8`dN 8`eN 8`fN 8`gN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`pN 8`qN 8`N 8`rN 8`sN 8`tN 8`uN 8`N 8`N 8`N 8`vN 8`wN 8`N 8`N 8`zN 8`{N 8`N 8`xN 8`yN 8`|N 8`}N 8`N 8J<8|2((AbxH8c=| *| N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N AN 8`?N 8`@N 8`AN 8`BN 8`CN 8`DN 8`EN 8`FN 8`GN 8`HN 8`IN 8`JN 8`KN 8`LN 8`MN 8`NN 8`ON 8`PN 8`QN 8`RN 8`SN 8`TN 8`UN 8`VN A 88 8T8((I+AbxH8cH|c *|iN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`xN 8`N 8`N 8`N 8`N 8`N 8` N 8` N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8`"N 8`$N 8`&N 8`(N 8`*N 8`,N 8`.N 8`IN 8`2N 8`4N 8`6N 8`9N 8`;N 8`=N 8`?N 8`AN 8`CN 8`EN 8`GN 8`JN 8`LN 8`NN 8`PN 8`RN 8`TN 8`VN 8`XN 8`ZN 8`\N 8`^N 8``N 8`bN 8`dN 8`fN 8`hN 8`jN 8`lN 8`nN 8`pN 8`rN 8`tN 8`vN 8`yN 8`{N 8`}N 8`SN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8` N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`"N 8`$N 8`&N 8`(N 8`*N 8`,N 8`.N 8`0N 8`2N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N A|bxH8c|c *|iN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N AbxH8c0|c *|iN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8`!N 8`"N 8`#N 8`$N 8`%N 8`&N 8`'N 8`(N 8`)N 8`*N 8`+N 8`,N 8`-N 8`.N 8`/N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8` N 8` N 8` N 8` N 8`N 8`N 8``N 8`bN 8`dN 8`fN 8`hN 8`jN 8`lN 8`nN 8`pN 8`rN 8`tN 8`vN 8`xN 8`zN 8`|N 8`~N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N ,,EA\A@`N 8ސ,!(AbxH8c| *| N 8`!`N 8`!aN 8`!bN 8`!cN 8`!dN 8`!eN 8`!fN 8`!gN 8`!hN 8`!iN 8`!jN 8`!kN 8`!lN 8`!mN 8`!nN 8`!oN A8(A4bxH8c|c *|iN 8`N 8`N 8`N 8`N 8`N 8` N 8` N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8`"N 8`$N 8`&N 8`(N 8`*N 8`,N 8`.N 8`0N 8`2N 8`4N 8`6N 8`8N 8`:N 8`N 8`@N 8`BN 8`DN 8`FN 8`HN 8`JN 8`LN 8`NN 8`PN 8`RN 8`TN 8`VN 8`XN 8`ZN 8`\N 8`^N 8``N 8`bN 8`dN 8`fN 8`hN 8`jN 8`lN 8`nN 8`pN 8`rN 8`tN 8`vN 8`xN 8`zN 8`|N 8`~N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8` N 8` N 8` N 8` N 8` N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`(N 8`)N 8`*N 8`+N 8`,N 8`-N 8`.N 8`/N 8`8N 8`9N 8`:N 8`;N 8`N 8`?N 8`HN 8`IN 8`JN 8`KN 8`LN 8`MN 8`YN 8`[N 8`]N 8`_N 8`hN 8`iN 8`jN 8`kN 8`lN 8`mN 8`nN 8`oN 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 8`N 80<8|2((AbxH8c'| *| N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N 8`$N ATbxH8c(h| *| N 8`!N 8`"N 8`#N 8`$N 8`%N 8`&N 8`'N 8`(N 8`)N 8`*N 8`+N 8`,N 8`-N 8`.N 8`/N 8`0N 8`1N 8`2N 8`3N 8`4N 8`5N 8`6N 8`7N 8`8N 8`9N 8`:N @ toupperU168N @InputConversionSpecCtorN @InputConversionSpecXtorTd>8`88((AN 8@,$a(@/$i,A@$,$sA,uA,$xLFAH/$XA,[L3LFA8`N @#InputConversionSpec_isValidSymbol__|!`f`T>K),@8!p}N A8InputConversionSpec_setSymbolcN @InputConversionSpec_getSymbolA( L| N A( L| N A( L| N A( L| N |`8c8!K.a`8K7U`8 K`c8!}N AXInputConversionCtor|`8c!K. `8K6`8 Kq`8!}N ALInputConversionXtor|`;a`8;;`!a8c, *@8H ;;`|2.,$*8( L+BAH |2K-e`{c|.{`/$j8,$lA,$L,hL3OFӂA H,t/$zL3OFӂAH |K6`{c|.888 8((L)Ax(@p/a,$iA$,$A,X/$[L3OFӂOAHH ,s/$u/xL3OFӂOA(;T>c8h8K%`HK`;},@8!}Hc8!}aN AInputConversion_parseA( L| N A( L| N A( L| N 8`N @tol_dummy_function|}&aA`,!`~b`|!A,,$L+Acc~KY`c,A$`!;z;ZK5`,@8NB8`,$-,A9@l8;N1,,0O@@cA ,@,'XA,'xA ,@; ',$ccA|};{) }GA!j```!,<,0AT,$9/$aAt9DAlUL>|,H@4|#@@;AH|X@LEA<|g|l8,$@|@,=A8"9A,@XxAp|@NBA@@|c |8!} !AaN @9|h |K|@NBA@K,=8`A|P|t|, A0, XA , x@8,$0@ KH 8!|} K@NK,$z,AA9DAUL>|,H@K,$Z8LD AT>|,H@Kd;; K@; K,$+@8N0;K8N0K,@@,=b8A!8!8`}N 8apc%8KA(8ap8884K`K C strtolU16|K @strtolU|}&aA`,!`~b`|!A,,$L+Acc~K`c,A$`!;z;ZK`,@8NB8`,$-,A`8@(8;,,0O@,cL0BA,&x,XLFA,@; &,$ccA|3{( }&9!I````!,<,0AT,$9/$aA09$A(U+>|+@@4|#8@;A|P@LEA|f|k8,$@|@,=ApA,@@@|c |8!} !AaN 8"8` |K,=8`A|P|t|, A0, x,XLFBA8,$0@ Kd 8!|} K\NK,$z,AA9$AU+>|+@@K,$Z8LD AT>|+@@K;; K8@4; K,,$+@䠜;K؀,@@,=b8A!8!8`}N 8apc%8KA(8ap8884K`K Ct strtoulU16|K\ @strtoulU|}&aA`,!`~b`|!A,,$L+Acc~K9`c,A$`!;z;ZK`,@8NB8`,$-,A9@l8;N1,,0O@@cA ,@,'XA,'xA ,@; ',$ccA|};{) }GA!j```!,<,0AT,$9/$aAt9DAlUL>|,H@4|#@@;AH|X@LEA<|g|l8,$@|@,=A8"9A,@XxAp|@NBA@@|c |8!} !AaN @9|h |K|@NBA@K,=8`A|P|t|, A0, XA , x@8,$0@ KH 8!|} K@NK,$z,AA9DAUL>|,H@K,$Z8LD AT>|,H@Kd;; K@; K,$+@8N0;K8N0K,@@,=b8A!8!8`}N 8apc%8KA(8ap8884Kġ`K C strtollU16|K @strtollU|}&aA`,!`~b`|!A,,$L+Acc~K`c,A$`!;z;ZK`,@8NB8`,$-,A`8@(8;,,0O@,cL0BA,&x,XLFA,@; &,$ccA|3{( }&9!I````!,<,0AT,$9/$aA09$A(U+>|+@@4|#8@;A|P@LEA|f|k8,$@|@,=ApA,@@@|c |8!} !AaN 8"8` |K,=8`A|P|t|, A0, x,XLFBA8,$0@ Kd 8!|} K\NK,$z,AA9$AU+>|+@@K,$Z8LD AT>|+@@K;; K8@4; K,,$+@䠜;K؀,@@,=b8A!8!8`}N 8apc%8KA(8ap8884K`K Ct strtoullU16|K\ @ strtoullU|`T`>b!q, ,@8cx;|yA```!Kq`|~Adx~;K `,A,~,#@8`8!}N 8`8!}N K`;|ex`K`,AK8`8!N @8c8K A RelCompare|`,aA`~;!AA(@dKA`P8(#;``#,;An@``!|c.d| DN!A(z;Z;;{K`| @@ (Ax8`,|dp@<8ap?8K`,8apAD8K}`,A08`8!}AaN 8`8!}AaK԰p@Kp ApIsVersionRequested|`,a`!AA(@;dK`;P(#;an@``!|c.d| DN!A({;{;;KI`P| @@ (Ax88ap|*<8ذpK `,@,8`8!}aN 88!|48T}K88ap`%<8ذpK`,@K A`IsLoadDbRequested|c8H8 @ RelPrint|}&a`|~`}c`!AKE,AccceKT~>,@.@0;8`(=@||dx|v|}9A88ap8K`8apKj`8ap<8K]`,#A|H8`KA(|pH A, RelPrint2Tc>|H8 @ RelPrintNewNoExit|;|p`!8a899A888Aax8a9aa8a8apc9 aHb?8|dK`cHa`d8|Ku`8|Ki`8|KY`8|(KI`a,#@|#yA, @8|8dK`8|xK`8|K`8|K`cH8|`K`8|K`8|K`8|K`8|4;,$A4````!K`8|4;|*,$@a|`yA, @8|KE`8||,$A,``!K!`8||;|*,$@, @$08! }N 8|K`cH08! }K8|xK`8|;,$A0`!Kq`8|;|*,$@K8|KI`K$8pK9`,A8|aK!`,A8|K `Kaxc89 pH]K0 A\RelPrint2NoExit|``aA`a!a9aX``w!1X@|xy@:,6@,<A0b>8v<:8uPA 8`,?8B`A,;,`A<9T,:`<A 9,9@,8A8,=AXA88,<@D8!}!AaN ~H|8!}K,<AKL@tK,=@\K,8AK8|K,<b!q?8}t, AK`K`d8}K`8}K`,<,A4`!AL88}|T>K`;,<,@8!}N 8}KQ`8`K%`d8}K9`8}LK-`Kpx8!N APrintPatchInfobcN @ RelSrcProtectbcN @ RelForCustomers||};aA`;@!c; 888!A`;@~b`!H p`c@;;((< #A,;A[H`,yA{#6d{ E|cP{ $|`|,$|òcAh;c@\;e@c``!H;Z,>;{Y;(,A(;8|(A,;(c, AA{#$8|8!}8H!AaHN :8~XbH ;Z;;;(cY,( #L#B@K A GetPatchTextsAndNumber|aK;a ```d!Q8`( !pax``8Km8!}N AlRelInfo|!, A  |8!}N H`,# AԠ,$A8cH]|c8!}N Aget_sapreleaseno|ࠣa8!a?8ap8\A(ptvK`,At8ap8lK}`,ADprXat88( ( L!Ad| DN!A(P,W80atAW(4WP*|(PW(4W:|PW8|:?|281:d| DN!A(T|>,XAxT`x,<0Tc ,9A<|8/A0|~8!}|"|N 8`8!}aN `{,A,<0,AA 81,<9A|~||KT`xA,,<IA$`T` 8/@|d||*|K|,<JA ,<R@<8/,Tc |,<Z,S|~|"@c`K #A8!}!AaN ;Xc\;((> #@KcC````!Hap`@ ;;{(cC(> #@tK܀\;{(;cC(> #@PK;|~Ac8```!Hp`@<;;(c(= #A!x8!}N X;(;c(= #@Kc8c```!Hqc;(= #A8!}K,A,K A( GetPatchLevel`,|`!a,@Ab8x$x.|"|`|,@, Abx$x.8c@|"*hKy`,APhaxKn}`xeb8xH`,A$8`8!}N 8`8!}N @b8, AKP8` 8H `,8AK ADPatchIsRelevant|`,$aA`|z!8cY8 `!Qcc@,&A<8;`cC8`!Kp`@;{;(cCd(; #A,8A@b?8K<`8 8,#AK`x, @48!}!AaN 80|e8fK`88!}!AaؘK<`18!8}x}K;{XcC\;(d(; #@ K;c#8`!Kp`@(;;{(c#(= #A,8AKЀX;{(;c#(= #@K8`,&AKP AGetPatchLevel2<18d}xN @ GetInternalKernelVersion|c8K @ GetPatchTexts|B!8F #`=J8K`8!p}N AHconvert_patch_infoTc<8,`@|8xe$|d(*N <8d8N @8GetExecutableVersionCommand|;|~aA;c!;;`8aA!!A8KH``zc|`yAh, @, AP8`(, A$``!8(`8c((, @8((8c(,&@8a (H 1`8 (8a@8K`l8a088 K E`; ;8a80>8c!08԰@K `cKUa0cKIKhe``f8a80K"`8a@8Ki]``f8a88@K"`8a0888899 H`,@ w|@w||`8|||4TA8cK`gcK: :A`j8@x`:@8a@88 `:w ap:7xdx$8 XA(8b8X@8!b(}K A db_describe|!xK, @8`8!}H4`gax8 8 8XK`8`8!}N Ah DbSlControl8`N @db_dsql28`N @db_rtab0|`!8apH A(`~H8p,cA|``889 9)9J(K`;(#H|@8A 88A``89 9)89J(K`|#@H(`A88A`89 9'H89J(K`|#@H(`A88A`9 89'X89J(KA`|#@H(`A`88AT`9 89'h89J(K`(#|@A(cA @8!0}N 8`@8!0}N 8`@8!0}N AunameUH@ @ getgrgidU|Tc>a!aH A(|yXA,8,$@<,$@88 8 ,$A\8@H8~+88;a a a;;~+899)9J`!Kq`88H|# @(@``A;8{A ,`8@899)d*Ad;;{9J|*,$@| 8x$8!8~}a|)*N ``88c88$KA`8`8!}aK8`8!}aK888~8!}|!*N ;H8~8@899&9FK`8(#@8 8|@LFA  ,$AxK8`8!}N H8~(;(8@899&9FK`(#@8|@AA,$AK8 A getgrgidU16H@ @getpassU|H!Q,#`d@t8`HA(,#AL`dbX8H868c(9`9&l9FtK`8(#|@AbX8c(@8`8!}N 8ap8@8/9`9&9FK]`8apH!A(,#AKp A getpassU16``}aA`hX|^!Q,:@;@^|H@@Dx$8|*, -@,|Kc`,A8|9#<,$:,A`@bp, A, :@Tx8`? , @;Z8^8!}AaN b0H8c8,Kƕ`<KccxKbY`,#<A<8x9,':ax@p|d,@At{, ,:L3A(b0H8c8K`88x8`:, :A8`?K|`x8xg$ax9|8*K`x8ax9K8,$@h;ZK\K^88`8!}KD888`8!}K||`y@KX AgetoptUH@ @opendirU|H!,#`dA@8ap8899&9FKm`8apHYA(8!p}N 8`H=A(8!p}N At opendirU16H@ @readdirU|!HA(,#8AdXH889&9F(8h209KQ`8(#|@A bXA8!p8c(}N 8`8!p}N A readdirU16H@ @ readdir_rU|``!a8x8pHA(,H8@T8 88Q9x9&9FK=`8,>(#@A,A(8`A8!}N b8!}cK A readdir_rU16@A( L| N PA( L| N `A( L| N A( L| N A( L| N A( L| N `L! B;c|88 !q|A | L!B@H9,,AA~,,Al@@8ap|P|t||pHm8!}N p8apHE8!}N H),~@K8"8`8!}KH~cH8!}N A K ADlocaltime_cont|`,# `!@8 | Aa8a8H9,#A\ ,a8A8 8a8H ,#A,|Aa,|@a<`ʠxdxMxgdxhM}%0Px &}h8Pxl&}*HP}kb})Z|}i"A9i |@P|(P|8P|*|*||"@x@H}icAxpH  P8!@}N ` c}iAxK8 A` c}iAKaaAccH ,@;8~H ,@88a8Hi,#A8a88HI,#AlȀa|@a|Ad88a8<``!H,#88aA|A8<KЀĀa|@aL19Aa|At88a8`!H,#88aA|A8KЀĀa|@a|@cA}'@PxpH]|cP8!@}N 8`P8!@}K8~```!;H,8}@K8~<`!;9@9)Tl | LN!A(`}~8!}KPb K`9b" 8O8z88`px89>Kx;B`z,#A|9b" 8O88`p8x8$959@9)l | LN!A(`}~8!}Kb K `9b" 8O8z88`px8$95Kx A Utf16nToUtf8nNoCC``;= aA=@=` |!9`=b8 (|< @!!9~A(@``!\; :WI*( @4;|8 @@<U8*(@Z9)$WXP*:XJ(@ 9;c;`;|)0@A<(W9| @(*A )N a9خ9)ZxYiA`~8!}!AaN a9cXs9)WZѾKa9cX9)WZѾsa9cXsKa9cX9)WZѾsa9cX9)Ka9cX9)WZѾsa9cX9)Ka9cX9)WZѾsa9cX9)Ki;B`z,#A|9b" 8O88` p8x899@9)8l | LN!A(`}~8!}Kb K`9b" 8O8z88` px89Kx(@9;;`;|)0@AK|P@@ 9;; ;`;|)0@AK|X@@ 9;; ;`;|)0@AK|`@@ 9;; ;`;|)0@AKt#|H@A 9;; ;`;|)0@AKL9;E;`;|)0@AlK0;B`z,#A|9b" 8O88`p8x899@9)l | LN!A(`}~8!}Kb KY`9b" 8O8z88`px89Kx A Utf16nToUtf8nGD``;= aA=?@ |!? 9`8 (!b|< @9~A(@````!9;9|;9@V*:((@,|+ @@~|VP*:$Uk*~֪( @:|)0@(@9`cAD(W | @}hX*A }iN a+gP9)~xkiRA\~8!}!AaN a+bsx9) VѾKa+b9)VѾs{ka+bsxKa+b9)VѾs{ka+b9)Ka+b9)VѾs{ka+b9)Ka+b9)VѾs{ka+b9)KiZ;B`z,#A|9b" 8O88` p8x8"9+9@9)8l | LN!A(`}~8!}Kb K`9b" 8O8z88` px8"9+Kx9;(9@|`@@9`|)0@AK9;9@@9`;|)0@AK9;|@9@|@@9`;|)0@AK9;9@@9`;|)0@AKl9;9@9`|@A;|)0@AKD9;9@9`|)0@AlK(Ke@avK A Utf16nToUtf8nSubstAll``;aAc|!9`b  9|< @!! c~A(@x`!c<;;|0@~HV:V|8 @A(}hX*A}iN ;I@`}'P.E})P| P@U*>AT;c;|< @A~8!}!AaN |90@@(=*y*U+}*bK[;;{K 8b`c,#A|9b" 8O88` p8x899@9)8l | LN!A(`}~8!}K$b K`8`9b8" 8pxd8` 8OKt 8b`c,#A|9b" 8O88` p8x899@9)8l | LN!A(`}~8!}K\b K`8`9b8" 8pxd8` 8OKt <;W02K <;W02 <K <;W02 <K <;W02 <KcU:02;+ <;W02K;B`z,#A|9b" 8O88`p8x89j9@9)0l | LN!A(`}~8!}Kb K`9b" 8O8z88`px89jKx A 0Utf8nToUtf16nGD|``aA;!a!e|< @A(@,'8:Ad,(Ab ;B`cc " (B b 09`!c|;0@;@~c~|7 @@D,3@t;{(;9(|< @A~8!}a!AaN ;;B`z,#A|9b" 8O88`p88x99)h9@ l| LN!A(`}~8!}aKDb K˕`9b" 8O8z88`p89xKxVw(~*A4~N ;{K<;W02~x|8z Vy:, ~.~PV>@ ,6A,P8;{(:;9(K\).|@A8*|@A;{K8+|@A;;|90@@(?8{8W78~w{;;{K z,#A|9b" 8O88` p88 x9w9)89@ l| LN!A(`}~8!}aKb K`9b" 8O8z88` p8 9wxKx<;W02~x|8z KX<;W02~x|8z Kċ<;W02~x|8z K;9W02~x|8z K;;B`z,#A|9b" 8O88` p88x99)89@ l| LN!A(`}~8!}aKLb Kȝ`9b" 8O8z88` p89xKxb ;B`cc  (" B 09z8````!c|;0@;@,~cȮ|8 @@$,3@䁇;{|< @@KVx( *A4 N ;;{Kԉ;W902,~cx|`8{ Vl:, `.PW>@ ,6A P8;{:K|}`.|`@Ad|`@A;{KX|`@A@9|,0@@=yU}~;{K;W902,~cx|`8{ K,;W902,~cx|`8{ Kĉ;W902,~cx|`8{ K;W902,~cx|`8{ Kb ;B`cc (  " 09Zp```!c|;0@;@(~c`~Vy|7 @A(**A<)N ;{|< @@K|;U02}b~[x|X8{6 , @0,6@(Vk:%X.}gX.~`P|@V>AD|`@A;{K;;|`@A0|90@@(=kylUy}l~{;{K\8~z,#A9b" 8O88`p88 x9o9)9@ l| LN!A(|ca8!|!AaN b K`9b" 8O8z88`p8 9oxKX z,#A|9b" 8O88`p88x9^9)9@ l| LN!A(`}~8!}aKb K`9b" 8O8z88`p89^xKx z,#A|9b" 8O88`p88x9J9)9@ l| LN!A(`}~8!}aKb K1`9b" 8O8z88`p89JxKx|;U02}b~[x|X8{6 K̉|;U02}b~[x|X8{6 Kĉ|;U02}b~[x|X8{6 K;kU02}b~[x|X8{6 Kz,#A9b" 8O88`p88 x99)@9@ l| LN!A(8~|ca8!}!AaN b K`9b" 8O8z88`p8 9xKL,3@d;z,#A|9b" 8O88`p88 x99)@9@ l| LN!A(`}~8!}aKb K`9b" 8O8z88`p8 9xKx A  Utf8nToUtf16nSubst`j```aAa|!aA!xpj!E|; @aA(8`@88`;;": (` `B 0:$```!cd|:@;{@ 8 8}怮|zU| @(@,,=@@ ,7A,=,A0oP;;Z:A8K 8b`{c,#A\" ;88`8O889^ l9)p9@x| LN!A(K(b Ky`8`;88" d8`8OK,=| .| @@@ 8b`{c,#A\" ;88`8O889l l9)p9@x| LN!A(Kpb K`8`;88" d8`8OK| @A;ZK,=8| @@@88b`cE,#A|" ;88`8O889} l9)p9@x| LN!A(|cP8!@}px!Kb K`8`;88" d8`8OKt|&@<@$Tx||;ZK 8b`{c,#A\" ;88` 8O889 l9)8p9@x| LN!A(Kb K`8`;88" d8` 8OKb K`8`dKV02~"KXV02;{|"(8~+xT02~:|08|+xK(;{V02~"|x|8x K;{V02~"|x|8x K;dV02~"|x|8x K,=@8b`c,#A" ;88`8O889 l9)@p9@x| LN!A(8|cP8!@}]KDb Ku`8`;88" d8`8OKp,=@8b`c,#A" ;88`8O889 l9)p9@x| LN!A(8|cP8!@}]K|b K`8`;88" d8`8OKp;{8b`c,#A\" ;88` 8O889 l9)8p9@x| LN!A(Kb K `8`;88" d8` 8OK A Utf8nToUtf16nNoCCSubst`,'|aA`;!::aAb!eA(@| @,(@l;B`ccAb 8P`!c|0@;@'~H}\V| @/5@@t;{8| @A~8!}Aa!AaN ;{hA8!8~}K(B %X*V:A4)N ;;{KL;U)02}'J~;x~88{6 ,|X./6'HPW'>@ " (A(;{P::8KB })X.|H@A" 0J|P@A;;{K9[)|H@*0@A<@$T鲾x}Ib[}';;{K z,#A|9b" 8O88` p8x8909@9)8l | LN!A(`}~8!}AKb K`9b" 8O8z88` px890Kx;U)02}'J~;x~88{6 KP;U)02}'J~;x~88{6 KĈ;U)02}'J~;x~88{6 K;U)02}'J~;x~88{6 K;z,#A|9b" 8O88` p8x899@9)8l | LN!A(`}~8!}AKb Ke`9b" 8O8z88` px89Kxcb c 8" (B b 0``!c|0@;@,~Ȯ~|V| @/5@@t;{| @@K(~g*V:A4~iN ;;{Kԉ;W902,~cx~`8zv ,}./6,PW,>L2A;{P::K .|@Ap |@@:{ |@AT=y|0@@U9 ;;{K0;W902,~cx~`8zv K@;W902,~cx~`8zv Kĉ;W902,~cx~`8zv K;W902,~cx~`8zv K A,Utf8nToUtf16nSubstAll|cN @rscph_rscpe__error(#8`@8N dN @$rscpSetHook_rscpe__error HA( L| N  PA( L| N  XA( L| N  `A( L| N  hA( L| N  pA( L| N  xA( L| N |}&aA`,#!```!ޱA(8b 8KA(|zyA8a;!88 cFKA(8|",#|xx@`,5N@D,#A(, A, A, @4;9|9@@A:````!y;9:| A:|9@@, A A|KLRB8Al::o`!8yv8:,#A0(@(:|$@`@@88ap8 KmA(,@8a}KA(K88ap8K=A(,@8aKyA(~K88ap8 K A(,@8azKEA(}K88ap8KA(,@p8a~KA(|K\;!8a88 cFKA(8,#@.~@K:K88ap|8|!K8a;!88 cFKeA(8,#@.~K<:.~K,cCKZA(,#@~,#@},#@x|,#@`88`!Z!`8!!P} |!AaN KHEA(KKH9A(KKH-A(KlKH!A(KT8a;!88 cFKUA(8,#@b~.AK:KcCKYA(8`!`!Z8!!P|} K48`!`8!!P}AaN b 8{0KA(8{KA(~8{KA(}8{]KA(|8`!`8!!P}aN C GetSAPFileVersionConvertSCCSID_w failedCommand Line ConversionEnvironment ConversionIBMnlsui1.cIBMfdopenU16IBcmodeIBMAX_MODE_LNMAX_NDIGITSexcvtU16IBMwstringmkdirU16IBMcpathIBMAX_PATH_LNchmodU16IBMgetcwdU16IBchdirU16IBMaccessU16IBstrfctimeU16IBMcformatMAX_FORMATSTR_LNIBMstrftimeU16MAX_TIMESTR_LNIwteststrIBMsystemU16IBcstringMAX_COMMAND_LNIEntering cleanup_putenv_table(). Allocated table lines = %i IBEntries after shrinking: %i IBMEnlarging table to %i IputenvU16IBcptrIBMlengetenvU16IBcnameIBMAX_ENV_LNIremoveU16IBrenameU16IBcfromIBctofopenU16IBMopenU16dlerrorU16Ierr_msgUIBMMAX_ERROR_LNIBMdlsymU16IBMMAX_SYM_LNIdlopenU16IBSAPCASTRAW2UCCHKI0nlsui_cast_raw2ucIBfileCIBMAX_FILENAME_LNERROR: Casting an odd adress to SAP_UTF16* in file %s, line %d nlsui_alloc_mbsarIBConvertSCCSID_wwstrIBMinlenIBttynameU16IwttynameIBMmkstempU16IpatternCIBMpatternU16IsrcLenU16+1mktempU16IBtempnamU16IrcIcprefixMAX_PREFIX_LNIBcdirIBMsetlocaleU16IBMc_inlocMAX_LOCALE_LNIBw_outlocIBMstrerrorU16werrorICould not convert error no. %d3 to UTF-16 charactersIBMctimeU16IBMubufferasctimeU16Ictime_rU16Iasctime_rU16IBMunlinkU16IBstatvfsU16IrmdirU16IBMpopenU16IBMccommandIBMctypeIB: IcreatU16IBMutimeU16IBMmkfifoU16IBchownU16IBMreadlinkU16wbufIBMwsizeIBsymlinkU16Icpath1Icpath2IlinkU16rexecU16IBMccmdIBMchostIBMAX_HOSTNAME_LNMAX_USER_NAME_LNIBMcpassIBMAX_PASSWD_LNIB*ahostIgethostnameU16IwnameIBlengthIfreopenU16Ifopen64U16@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_str.c#3 $ SAP@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_str.c#3 $ SAPIBM IB~@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_aux.c#5 $ SAP@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_aux.c#5 $ SAPnonelowmediumhighIBM --- Unicode interface ------ End of message --------- Unicode interface [%.60s line %d] pid = %d time = %ld:ICmdline : %s IBM IB --- Unicode interface ------ End of message ---dbgAlignCheckStringU16(): ERROR: The following string is unaligned: IBMIBM IBError in format string at or near 'Y': Error in format string at or near 'Y': Function %.64s : Array %.32s length %.32s is too small. : malloc : Out of memory.I--- Unicode interface ------ End of message ------I %02xIB %04xIBCharacters previously read: encountered invalid UTF-8I (but where?)IBAll bytes to processIBMNLSUI_FILE_TRACEI0%.10s "%s%s" (fileno 0x%x)IInternal errorIU16 trace level set to u16_aux.cIBM IBU16 trace level set to @(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_put.c#3 $ SAP@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_put.c#3 $ SAPIB @(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_OutStr.c#4 $ SAP@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_OutStr.c#4 $ SAP@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_FldWd.c#2 $ SAP@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_FldWd.c#2 $ SAPIBM IB@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_OutCS.c#3 $ SAP@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_OutCS.c#3 $ SAP(null)(nil)vvfprintfU16IBMu16_OutCS.cIBM B:QnٺzfpH=c)\Buffer overflow (floating point output)@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_OutCon.c#3 $ SAP@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_OutCon.c#3 $ SAPIB0u16_OutCon.c4.0.1libicuuc40.alibicudata40.alibicui18n40.aIBNLSUI_INIT_TRACE_LEVELInoneIBMlowmediumIhighIBMNLSUI_INIT_TRACE_LEVEL set to 'high'IBM [%s %d] pid = %d Inlsui0.cIBMEnvironment variable reset: %sstrcat error: Source array %s has length %u. After concatenation ... IB... it would exceed the destination array %s (length %u). It will be truncated.Unnecessary call of nlsui_setPath(), LIBPATH will not be changed.IBLIBPATHCould not allocate space for %u bytesIBLIBPATH=I:Environment variable set: %sIBCould not open %s shared library %sError message: "%s"Library handle for %s: %pIBSearching for libicui18n in environment path LIBPATHIBMLIBPATH is set to %s IBICULoaded ICU i18n lib: %s from environment pathIBSearching for libicui18n in additional path %sILoaded ICU I18n lib: %sCould not open the ICU i18n librarydlsym %s failed with error: %sIFunction pointer for %s: %pucal_getAvailable_4_0IBsymbol load "%s" failedError Message: %sIBucal_countAvailable_4_0ucal_open_4_0IBucal_close_4_0Iucal_set_4_0IBMucal_setDate_4_0IBMucal_get_4_0IBMucal_getMillis_4_0Iucal_setMillis_4_0Iutrans_openU_4_0IBMutrans_openInverse_4_0Iutrans_close_4_0IBMutrans_getUnicodeID_4_0utrans_setFilter_4_0IBMutrans_countAvailableIDs_4_0IBMutrans_openIDs_4_0Iutrans_transUChars_4_0Iucol_open_4_0IBucol_strcoll_4_0IBMucol_close_4_0Iucol_setStrength_4_0IBMucol_getSortKey_4_0ucol_getLocaleByType_4_0IBMu_versionToString_4_0IBu_errorName_4_0u_getVersion_4_0IBMu_getUnicodeVersion_4_0u_charType_4_0Iu_getIntPropertyValue_4_0IBu_charDirection_4_0u_getPropertyEnum_4_0IBu_getPropertyValueName_4_0Iu_setMemoryFunctions_4_0IBMu_init_4_0Iu_cleanup_4_0IBuenum_unext_4_0uenum_count_4_0u_strToUpper_4_0IBMCould not close shared library handle %pIBMError message: %sIBlibicui18n40.a is closed againIProgram is compiled with ICU version %sRequired ICU library files: %s %s %sIBMSearching for libicuuc in environment path LIBPATHILoaded ICU common lib: %sIBSearching for libicuuc in additional path %sIBMCould not open the ICU common library. The following files must be in the path described by the environment variable "LIBPATH": %s, %s, %sLIBPATH is currently set to %s Compiled with ICU version %sIBMRunning with ICU version %sICU uses Unicode version %suidna_toASCII_4_0IBuidna_toUnicode_4_0uidna_IDNToASCII_4_0IBMuidna_IDNToUnicode_4_0Iuidna_compare_4_0IBubrk_open_4_0IBubrk_openRules_4_0Iubrk_safeClone_4_0Iubrk_close_4_0Iubrk_setText_4_0IBMubrk_current_4_0IBMubrk_next_4_0IBubrk_previous_4_0IBubrk_first_4_0Iubrk_last_4_0IBubrk_preceding_4_0Iubrk_following_4_0Iubrk_getAvailable_4_0IBubrk_countAvailable_4_0ubrk_isBoundary_4_0ubrk_getRuleStatus_4_0Iubrk_getLocaleByType_4_0IBMuloc_getDefault_4_0unorm_normalize_4_0unorm_quickCheck_4_0IBMunorm_quickCheckWithOptions_4_0unorm_isNormalized_4_0Iunorm_isNormalizedWithOptions_4_0IBunorm_next_4_0Iunorm_previous_4_0Iunorm_concatenate_4_0IBunorm_compare_4_0IBu_shapeArabic_4_0IBubidi_open_4_0Iubidi_close_4_0ubidi_setInverse_4_0IBMubidi_setPara_4_0IBubidi_writeReordered_4_0IBMubidi_getLogicalMap_4_0ubidi_getVisualMap_4_0Iubidi_getLevelAt_4_0IBMu_charMirror_4_0IBMICU data shared lib does not behave correctly.Iu_isalnum_4_0IBu_isalpha_4_0IBu_iscntrl_4_0IBu_islower_4_0IBu_isprint_4_0IBu_isspace_4_0IBu_isupper_4_0IBu_toupper_4_0IBu_tolower_4_0IBUnicode ctype functions are replaced with 7bit fallback functionsIBNLSUI_7BIT_FALLBACKTerminating. You may set the environment variable NLSUI_7BIT_FALLBACK to run the program without the ICU libraries in an emergency mode.IEnvironment variable NLSUI_7BIT_FALLBACK is set.IBMNLSUI_TRACE_LEVELIBloadIcuDo() is calledIBICU shared libraries are not loadednlsui_set7bitUnicode() is calledIBMIBM ERROR: Non 7-bit character U+%04X encountered in function toupperU This is not supported in 7-bit mode. IBERROR: Non 7-bit character U+%04X encountered in function tolowerU ERROR: Non 7-bit character U+%04X encountered in function isupperU ERROR: Non 7-bit character U+%04X encountered in function isspaceU ERROR: Non 7-bit character U+%04X encountered in function isprintU ERROR: Non 7-bit character U+%04X encountered in function islowerU ERROR: Non 7-bit character U+%04X encountered in function iscntrlU ERROR: Non 7-bit character U+%04X encountered in function isalphaU ERROR: Non 7-bit character U+%04X encountered in function isalnumU Size: %9lu %8lu.%lu MB Att: %-2ld Owner: %s Perms: %o - %sIB /SAP_ES2_%2.2d_%3.3dIBSAP_ES file: %s removed IBSAP_ES file: %s remove failed **** - errno = %d (%s) /usr/sapIBopendirUIB./usr/sap/%s_%2.2d_..IB%s/%sSAP_ESIBstatUSAP_ES file: %s IBremovedremove failed **** - errno = %d (%s)IBclosedirIB%s/%s/dataIB Number of SAP_ES files found:.............: %4d Number of SAP_ES files removed:...........: %4d ------IBrunning IB--------IB---------------------------------------------------------- ---- Clear IPC-Objects of Sap-System %2d %s%s---- IB---- Show IPC-Objects of Sap-System %2d %s%s----- IBCLEANIPCIBcleanipcIBremoveIBfullIBjavaIBabapIBversionShow/Cleanup SAP-IPC-Objects V2.3, 94/01/20 IB=========================================== +-------------------------------------------------+ IB| To inhibit destruction of valid SAP-IPC-Objects | IB| during shutdown, this program requires now | IB| special options for removing IPC-Objects. | IBSAPSYSTEM%d, Error: No Sap-System-Nr specified. all-1IB%d, Error: Illegal Sap-System-Nr: %s Running SAP-Systems (Nr)...: IB %d IBOsKey: %8d 0x%08x %s Shared MemoryKey: %-2ld SemaphoreEvent FlagIBMessage QueueDP/WP Event FlagsSCSA Shared MemoryIBSCSA SemaphoreIB Summary of Shared Memory Sizes..: %8lu.%lu MB Number of IPC-Objects...........: %4d IBNumber of removed IPC-Objects...: %4d IBSummary of SAP Shared Memory....: %8lu.%lu MB IBipcs -mb > r%s %d%s %d %s %s %s %s %lu%-65s %8lu.%lu MB IBSummary of all Shared Memory....: %8lu.%lu MB (%s) may be incomplete when not in superuser modenlsui2.cIBMgetpwnamU16c_nameIMAX_PWNAME_LNIBpw_name_bufpw_passwd_bufIBMAX_PWPASSWD_LNpw_gecos_bufIBMMAX_PWGECOS_LNIpw_dir_bufIMAX_PWDIR_LNIBMpw_shell_bufIBMMAX_PWSHELL_LNIxdr_stringU16IBchbufferIBMstr_sz1+1IBwch_bufferIstr_sz2+1IB*spgetservbyportU16IBMs_proto_charIBMMAX_SERVPROTONAME_LNIBMs_name_bufIMAX_SERVNAME_LN&s_aliases_buf[i * MAX_SERVNAME_LN]s_proto_bufMAX_ALIASESs_aliases_bufIBgetservbynameU16IBMcnameIBcprotoIgethostbynameU16IBMh_name_bufIMAX_HOSTNAME_LN&h_aliases_buf[i*MAX_HOSTNAME_LN]IBMAX_IPADDR_LNIBh_lengthIBMMAX_ADDRESSESIBh_addr_list_bufh_aliases_bufIBgetpwuidU16@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_get.c#4 $ SAP@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_get.c#4 $ SAPIBInvalid UTF-8 encountered by freadU16 (fileno 0x%x)u16_get.cIBInvalid UTF-8 encountered by getsU16IBM IBMInvalid UTF-8 encountered by getInvalid UTF-8 encountered by fgetsU16 (fileno 0x%x)Invalid UTF-8 encountered by fgetcU16 (fileno 0x%x)@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_InStrm.c#2 $ SAP@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_InStrm.c#2 $ SAPIBM @(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_cty.c#2 $ SAP@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_cty.c#2 $ SAPv,?@@??/`?#m^##=@/ % 3_??======?????_>/P>`w<???_? ?@@??/`?#m^##=@/ % 0_??======?????_>/P`>`w???_? UUԪN$1)Q-*UR@) ?/*ꪪ???@?D0???????9m^9;9=ÿ=`=@`==/_%;3?_?======???????G?~???]?_0UUUUUUUUUT+UUUJUUUUUUUUT@TUUUUUUUUPUUUUUUUU?UUUUUUUUUUUUUUUUUUUUUUUUUUUUU??>'8 =P@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_InCon.c#2 $ SAP@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_InCon.c#2 $ SAPIBu16_InCon.c@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_tol.c#2 $ SAP@(#) $Id: //bas/720_REL/src/i18n/sapu16/u16_tol.c#2 $ SAPIBIllegal base %d in strtolU16IBMu16_tol.hIBR/3ALLInconsistencies for <tt:call transformation> IISELECT with FOR ALL ENTRIES and dynamic WHERE condition IIPresentation buffer improvementsCurrency fields with manipulated input maskXBNF: Adjusted some identifier rulesSuppressing input history for the SAP GUIVMC: Checking for null in JARM data condensingGUI status versionVMC/JACSupport for SAP releases 703 and 730 with 720 kernelABAP-SYCH: Missing LOD for friend classVMC: NullPointerException during SAT data collectionVMC: timezone update 2009gSHO: improve analysing toolsDebugging VMC application, modifying String objectsBuffer synchronizationDo not raise exceptions CX_XSDANY_* in 7.10 and 7.11C14N ProbelmSWINCF: Tray selection using print controls TRY01 and TRY0OPEN_DATASET_NO_AUTHORITY in cl_abap_file_utilitiesMemory leak in XML readerCall touchload in movenametab step for transportsCentral note for WS Security on 7.20Fix dump in spool WP for access method ESAP GUI for HTML - No server resize w/o resizable objectACI qualify_tokens with list-tokenized inputCoverage Analyzer deactivates, causes RUNT_INTERNAL_ERRORPatch collection for ABAP code generation KW 18/2009VMC: Improved session error handlingABAP compiler error messagesVMC: Configuring memory isolationVMC: Trace Lock Information (CVM)VMC: Trace Lock Information (kernel)VMC: enable forced VMC resetVMC: Windows Memory Management improvementsJCO VMC connection attributesFill lang, user, client on connection attributesVMC: No more negative millis for cache eviction periodCorrect touchload in movenametabSE30: Check for trace request in case of ITS and rollinCST Patch Collection 20 2009CST Patch Collection 18 2009Corrections for the statement MOVE EXACTJ2EE failures in the vfprintf hook functionCCMS Agent Patch Collection 2009/2SE30/SAT: Runtime for HTTP & RFC server applications wrongChanged database times in the kernel statisticTp file deployment does not workEnhanced error handling during file system deploymentRC 84 during deployment stepSAPCAR terminates with read errorSAPCAR: option -hSAPCAR: signed archivesCCMS Patch Collection 2009/3CCMS Patch Collection 2009/4IBM i: SAPOSCOL and CCMS agents in dialog modeCCMS Patch Collection 2010/1CCMS Patch Collection 2010/2CCMS agent and kernel: patches 2010CCMS agent and kernel: patches 2011/1CCMS agent and kernel patchesLess tracesSNC enabling for sapxpgError 1006 when executing external commandExternal command: Output is incorrectTimeout when executing external commandSAPCPE: CorrectionsIBM i: set correct user and mode flags in instance exedirIBM i: SAPCPE does not set all file authorizationsIBM i: SAPCPE must access DIR_CT_RUN to load itselfIBM i: sapcpe claims: fixsapown not foundIBM i: avoid unnecessary run of sapcpe if dirs are in syncChange Cleanup / Exit orderIBM i: check whether a child process has already endedIBM i: Automatic consistency check of MDM installationFix issue with special XML characters in valuesError analysis during system registration using sldregSolaris: wrong runpath causes executables to hangInternal Error with Function module FTP_SERVER_TO_R3400 Bad Request Error with latest version of SAPHTTPSAPFTP: DB2 z/OS fast load: Upload from Windows NamedPipeSAPFTP: MPUT with more than 2500 filesServer messages could not be displayed during exit by sapfSAPFTP unicode charcter conversion in FTP_R3_TO_SERVERSapSSLReloadCred fix, SSLv3/TLSv1.0 configurability, GOSTError in SAPHTTP when setting up SSL connectionMultithreaded SAPHTTPProblems during Mass check-in with latest version of SAPHTSAPHTTP fails in SSL scenarioError during Redirection with SAPHTTPSAPHTTP breaks HTTP ProtocolSAPHTTP does not work correctly in the redirect scenarioCST Patch Collection 42 2009CST Patch Collection 47 2009Error for setsockopt on Windows Vista/2k8SAProuter: NiBufIClose: called while buffer filled -wSAProuter crashes with segmentation fault and core dumpSAProuter version number updatePermission denied when renaming SAProuter logSAProuter dev_rout spammed with error and log entriesThe RFC-libray uses the portlib UUIDs on AIXMemeory usage of an RFC connection increases steadilyRfcLastErrorEx doesn't return detailed error infomationNew RFC load balancing procedureError with Started RFC Server after Applying RFC LIB PatchRFC connections are not closedMeaningless error message when SAPLOGON_ID does not existRFC Lib vulnerable to buffer-overflow attacksUpload from clipboard into ALV grid causes short dumpLIBRFC32.dll failed to get some environment variablesComputers with non-english characters in hostnameRFC Lib: error RFCIO_ERROR_NOMEM caused by memory leakRFC: signal 11 while processing class-based exceptionsSeparate program and broken Asian multi-byte characterCode pages 1146 and 1155 in 'F5-memory'Sapiconv - a tool for converting the encoding of filesWrong deletion date in spool requestImprovements in rslgcoll and rslgsendProblems with the writing of the central SyslogSyslog message: Broken pipe in Module rslgsend(027)An instance cannot write into the central syslogProblems with the writing of the central Syslog,Hom./Het.System Copy for SAP NetWeaver based on Kernel 7.2DB2-z/OS: Support for hybrid DbSlDB2-z/OS: R3ldctl, R3load, avoid libvers err, fix fld winR3loadctl: page compression for SQL 2008Missing space in ddlora.tpl after negcprNewDB: R3szchk for NewDBDB6: Numeric value out of rangeR3szchk on MaxDB: Unknown columnname 'OWNER'MaxDB Correction owner -> schemanameR3szchk on MaxDB: Correction Wrong SizesR3zchk: Correction: ERROR: database ada not supportedDB2-z/OS: R3ta partition splitterBetter Performence on MaxDBR3ta: MaxDB Correction core dump part in on partitionMaxDB R3ta: Correction error for table with / in nameR3ta: No R3ta_hints.txt needed onR3ta on MaxDB Correction core dumpsMaxDB R3ta: wrong value in range conditionDB2-z/OS: R3ta support MINVALUE, support hybrid DbSlR3ta: MaxDB invalid range conditionsR3ta: MaxDB solaris bus error on cluster tablesR3ta MaxDB: Error tablename longer with 10 sig R3loadMaxDB: R3ta: Correction SQL Err-5010 for splittDB6: use COUNT_BIG to count number of rowsSmall corrections in undelivered source codeSwitch Buffer: Memory class changedSAP Spool: direct access of fields of DB table TSP03AIncorrect Sash position in dynpro splitterSXML: xop reader hashed key accessPerformance Improvements [itabs, component handling]Avoid access of view D010SINF in shadow upgradeFix shared memory issues / start failures after deploymentADABASR3load export aborts with signal 11ORACLECore dump in dbacockpitMSSQLNTStored procedure delivers no rows in EXEC SQL or ADBCIndividual solution without a specific SAP Note.DB6DB6: unexpected token INLINE LENGTHDB6: configurable cc_release attribute for UR cursorsDB6: cobra enhancements part 2XACT_ABORT OFF on DbSl-connectDbsl procedure to get datasourceExplain external for MaxDB BridgeMSSQL: deliver dbmssslib_oledb with SAPEXEDB.SARDbSl: SQL errors erroneously translated to 'duplicate key'VMC: Automatic module integration asapVMC: improve trace for heap mismatchVMC: improve handling of allocation of interned stringsWidth of loop containers after field modificationST-Debugger missing loops in tt:loopAvoid DBIF_REPO_PART_NOT_FOUNDVMC: VM is attached to two work processes at the same timePerformance improvements for ABAP MOVETrace output of memory blocksSapstartsrv: hang in environment setup on UnixVMC Status informationXSLT: multiple keys with same nameTrace error message SetProperty 90 removedCorrections for ITS-PluginVMC: New profile parameter vmcj/sgc_after_importCST Patch Collection 24 2009SHO: improve error handlingError in kernel-function: db_rbam_tobj_off [authraut.c]XBNF: Revert database table roleUse subdirectories for ADS jobs720 ACI CorrectionsDownport of Code Completion Performance ImprovementsTime out when processing table control(Re)Store connection info required for getAttributes()Tune PXA preload for installation/upgrade scenariosFunction sequence error in SELECT $XSQLNo RFC authorization for RPE_REQUEST [authraut.c]Refresh inside ITSStartup Framework 7.20 patch collection PC-10VMC: check for read only Java objectsUSRPWDHISTORY entry created with non-UTC timestampVMC: send notification to all VMs of an instanceWorkprocess restart when using accessibility guiFixed anchor handling in find_next( )DummySapgui scripting: check sapgui versionVMC: Autojava jobs lost after custom configurationVMC: put intern strings and type ids into shared data areaPXA: correct swapping of objects during mass invalidationPotential memory leak in function rfctr_init_handleMemory Inspector update XSapstartsrv: Incomplete environment on UnixError if mpi/buffer_size <> 64 KBFixed [:print:] for non-latin charsDB6: substitution of aliases in optguidelinesODBC DBSL parameter connect_timeout has no effectDBSL error in connection with DBACOCKPITABAP_ASSERT at WRITE <field in boxed component>RSPO_CACHE_CONTROL sets SY-MSGNO to spaceRuntime monitor check for int. table typesWrong mapping of IP address to host nameRemove wrong error trace for TA SPADLob Handle Structures with incorret alignmentEnhancements for SAP GUIIncorrect processing of required entry fieldsInvalid destructor call after forkAccess violation in ReportDeadlock for UPSERTFix memory corruption caused by convertNengo2GregDateABAP Runtime Analysis: Shortdump during ExportImproper use of the thousands separator, DecfloatRare cases of memory corruption in getcwdU16Secinfo: Fields USER and PWD are not checkedRTTI and namespacesTable logging: Avoid duplicate log recordsVocabulary for Unicode conversion: faster hash functionHash Tables with Data References in the Table KeyISeries: TCP/IP Interface Enumeration ImprovementReduce priority of secondary key messagesPatchlevel not visible in traceDB400DB4: LIB_DBSL independent from os4apilib.soDB4: Longer SQL Statement Text with LiteralsDB4: DBSL Direct Drive for DB2 for IBM i (DB2/400)DB4: Longer SQL Statement Text with Literals - Unicode FixDB4: Longer SQL Statement Text with Literals - sans DDLDB4: Longer SQL Statement Text with Literals - Endian FixPrinting ADS documents with SAPGOF printerAGI correct signature of method SetControlFocusStrange values in table TSPJSTATABAP: using built-in replace to set a C-FieldTPDA: Data Explorer/object display and private attributesErrorhandling for 'data begin of'ABAP Types N, D and T in the COMPUTE EXACT statementSemaphore 51 in SM50 caused by ABAP runtime analysisWhere-Use-List for DBTAB~FIELDIslamic and Farsi date format missing in DKK modeMemory leak in Simple Transformation engineRemove assertions in jit compiler of VMC.Invalid GUI input dataSapstartsrv: Unix exit handler deadlockCST Patch Collection 29 2009RFCGUI_UNEXPECTED_DATA in connection with Inter Modus CommError trace: invalid roll count mode ... dymain.cCheck gui input dataWrite SAP TRACE for RFC call to SAPGUI tooRFC inprocess communication: free RFC connection dataDeletion of obsolete OTR textsAllow blanks in TIME columnsAvoid error ' invalid interface parameter'Printing of Arabic-Indic digitsAPI_GETFILEINFO (APICODE 42) Parameter 'FILE' is too shortImprovemnts to PXA preload for Installations & UpgradeWrong enhancement category for 'type boxed'Creation of temporary license after hardware changeRegistered regex classes for Mem InspectorStartup Framework 7.20 supportability enhancementsConnection from Client to VMC brokes suddenlyITS Up/Down: long lines truncated during clipboard importIncreasing handle consumption (multithreaded)Wrong table name in ST05 traceDB2DB2-z/OS: PLAN_TABLE & DSN_STATEMNT_TABLE for v9.1Rabax CONVERSION_NOT_ONE_TO_ONEVMC: error in ThVmcCheckVmPoolABAP debugger: fix for displaying invalid referencesVMC: Additional Trace FlagsVMC: improved shared pool handlingSCOV: Branch Coverage feature not availableTROYMICR: Incorrect print output with 701/711/720 kernelRTTI and namenspaces IISHO: transactional locks and memory leak in RABAXMemory Inspector update XVISynchronize spool job reactivationVMC: metadata objects for many cache objectsVMC: cleanup VM Container frameworkDB6: login timeout for secondary connectionsUpdate statistics for MaxDB BridgeNew method for generating HW license keys on IBM System zGui data > 30KBSFW: Wrong Switch StateSXML: dev-trace for codepage conversion errorsRuntime errors BOXED_BAD_REF and/or SYSTEM_RUDI_INVALIDMemory Inspector updateVMC does not start on Windows platformsRFC: Conversions to UTF8 return errorFix dump in WP when creating ADS spool requestCL_ACI_EVAL query cache roll area allocationFixed assert in ACI node traversalACI mse: [sub][rsyn] Should '+' at the end of idFix overlapping char's when printing on device type SWINCFVMC: do not enable JIT during shared garbage collectionSSL Client Certificate forwardingGUI input data > 30kEnable rolling of debugger masterPreserve open cursors when switching DB connectionsFaster table buffer reorganizationSyntax error at 'like STRUCT1-STRUCT2-COMP'ABAP Debugger: search in internal tables does not workPrevent tp start via gateway for security reasonsActivation of enhancements during importDB4: Parallel / Online ALTER TABLE - Support SQL LOCKDB4: DB Connect Method to Virtual Host based on InterfaceGenerated objects not package-checked as dynamicDialog box dimension must not exceed display sizeITS: support of server header in HTTP responseRuntime error VALUE_LIMIT_EXCEEDEDJNI API for SAP_CMCANCELExternal explain returns more than one rowCheck for external update statistics changedPossibility to disable UPSERT statementsDB6: revalidate views in status active=NDB6: create index with 9.7 and virtual tablesDB2-z/OS: planned failback doesn't workAutoresize at first screen of new external modeDynamic Assign and Boxed ComponentsIllegal objects in package check and where-use-listDB6: optimized performance for R3load with DEF_CRTPXA: fix slow startup due to conflict with package checkATRA: avoid unnecessary calls to semaphore 51Dynamic LOOP WHERE illegal rudi typeTPDA: send info if no session availableESC/Page and ESC/Page-Color support as PDLHandling of empty passwords during logon via SAPGUI/DIAGDon't start transaction TPDA_STARTDynamic CREATE DATA with boxed component type namesUsage environment invalidated during LIMU ADIR importClass constructor at Create Object with parametersThread dump ends up in coreSpecial describe handling on MaxDB systemtablesJCo cuts off last field of a structure or tableVMC: Replacing & in T100 messagesLong runtime for ASSERT statementIntegrated ITS: wgateUrl(~secure="on")Error in compilation of IF_RSR_MDX_STATEMENTUnaligned list columns containing symbol sym-ellipsisSyntax Warnings for Keys of Internal TablesOpenSQL: Syntax warning correctedInt. err. in syntax check for INSERT ... iNTO TABLE ME->ITMemory Inspector update (Dominator tree)Copy of generated BW objects within an upgradeVMC: Calculation of gross time of long SATsWrong column postion in where-use-listWrong handling of deep syntax errorsST: Comparision with INT1/INT2 and integer constantsCST Patchcollection 39 2009Atra: Initialization of Extended Passport componentsAvoid STACK_BLOCK_ILLEGAL_STATE in case of CHECKCore dump in the function fill_agg_record()SUBMIT and string parameterEXPORT TO DBUF: realloc strategy improvedEmpty menu entriesAvoid ABAP stack overflowIncomplete ABAP list when scrolling horizontallyUnjustified warnings for SELECT INTO CORRESPONDING FIELDSTPDA: ignore break-point statement in batch processingDynamic offset in LOOP-WHERE-ClauseBatch-Input: core in dybisetdefwsize()VMC: Replacing & in T100 messages revisitedStartup Framework patch collection PC-11Upgrade problem in phase TP_ACTION_CP2STABPrevent tp start via gateway (compatibility change)DB6: timeout for CREATE/DROP TRIGGERDbsl procedure to update datasource informationError handling for external update statistics changedRFC Communication is very slowST: Wrong pop state during exceptionChecking input data of SAP GUIVMC: 'G' values in VMMonitorEmpty menu optionsAAB/RTM : ATC loggingSUBMIT and xstring parameterSHO: displacement also for admin dataAPI for BIDI support in OTFSCOV: API not availableError when adding hints to SELECT SINGLE FOR UPDATEDB2-z/OS: db2radm bind with jdbc temp licenseDB2-z/OS: db2jcllib print version infoFix wrong size of tablsizeEXPORT TO DBUF (SAAB) and deep tablesInconsistent text splitting at broken multibytesLine style DOUBLE for OTF printer driversI8HPLJ4: Hebrew TrueType-Font problem on old LaserJetGW: Hanging JCo connectionsJCoServer does not set initialized flag on structure parametersUse MaxDB SDK 7.8.01.04 (only AIX)Avoid unnecessary DB calls to table DDNTTShifted search result in listsITS: relative MIME URLDCK kernel 702 in 701/70 generat. error(dynamic badi call)Fixed Error RUNT_INTERNAL_ERROR on bgRFC executionBgRFC Units are stopping without detailed error informationWorkaround for lost HTTP threads after overload & restartITS HTML Viewer: Display errors when reloading HTML controITS: backslash escaping in SearchHelp (non-unicode)Deleting DD objects in type T transportsConnect with special xuser keyService-Request supportError in spooljob statusVMC: cassifying of syslog messagesABAP-PH: Wrong Type AssociationGetenvU can cause crashes in multithreaded applicationsAdmin pages of ICM or SAP Web Dispatcher display source coITS Textedit: selection problemsVMC: move kerberos classes out of rt.jarVMC: signal 11 in CVMscpScanAllPeersDB6: patch collection 10/09VMC: wrong lenth of abapVmStates during copyingSyntax check: add scComponentEval for itab key accessITS: fixed usage of GetByUniqueName() on non-unique namesWrong root of UUIDsMessage: invalid textpool timestamp for gui statusVMC: PRIV-Flag handlingVMC: critical low shared memoryArithmetic: IA64 and subnormal numbersABAP Debugger: fix for display of read-only internal tableITS: includeframe for subscreens with invisible elementsSapcontrol throws error in function StartServiceMemory Inspector update (invalid entries in snapshot XML)More traces when code page converter reconnects to databasIcman crash with HTTP POST requests and processing timeoutEXPORT TO ITAB: avoid filling alignment gapFX: binary XML performance optimizationFX: check prefix collisionWrong Unicode characters in Binary XML writerITS: includetabstrip() fixedUnderflow when converting Decfloat to BCD must not give -0Content Filter does not match on contentCore while trace level increasedCTU: no default size at end of BDC-data with NOBIENDMemory Inspector update XXEnable reference user in old debuggerPXA: RUNT_INTERNAL_ERROR due to lock state inconsistencyABAP: STORAGE_FREE_FAILED in syntax-checkC-call dy_get_modal_levelCore in kernel function CuaSearchTextInvalid dialogbox dimension 0 rowsVMC: blank-padded string error during SAT DB importMultiple GUI login possible in case of license popupEmpty SY-ZONLO value with active HTTP Security SessionsITS Up/Down: method GET_SCREENSHOT of frontend servicesImprovements to ABAP Program Buffer & Coverage AnalyzerDBSL accesses the master databaseDbSlControl(DBSL_CMD_DBNAME_GET): RFC-'Fingerprint'DB6: Potentially unnoticed rollback during array operationOpenSQL: Syntax warning levelACI correctionsTrueType Font does not print Cyrillic on PCL-5Printing ADS documents with Kyocera printersADBC queries returning XSTRING valuesGui status: empty dynamic textsITS: fixed deadlock in file interface (namespaces in templGarbage characters in syslog message ECFTrace for ALV grid viewDynamic LOOP WHERE: no cache use for RTTC typesSyslog message: 001 units locked by semaphore 009VMC: java.lang.Exception: No sessionWSSEC: Support SHA2-family for Message DigestIMPORT: avoid interpreting data as controlsSapstartsrv: CrashOpen SQL: SY-DBCNT handling refinedAuth check on parameter transactions in call transactionSSL Server Endpoint Identification by SubjectAltNameReduced contention for AS Java request load balancingSapstartsrv: Syslog updateLOOP ... WHERE ... with unsuitable datatypesNew screen load versionCount of records for bulk insert optimizedCheck NLS_LENGTH_SEMANTICSPage limitation for printing does not workError in Watchpoints Handling with 'Net TPDA'Non-ASCII-7bit characters in distinguished namesGui status and initial dynamic textsSET CURSOR in LEFT SCROLL-BOUNDARY noneffectiveRFC Data Trace for Large Conversion BuffersUnwanted SYSLOG entry when touching PXA objectFRAC function for type P without decimal placesVMC: Tracking down CPT file write error during SATVMC: added sort criteria of JARM resultsDynamic LOOP WHERE combination BETWEEN vs BOXEDSPA/GPA memory destroyedPXA: fix reload of typeloadsObjectServices: SYSTEM-CALL PRIVATE ATTRIBUTES and GCThai tone marks issue with Cascading FontsSapstartsrv: ReadLogFile performance optimizationTransport of Japanese report texts to non-Unicode systemsDBSL (MSS): Maximum buffer size for array operationsTable logging: Omit trace entry on string truncationAvoid core dump in external debuggingInitial dynamic texts in GUI statusDuplicate entries in default context menuNO-DISPLAY: avoid SLIN messages for extendable structsVMC: Download of JARM resultsStartup Framework 7.20 patch collection PC-12Sapstartsrv: New JAVA system typeSapstartsrv: J2EEControlCluster double stack bug$DBCC() displays binary data as hex. string without 0xDB2-z/OS: Fast load: support for ROWFORMAT optionDB2-z/OS: db2radm fast load USS fifo cleanupXSLT: format-number accuracyWork processes waiting at semaphore 12 for c.p.convert.objUser Switch and Authorisation for RFC DestinationPackage-check system settings inconsistently appliedVMC: Patches for zero administration memory managementPOSS inputstring bug with options 16-18SCOV: remove coverage data export on shutdownVMC: Incomplete request gross times in SAT dataFixed ##pragma/dot handlingCST Patch Collection 52 2009TPDA: debugger window not closedDB6: client affinity supportMake FQHN for MS-Host possiblePrinter Job Status via SNMP for Interactive FormsDialogboxes and docker control widthDBIF_RSQL_INVALID_RSQL for VARC field in dyn. SELECT listSending big dynpros via RFCR3trans deletes too much Dynprotexts (D020T)R3load give false warning:Cannot get memory to read NameTaDbm commands support addedAvoid unnecessary connect attemptsHandling of unconfirmed transportsMicrosoft security patchMemory leak in dbmssslib.dllST05: Truncate too long SQL statementsVMC: corrupt Java copy-only closuresOTF: allow OS/2 table ver.4 for TTFPrevent negative spool numbersDocker width in dialog boxesWEB SAPConsole login to systems > 7.00 not possibleMissing dependencies: encaps. packages, interfaces w. ACLABAP Debugger: search in itabs with secondary keyFormat string error message from snprintfU16PXA: avoid multiple PXA_DESTROYED for a single incidentVMC: reduce number of Java objects for cache region adminUsage environment invalidated during re-try invalidationA program will not startVMC: detected illegal field access per JNI callVMC: No handler found for remote functionICM: Improve Message Server failover detectionProblems opening .pdf files in Web browserEsmon terminates if option '-f' is usedHTTP chunked requests failed with ICM and WebdispatcherTabstrip scrolling does not workTransport of Japanese report texts from unicode to asciiCorrect transport of LIMU DOCU TTDB4: DBSL Direct Drive September 2009 PatchDB6: CLI TraceRefreshInterval during parallel importDialog work process crashes for spool displayITSmobile: CustomProperty on dynpro exported to contextVMC: File rename error during DB import of SAT dataUnexpected truncation in atollU on Windows NTWhere-Use-List for SUBMIT (F)OTF TrueType font download bug for PSNo tracing if softcancel during a traceMS: don't expose informations for ext. clientsITS: error while reading empty template from LocalRepositoVMC: data source for opensqlVMC: jco metadata storageWrong Sort Order After INSERT LINES OFSHO autm. area constructor: debugging out of HTTP sessionNew storage option for VMC JCo repository: vmlocal_storageAvoid senseless connect attempts (2)Long status STOP for batch processImprove internal message checkMissing GUI status MENUSYST leads to core dumpsCoredump after webgui callAdapt VMC makeDpCreateCommEntry: FtInsert in developer tracefilesMissing server informationsBad dispatchingAutomatically deactivating the reverse name lookupCore in gatewayLocks are retained due to network instabilitiesSystem log GJ0ENQU: improvements of trace outputABAP: Function with named param as meth-call paramSecurity note: Bypassing security in reginfo & secinfoENQUE: Standalone enqueue server terminatesENQUE: Connection terminations in standalone enqueue serveSecondary connection to Oracle DBImproved counter initialisation for RFC-GUIDAvoid abortion with signal 6Avoid truncation of Japanese and Chinese report textsDB2-z/OS: Upgrade/EHPI phase CNV_LIST failsFailure of a redirect from http to https protocolStartup Framework 7.20 patch collection PC-13Simple Transformations and Pseudo componentsABAP: error in && operatorSapstartsrv: ReadLogFile correctionsTable control configurationHPL2 list driver: allow bold fontSyntax warning for DATE/TIME fields in CONVERT TIME STAMPVMC: timezone update 2010bContext menu: missing entriesEnhancement of Service Request InterfaceIncorrect paper selection in ESC/Page and ESC/Page-ColorSE30/SAT: Measurement could not be endedProfile parameter for esid session displacementICM: Avoid many epp trace entries at ICM trace level 1Performance improvement for stateless JCo callsUnicode conversion: Transparent container rows for repairDB2-z/OS: db2radm fix load and chain testLDAP segmentation fault RC=6R3trans aborts with: Input Buffer ... bytes too shortAS Java loses HTTP worker threads after failed restClass Methods missing after 'downtime optimized' SP importDBIF_RSQL_SQL_ERROR during package compilation on DB6Correct statistic data of nametab bufferLAST_SHORTDUMP in post mortem TPDASELECT: Warnings for ORDER BY, GROUP BY and aggregate fctsCheck screen loadCorrection concerning SBUF_RESET_BUFFERED_TABLEImproved trace outputs regarding time inconsistenciesInvalid dialog box height of 0 linesMS: fix loop counter for MS_NIPARAMLdap_rfc trace can contain plaintext passwordCorrection upgrade phase INDQUE_CHKDELETE itab FROM expression WHERE table_line = computationSupport of SBA2 for large listsICF trace: Meaningless characters in the trace file dev_wpImproved algorithm for sap-contextid generationConnect and execute function in DBSLSystem doesn't start:: invalid screen loadR3load: MaxDB Correction core dumpDB6: CLI LOAD for tables with LOB columnsABAP-SYCH: Core dump when resolving TABLE_LINEImproved UUID generation on SUN-OSIncorrect include dependencies for CREATE OBJECTAvoid deadlock with failing GENERATE DYNPROHide toolbarCorrect handling of epp imported handleSapstartsrv: New generic logifle format parserNew profile parameter system/uuid and system/descriptionVisual width of pushbuttons noneffectiveDB2 - z/OS: Accounting for Web ServicesCorrupt Package Check Environment LoadsJobs remain active - Reason for wait RFC/ARFCVMC: SYSSTP shared type pool lockBugfix: ST syntax check and ST debuggerVMC: use initial static buffer for shared closure creationRSPOSNMPSPO_KRN: ABAP short dump during upgrade to 701/702Use of maximal alignment in DB Interface (ntab and sync)ICM: Increase maximum number of threadsUnset value of <system/type> breaks CCMS in Java ASPassword logon via RFC not possible despite SNCSYACLCCMS errors in the ABAP instance log files during initialiUdpdate debugging with new ABAP debuggerVMC: JARM NullPointerException due to missing endRequestEmpty transaction parameters for checkboxesVMC: cleanup unused slots in EM2Horizontal screen resize of controlsABAP: STRING_BAD_REF in SCAN with enhancementUnicode conversion of huge cluster recordsDB6: patch collection 03/10Define your own command buffersizeSE51 screen testingVMC: new address for jvm.dll on NTia64MDM5.5 Support on ABAP Kernel 720VMC: SM53 CacheCleanupJob Config display fixedDynamic LOOP WHERE handling of quoted literalsICM 7.02 Double Stack: Fix HTTP 500 Internal ErrorWeb Dispatcher returns 404 Not Found for ITS pagesAS Java 7.x direct node addressingICM Patch Collection (7.20)Correction type check for internal tablesWARN Shm 48 in Pool 40Tree-based Contextmenu after popup is not shownTooltips missing on some searchhelp buttonsInheriting of CONSTRUCTOREscape check for OpenSQLPool estimation is not activeVMC: Error handling in region config updateDump in spool work process when status of job is queriedABAP Shared Objects: Optimize access to ModeLockRefCCMS agent cannot display the working directoryDB2-z/OS: Support for NT fast loadVMC VM contention on SYSSIT Shared Intern TableWSSEC: Support SHA2-family for Digest and HMACSUBMIT and long stringsAPI for BIDI support: correction for non-UnicodeGui status: modified dynamic textsAgg. functions in dyn. selectlist and FAE conditionVMC: thread dump enhancement in case of failed lock requesFixed source hash for test codingSupport for subsequent releaseICM, Web Disp: fix icm/security_log MAXSIZEKBAvoid duplicate key error on table DD43LAvoid deadlock on table REPOSRCDeletions on DB2/6000 with sli=trueImplicit transport of TVDIR and TVIMF entriesPerformance during import of report variantsAvoid error in function tp_search_buffer_entryITS: drag and drop not working on big-endian systemsInterface for focus frameMax string length for screen elementsALV Gridview Control: color in header cellsCorrect handling of start transaction in connect stringItab Patch Collection 2010-01GUI focus after dialog stepSignal 11 for HTTPS status code > 400Signal 11 for HTTPS generating status code > 400Startup Framework 7.20 patch collection PC-14Core dump on detach_commit of shared internal tablesKernel methods for file path checkITS: Selection of tree node or item is not maintainedTablecontrol: button relates to wrong lineSUMG: Table in repair because of unprecise UMGSTAT-DICCNTDB2-z/OS: fast load with support for NTCorrection concerning R3trans exportMaximum string lengthABAP-SYCH: Core dump for VALUE of nested structuresGC does not know faked stack entry for XSLT method callInterface for setting a focus frame - ClearFocusFrame()VMC: error during accessing shared closuresCode page converter using wrong substitution characterITSmobile: fixed ZEBRA flag for mobile ALV GRIDITS: fixed upload of a zero-length fileWeb Dispatcher: Fix handling of port changesScreen generation: container layout checkRSTG chain defective, return code -03Cross reference patch collectionSapstartsrv: Hanging child processes on WindowsITS: Tree control displays too many columnsSYSTEM_CORE_DUMPED during roll outField RFCIPADDR returned by RFC_SYSTEM_INFO is emptyFixed possible coredump using RFC with basXML compressionIncorrect window size after exiting an internal sessionLogin/update_logon_timestamp doesn't work for initial pwSeperate ClearControlFocus from ClearFocusPerformance of WAIT UNTIL statementTransaction SM04: State has the value 4Invalid random license expiration dateSapcpuinfo corrections for PowerVMGateway shutdownSM53: OpenSQL error when importing SAT dataNiIWrite error on AIXSapstartsrv: Enhanced security configuration optionsITS/urgui: fixed NBSP in teaxtareaTooltips for EA fields on selectionscreensPreventing outgoing NI connectionsAccess Control List und Traffic ControlDB4: DBSLDirectDrive (XDN) Default on IBM i 7.1 and Win2K8DB2-z/OS: Fix of DSSIZE handlingDB4: Wrong library list in shadow systemSetuser replaced by EXECUTE ASUnknown primary keyMSSQL: avoid sql error 0Support of a code page conversion from EUC to UTF-8ABAP: support for method chain in non functional contextMemory leakTransaction SE51: Testing screensSapstartsrv: New hostagent webmethods for SMDASapstartsrv: ReadLogFile Unix style text file fixReadonly dropdown can't be opened by keyboardALV grid view focus is always setRl3oad: MaxDB Correction Maxdb Error -7500MaxDB R3load: Correction endless loop with MaxDB >= 7.9.03R3load: Correction Invalid indicator value for DECIMALMaxDB R3load: Fastloader core dumpIMC: no message dispatchingShared object: CLAD reallocationGUI status : Changing dynamic textsRUNT_INTERNAL_ERROR at GET REFERENCEDiag: correct trace componentIMPORT CREATE DATADisable cache if content-length missingAvoid buffer inconsistencies after DB_SET_ISOLATION_LEVELR3load fills binary alignment gaps in containers with x'00Performance with huge CLOBsImproved overflow error handlingMake and release information for MaxDB DBSLConnection table correctedABAP-PH: GEN_INTERNAL_ERROR for RANGE TypesProblem with single character string of type RFCTYPE_STRINMLICHECK problems prevent creation of temporary licensesDefault focusVMC: Avoiding X_VMC_CMS_LOCKASXML: extensibility for reference typesCALE: unjustified error FACTORY_CALENDAR_NOT_FOUNDSTRING_TO_FIELDS for name-value pair lists longer than 4 KBAvoid system_core_dump in dyShowLastRabaxPXA: optimizing swap behaviourTrivial joblogsDEV_TP_XXXX files in /tmpR3load: Correction 2 Invalid indicator value for DECIMALITS: Hidden nodes are displayed in tree controlITS: Certain items missing in the tree controlALV Gridview Control: cell contents cut by ...ITS: Tree items invisible after assignment to another coluMemory Leak when writing Memory SnapshotMax. framesize in dynpro is 255 columnsWarning for unsuitable data types in LOOP ... WHERE ...Appl. server shutdown after SAP GUI connection terminatesLarge bitmap data in OTF driverSecurity-Downport (ACL) for message serverSecurity-Downport (ACL) for gatewayDB6: FOR ALL ENTRIES: rsdb/max_union_blocking_factorOperation Mode Switch does not workSupport of SMDA as system typeHTTP login failsToDo Priority for Warnings W094 and W095DB6: patch collection 05/10DB2 z/OS: Exploit CLI time out parameterDB4: Multiconnect from AIX Application Servers to IBM iAvoid error 'Input Buffer ... bytes too short'Missing ABAP programs after 'inactive Import'Deprecations in new SQL Server Release: no sp_bindefaultITS: fixed stale mutex locks in terminated sessionsALV Gridview Control: transparent titleImprovements to authorization traceSE30: Record mismatch due to message within loopSupport switch of system languageF4 help is covered by other popupsALV Gridview Control: colored input fieldsMissing dependency by Simple TransformationsABAP Debugger: Security audit log for debugger activitiesGui-status: quickinfos starting with @VMC: improved shared intern String lockingMemory Inspector update (AIX)Exception text of class based exceptions is corruptedError in CL_HTTP_UTILITY=>ESCAPE_JAVASCRIPT in non-unicodeCore dumps, LOBPREFETCH failsDB6: return original schema in shadow systemTp terminates in function 'tp_search_buffer_entry'Fixed missing CP '*.**' matchSapstartsrv: Support SAP JVM heap and stack dumpTables as returning parameters not deleted in excep. caseAccess Control List and Traffic ControlVMC: change path of memory mapped files on SolarisSecurity note: Bypassing sec_info without reg_infoMemory Inspector update (AIX) IIInvalid water mark -10 at level 1Bad order of initializationsCore in DiagSetIMCProperties()Improved error handling in xRFCITS: ~sources param is limited to 255 chars lengthITS: Some items in tree control are cloned by mistakeDB2-z/OS: DB2 V10Secure sourcing of user and client in bgRFC user switchFont API for Unicode Printing Enhancement (UPE)Access Control Listen und Traffic Control (II)Signal 11 occurs after EgAlloc() failsSecurity note: CANCEL registered programsCase sensitive maintainance of sec- and reg_infoSoft shutdown hangs after logoutVMC: reduce memory consumption in shared closure view (SM5Enabling downport of Security Session ManagementStrange characters in hitlist after search in ABAP listContradicting status messages in the joblogFix page counter for empty pagesNo more pool 10 for Standalone EnqueueInappropriate handling of a broken surrogate pairABAP: Return technical database PPMS informationDBSL handling of too many fetch requestsReport synchronization during parallel importUnicode Conversion of Change Documents: parameter checksITSmobile: improved SearchHelp dialogIllegal characters for fastpathITS: Content-Type is always application/octet-streamVMC JARM: NullPointerException in ReadyRequestListITS: empty template is not an errorSapstartsrv: CreateSnapshot missing data collector on UnixSapstartsrv: New SDEFAULT protection enabled by accidentEnhancements for SAP GUI 11ITS: LS picture control set invisibleITS UpDown: printing in frontend servicesITS: Click on tree control header remains unnoticedITS Calendar: dump in calendar popup F4 search helpITS: fixed Content-Type parsing on FirefoxTechnical database PPMS informationDB6: literals for decimal columns of value 0DB2-z/OS: DB2 V10 cli timeoutITS: sapxjutil string length is limited to 4096 symbolsVMC SM53: Order of JARM sort criteriaSPO: core dump when device type does not existSFW: Missing invalidation of switch bufferGW: Gateway terminates in live operationError trace: invalid EventId ...DB2-z/OS: DB2 V10 shadow upgradeDB2-z/OS: DB2 V10 SSID in connection table not setABAP: DATA BEGIN OF COMMON PART in enhancement-implVMC SM53: Cache regions sorted in cache status listsMirrored icons in rtl environmentSupportbit VARINFO_CONTAINER and message 00118Focus offset does not fit to codepageACI: Random token positions / change of internal policyVMC: error in ES2 layerGw/acl_mode versus gw/reg_no_conn_infoRemove 64G limit for exetended memory in map modelITS: fixed backslash escaping in Search Help dialogOptimize deletion of ADS spool jobsSystem cannot be startedMSSQL: database fingerprintR3trans import with parallel processesTransport between Unicode systems and non-Unicode systemsMaxDB R3load: Negativ list for primary keySaplikey parameters and output adapted to saplicenseDB2-z/OS: DB2 V10 stoproc output paddingALV Gridview Control: dropdown fields missingIMPORT: ignore irrelevant alignmentsNT: new start address for ES windowNew supportbit VARINFO_CONTAINER_1Bad HTTP responseShared Objects: STRING_BAD_REFRuntime error LIST_ILLEGAL_PAGE at scrollingDeadlock or timeout when accessing table TBTCOGw/reg_no_conn_info settingsBetter compression of dynpro sources in Unicode systemsSupport for release 7.31DB2-z/OS: db2radm support for hybrid DbSlDB6: tolerate client deletes on virtual tablesDB2-z/OS: DB2 V10 call_sub_function (stub -> v9)ADBC metadata correction for datatype bigintDB2 z/OS: return technical database nameDB2 z/OS: export shared libsRm Shared Objects: STRING_BAD_REFUnicode Printing Enhancement (UPE)ITS: Tree icons are surrounded by unexpected blue bordersITS: system info area in statusbar is misaligned in FirefoITS: Accessibility improvements for the tree controlITS: automatically escape context fields in outputExploitable buffer overflow in SAP Kernel functionsDB2 z/OS: callback for DbSl to get ABAP caller infoMissing interface for raw dynpro fieldsGui status: separator linesDB2 z/OS: correction to corr.meas. 01200615320002290541201BgRFC Outbound-Destination gesperrtConversion to pregenerated UR-sourcesA11y improvement: label for okcodeAdd support for ~webgui_message_in_popupVscan_rfc doesn't reinit VSA instances during reload retryLow performance esp. with long SQL statementsDB2-z/OS: db2radm fix db2i with secondary connectionsTBX: limit maximum table buffer displacement durationOpenSQL : SELECT COUNT(*) and dynamic GROUP BYVMC: preparation for updated C/C++ compilerICM, Web Dispatcher: Avoid blocking SSL callsGEN_ILLEGAL_SWITCH: DREF->BOX-COMP+OFFSET(LENGTH)RFC improved error message when using VMC with RFCAutomatic deletion of trivial joblogsFixed error when using inprocess RFCs from ABAP to JAVADBLOG_GET_DIRECTORYPXA: avoid short dump LOAD_UNKNOWN_SUBPOOL in RTTICorrecting buffer overflow in ABAP system callSynchronization after importing deletions of includesDB4: XDN Keep Alive / DBSL da_cache_size = 100 for XDNDB2 z/OS: DB2 V10DB2 z/OS: core dump after checking CLI client typeTp execdbscript -- operations are not executed on databaseDB2 z/OS: DB2 10: wrong OID in V9 branchXSRF Implementation Part IWrong reader/writer instance in ABAP method call from STSuppress SU22 trace while debuggingXPath parameter binding / number() on hpia64Cross Site Request Forgery ProtectionALV Gridview: scrolled to wrong position in Bidi/RTL modeChild processes of a work process remain as zombie processDB4: HA healthcheckMSSQL: Unicode literals and standalone toolsDB2 z/OS: DB2 10Additional combobox value appears after selectionTablecontrol configuration: message 00 124 as warningIntensify-display for listboxesMaximum string length adaptations in agiForging SSO Tickets (2)Inputfield misses searchhelp iconF4 help is covered by other dialog boxesABAP-PH: Wrong type alias after structure extensionIBM i: Set up correct JAVA environment after log onIBM i: Fix minor CONFIGJVM CMD interface issuesDB2 z/OS: wrong schema length (dbdddb2.c)DB2 z/OS: call sequence, client check, SQLGetPositionWDB2 z/OS: DB2 10 nuc build errorDB2 z/OS: DB2 10 connect.ini with logical hostnameSAT: Corrections for runtime analysis (ABAP)Checkboxes cannot be accessed by keyboardCorrect unsharing of int.tables with secondary keysLess trace data when opening a database connectionIBM i: Fix JAVA_HOME for non Java systemsIBM i: cannot restore correctly jvm kernel directoryRow counter limit set to 65535DB2 z/OS: DB2 10:client version;FAT client;CLI_INSTALL_PATDB2 z/OS: DB2 10 Vx: stats; duprecDB2 z/OS: DB2 10 V9: contabDB2 z/OS: Hybrid V9: remove SQLGetPositionDB2 z/OS: Hybrid V10: SQL_ATTR_INTERLEAVED_PUTDATADB2 z/OS: Hybrid V10: memory leak; memory+prepare statsStartup Framework patch for wily under AIX'DATA_REF->COMP in Syntax-Error-Message'Enable logging of IP addresses only in security audit logBADI Filter does not exist syntax error message erroneousMissing robustness in AGI parserExtension Type 'CS'Core dump due to overwritten memory during generationVMC: Cloning a cache regionTablecontrol: cell content is not displayedIBM i:Updating software packages before installation/upgraDB2-z/OS: R3load export: Do not set DBINTERNAL on V10DB2-z/OS: db2radm set singletaskABAP sessions are displaced for applications in the portalHTTP URL rewriting does not work with qsreplace optionTable PAK_INTF does not exist in nametabTable PAK_INTF does not exist in nametab IIStartup Framework 7.20 - patches and patch collectionsWily can't be loaded with SAP JVM 6 under AIXCopy function non-UC SAPOSCOL to UC kernel last charP4 communication breaks when used with SSLSapstartsrv: SLD registration fix for SCS instanceDefault-cursor handling includes tablecontrolGenerating sec_info reg_infoTablecontrol scrollbar hidden by local sapgui scrollbarICM HTTP modification handler fixesXML-Decryption with EncryptedKey outside of EncryptedDataEnable popups in accessibility modeUnlocked screen during java applet confuses userDisplay errors during start of virus scan adapter in traceCore in gwrdDeleting ADS spool requests takes a long timeAvoid core dump when changing parameter values in RZ11ST: Core if calling a method with table returning parameteError trace for reading Unicode files and OS environmentResize issue in PBAG generationRuntime error DDIC_TYPELENG_INCONSISTENT with APPENDsDB2-z/OS: Fix wrong INLINE token in V9 DDLR3LOAD AND PARALLEL DIRECT PATH FOR TABLES WITH LOB COLUMNDB2-z/OS: SQL-Fehler -104: unexpected token '+'DB2 z/OS: Hybride DbSl: client awarenessUnwanted Oracle tracingNo logoff-popup if sapgui starts in workplaceITS: F4 IAC resultlist shows only 100 entriesSCOV: new functionality for Releae 7.03/7.31Correct nametab buffer statisticsMemory Inspector update (TRC)Avoid change of input field through F4 helpGW: avoid syslog Q0REnterprise Search Kernel ModulesABAP in Eclipse: ACI Kernel ChangesOpenSQL : Internal error in SELECT with JOIN in SubqueryAIX: Memory leak with SHM_SEGSDB2-z/OS: db2radm fix DBTEST 13 and 14DB2 z/OS: hybrid DbSl: logical hostname within accountingSend wp type to the databaseDB6: SQLE_CLIENT_INFO_USERID including quotesR3load: MaxDB error: lock collision for splitting tablProblem for SELECT with subqueries and JOIN(2)MOVE C to F: SPACE after trailing sign requiredConfiguration changed for multiple systemsST: Incorrect type check during dynamic invocationSESSION_ID parameter for ATRA_INITIMPORT w/ conversion: allow shorter C target fieldFixed null termination for CONVERT TEXTCOLLECT on internal tables with non-unique secondary keysNiHsLGetNodeAddr: to get '' failed in <x>ms (tl=5000ms)No F4-value on dialog box with listRemove SNMP job status functionality for SAPWINTable-Control: side effects of default cursor handlingRFC improved error check in UUID conversionAsserts in ST compilerITS: Error when clicking on some cells of tree controlITS: RFC table processing is improved for offset gapsR3load: potential dataloss on import of partitioned tablesMaxDB R3load: missing default value on decfloat coDB2-z/OS: R3load SIGSEGV in dbtype() when creating tableBetter handling of DSQL limitsDB6: revalidation of view failedDB2 z/OS: hybrid DbSl: SQLGetPositionW + DbSlLobGetPieceSaplikey in sap installationHanging COMM_ADM entries with status 'Clear SNC'ENQU: Incorrect data in enqueue requestsUnusually high number of dialog steps in transaction ST03ENQU: Incorrect replication information from enqueue serveEnqueue server uses a lot of CPU, even though it is idleRelease_ca_blk: I (5-34175) tried to rel a free blkCross Site Request Forgery Protection for ITSFunction keys do not workITS: Status line is wrapped in FirefoxSuppress class base exceptions in 731Lsgui: show title in the group, even if emptyALV Gridview Control: radiobuttons aligned erroneousITS: fixed separator in ~sources (space, tab, comma, semi)DB2-z/OS: ICNV: DROP TRIGGER is ignoredDB2 z/OS: hybrid DbSl Vx: piecewise fetch + row countDB6: DROP INDEX on virtual table ignoredWork process blocked in state 'On Hold ADM'No system messages for RFC-GUI usersOverflow of communication tableSapstartsrv: Missing SOAP array crashEstimated size of Shared Memory Pool 40 too smallJs-error on popups with dockersNo searchhelp on AIXEmpty tabstrip pagesNew call types for TREX statistic recordsCPIC programs < 21H cant connect to gateway >= 7.00GW: allow work process to reconnectCompatibility of SAP URL mangling with Open Data ProtocolDpRqNormalHandle: overwrite valid next_rqContext menu request leads to an application errorITS: fixed long context fields names (30) transport to ABARUDI_INVALID during local var name determinationIXML: infinite loop in method if_ixml_parser->parse_eventTrace level increases spontaneouslyWARNING => PfICompleteRec: OS CPU-time problemPotential directory traversals in applicationsDB4: Workprocess Hangs after Cancel on Slow SystemsIBM i: improved error handling for CONFIGJVMIBM i: Determining the patch level of an ILE programDB4: XDN Virtual Host SupportSQL Server version 11 supportTp import: error 13 on MAIN IMPORTPopups can not be movedUser examination of HTTP request in ABAP 700 / Kernel 720Enqueue Bug FixesExtended RFC Authorization ConceptTable control: Side effects of default cursor handlingSecurity note: Communication to a system without logon datTable control: Cell contents are not displayedBuffer synchronisation: avoid DB access in critical pathRandom 3D borders around pictures of image controlsICM could hang after high loadRuntime error STRING_BAD_REF for shared objectsSapgui-shortcut and transaction parametersESCAPE_JAVASCRIPT switches ( and ) in %2028 and %2029Gui standard toolbarLocal scrollbar covers table control scrollbarHanging enqueue processes; duplicate releases of WPCA blocCorrection of SAP kernel make environment for LinuxGUI standard toolbarInterface for access to vkeys of toolbarCorrections for Splitter / Docking ControlST: new options stripWS and preserveWSITS: Content of tree controls with one column remains hiddITS: Resized columns in tree control do not maintain widthSuppressing system log entries for plug-in timeoutIMPORT: ALIGNMENT_MISMATCH instead of WRONG_COMP_LENGITS: Error when clicking some columns in the tree controlAdded kernelname/releaseDB2 z/OS: hybrid DbSl: 1514236+error handling with chaininDB2 z/OS: heterogeneous secondary connectionsDB6: FOR ALL ENTRIES statement with SUBSTITUTE LITERALSALV Gridview: cell text colorBad memory managment inside the gatewayCall of method w/ returning parameter from STs terminatesCut print command with access method L and EDB2-z/OS: db2jcllib core on file putDB2-z/OS: db2radm fix BIND during UpgradeDump SYSTEM_CORE_DUMPED after error in applic. statisticError receiving data when opening a new sessionITS: Error handling in SAP GUI for HTMLITS: fixed boolean parameters in OMRT controlsRFC failure during upgrade when using HMACST: GC during tt:loop and tt:apply/tt:call transformationContext menu deletes table selectionConversion exits with very long fieldsFix core during generating dynpros with long table namesSapstartsrv: synchronous service uninstallUpdated WHERE clause grammar descriptionUrgui: LSX renderers for debuggingWrong width of AgiTableColumnIBM i: *CURLIB is not set for work processes if iASP is usDB2 z/OS: hybrid DbSl Vx: client build levelDB2-z/OS: SQL -204 in dev trace when LOB table is droppedRemove default for DDLOG identity columnTables ########## in SM50 or SM66IBM i: SAPIPCFG Doesn't return MAC address *IPS InterfacesABAP Debugger: short dump in Memory Object ExplorerAll work processes are used by the user SAPSYSCCMS: Missing user and client in alerts for aborted jobsCall SYSTEM with ping does not work from ABAPDB2-z/OS: Fast load, avoid DELETE FROM with LOAD REPLACEDB2-z/OS: UPG: Shadow tables special inliningEnabling XSRF protection feature for SAP GUI for HTMLHTTP port for dual-stack system points to J2EE engineLOCL printing with access method G failsMissing statistic recordsOpenSQL: Wrong syntax error in WHERE condition with rangePartitioning update tablesProblems starting web applications via HTML GUI controlProblems with HTTP multipart messagesR3trans Patch collection 10/2010Response time is too long due to incorrect roll wait timeSTAT: Incorrect value for COMMIT time in SM50STAT: Not all statistics records existSYSTEM_CORE_DUMPED with PfAReadAStatRecSearch help is hiddenSupport for Unicode NormalizationSwitch handling for rbam_is_active()Tablecontrol: button wider than column widthUnexpected End of Itab LOOP ProcessingVMC: NullPointerException on zLinuxVMC: Stackdump on VirtualMachineErrorWindow size for new external session is incorrectWork process hangs during RFC communicationCore in DiagoTabFocusColumn()Mm.dump does not display enough files for error analysisZ-order perfromance assistent and abap debuggerDB6: SQL0301N after LONG to LOB conversionProblems with the use of literals in non-unicode systemsDB2 z/OS: CTE hint + loader; hybrid DbSl: DB2 Rel + sec coDB2-z/OS: db2radm fix db2i for HA V9, CLASSPATH during upgDB2-z/OS: db2radm fix fail on CONNECT issues for GrantIBM i: Logon to system fails after upgradeToo many fixed columnsIBM i: remove superfluous lines from APYSIDKRN logDB2-z/OS: upgrade to 7.0x does not exploit REBUILD INDEXCorrupted PERM memory block fixedNew feature ignore duplicatesABAP-COCO Patch Collection 3Default cursor and table controlERROR => DpWpCTrc: invalid wpEXPORT: key length check correctedGW: connections not closedHttpFileAccessHandler not activated when in maintenance moImprove error message when calling a remotefunctionmoduleRemoveHeader erroneously requires an argument after headerSAFT PortugalSAP-Shortcut: length of program parametersSTAT: accounting of DB operations with direct readStart of Unicode Programs can fail on WindowsBcd_atobcd: check operand lengthCore in dyAbapGetBsdupValueDev_disp: *ABAP Request queue reached 90%Fxreader: COREDUMP bei Trace AusgabeSapstartsrv: Incorrect profile parameterRFC - Fixed error while transfering large data via basXMLABAP-COCO: Method chains with interface referenceDisplay correct nametab buffer sizes in ST02EXPORT (>2GB): exception instead of shortdumpEXPORT: source code positionEXTRACT: unique temporary filenameICM timeout statisticsNo PKRT_OBJECT_IDS entries for dynamic XSLT programsNo currency keys for Decfloat types in Release 7.31PostScript error when printing ABAP Symbol/Icon from OTFSecurity Policy bugfixesSupport for AIX 7.1Trans. ST03N, web server statistics display incorrect valuURGUI: calendar control month selection colour issueCore in dyRcUiReceiveRequestCONFIGJVM: Fixes for SAP JVM 4.1 params and IASP databaseIBM i: CONVUSRCPT ignores objects owned by QSYSDB6: overflow in rowcount check for large tablesR3load: oracle 11.2 securefile only for compressed tablesDB2-z/OS: db2radm mask passwd during BINDDB2 z/OS: hybrid DbSl: trace level 3; FP3aDB4: SQL Grammar: SELECT <Fields> FROM *LIBL/<Table> ...Secondary connections to Oracle, corr. of connect errorProblem with invalid DBSL datatype 111 fixedALV Gridview: columns rendered to broadAvoid negative numbers in buffered table statisticsCore-Dump at DREF->COMPDpSesGetSessionKey: session table emptyError during CCT callITS: ABAP program termination in ICF_DISPATCHITS: Right mouse click on tree control header causes errorSM59: connection closed (no data)VMC: external timer does not start on profilingVMC: log messages during global evictionsVMC: shared closure operations on cache regionsVMC: signal 11 in RFC callbackSwitch E2E trace by system commandDB4: XDN 2-Tier Cancel without Spin-LockIBM i: avoid 'achive not allowed for current OS release'IBM i: fixes chmod errorDB2 z/OS: hybrid DbSl: INIT_STATS; CLI timeoutDB2-z/OS: INLINE clause causes SQL error -104 with DB2 9ALV Gridview: background-color of editable fields wrongModification rules are truncated after 256 charactersError in Dynpro runtime: Module called twiceRFC: work process dumps while parsing xmlrfc requestsSystem Core after Applying SAP Note 1433584VMC Cache: empty keys no longer allowedWeb Dispatcher crashes with signal 10 or 11DB4: SQL Package Dispersion to increase Statement LimitsDB4:XDN Start : Handle Invalid SAPLOCALHOSTInvalid number of records after INSERTIBM i: Archive xxx is not allowed for the current OS releaseIBM i: Short dump DYNPRO_FIELD_CONVERSION in DB4CockpitDB6: overflow in rowcount check part 2DB2-z/OS: db2radm sapclinst with hybrid DbSlABAP Debugger: Fix invisible statement BPs at ENHANCEMENTABAP Debugger: Watch points on objects do not workADBC: enable long statements in method EXECUTE_DDLCorrection of {711,720}_COR/src/i18n/sapdecfDB2-z/OS:setibmsockopt SO_AcceptEConnAborted failed, rc=-1EXTSRV does not work for HTTPS protocolEnqueue bug fixesSCOV: correct metadata for SYSTEM-CALL and CHECK SEL.OPTIOCore in DiagiSetFocus1Gui toolbar missingLocal mime files for SAP GUI for HTMLScreen output area too smallTablecontrol not visibleNew version of AS4FIXFILEABAP: Session abort when compiling a deep constantAIX SAPJVM_4: JNI_CreateJavaVM from libjvm.soAIX: error in ESSHM managementAdding Enqueue-Lock in SNT-HMAC functionsMissing source code for subroutine pool in short dumpSHO: small correctionsSM13: Update test writes data onto the databaseShort dump SYSTEM_POINTER_PENDINGUnique subpool nameWeb Dispatcher crashes for large URLs with logging enabledDialogbox: horizontal scrollbarTablecontrol: default focusIBM i: CRTSAPVIEW results in SQL-104 on special tablesIBM i: print error report at end of patch processABAP Mixed-Case FunctionsATRA 7.03: Memory consumption is missing in SATChanging the default value of spool optionsGETWA_NOT_ASSIGNED during END-OF-PAGEInitialization of CTU message tab at rolloutMessage server: fixes for the rolling kernel switchMore robust security session inactivity watchdogSecure Storage ABAP Unit Test 7.20 AKK enablingWorkprocess restart during syntax check of a Simple TransfError when deleting large keysError: implicit langdeletions=noGui e2e traceIXML: Attribute value normalizationParallel import on Windows with CTC=1IBM i: Adjustment of DBSL statisticsSecondary connections to Oracle database (correction)DB2-z/OS: db2radm -m cmd: Invalid cursor stateIBM i: avoid conversion error when reading spool filesProblems with R3TASKS Menue 'Work with SAP System Jobs'Maxdb: Correction longer WHERE clause as 1024 byteR3ldctl (MSS): compression for table / indexCore dump during dynamic type creationDELETE generically typed standard table WITH TABLE KEYDynamically changed profile parameters are ineffectiveDynamically switchable parameter does not seem to changeENQU: format of the enqueue logEnhancements for SAP GUI 12Extended RFC authorization conceptHanging RFC connections with SNCItab Unsharing Core During Btree CopyPfFileList: found too many file in directoryRSUSR003 supporting checks for user TMSADMRUCRM701: Dump when initializing shared memorySHO: Additional diagnostic info for mutex timeoutsSoftcancel during RFC with Frontend OutputTPDA shows wrong length for strings in structuresTPDA: Core in non-excl debuggee when changing variablesVMC Caching: API extendedWeb dispatcher forwards HTTP requests to the wrong systemWorkprocess stucks in state holdWrong Itab Order after Block Insert with USING KEYCheck screen load: field exitDisturbed columns when printing doublewidth spacesMissing scrollbar on main dynpro areaMore information in trace of sapevtDB2 z/OS: No more connections available in 'connect.ini'DB2-z/OS: Exploitation of DB2 cli network statisticsParameter maxmarkercnt increased to 10000Runtime error when using cl_abap_db_c_locator->findSQL error -1 with severity 0Syntax error caused by SQL hintsNew feature batch streamingDB2 z/OS: hybrid DbSl Vx: BLD LEVEL not recognizedJava Runtime hangs when converting a certain numberDev_rfcx trace files lost at automatic workprocess restartDBSL error in secondary connectionNo UPSERT on WBCROSSGTAvoid runtime error SORT_AS_TEXT_DEST_TOO_SHORTCompiler options for HPUXHTMLGUI: texts and translation processSplitterarea is hidden in firefoxTableControl: default Fokus in dialogboxCheck gui connect dataDialogbox on wrong screenGui-title broken by multi-byte characterENQU: reading the enqueue table (high values of pck)Enable compressed OOPS on HPEnable password SAPGUI logon despite SNC usageSORT (AIX): disclaim addedTable control not visibleVMC: timezone update 2011bTemporary license overwrites permanent licensePXA: Avoid core dump due to protect callIBM i: check patch program for correct ownerACF with XSRF TokenAllow to free memory in case of short dumpAvoid core in zdate_info if timestamp is invalidContent type is set to text/plain for XSL filesDATASET (NT): SET POSITION END OF FILEDP: ERROR => DpRqIGetFromQ: SemRq(23,1) failed.Extended passport function for background programsFixed source hash for Coverage AnalyzerGraphics rendered with wrong resolutionITS: applet control setOkCode method missingITS: new functions to get/set RFC context fields/valuesNew Texts in sappfparNo memory for processing HTTP, HTTPS, or SMTP queries.Solved corrupted page caused by illegal IDsSyslog S19: Maximum number of <x> systems reachedSystem standstill: MtxLock EMADMTH: Send Commit Messages immediatelyWork process running endlesslyDeletion of enhancementsLangdeletions = autoDB2 z/OS: EHPI: ALTER TABLESPACE of DB2 catlg during uptimAIX/IBM i: Startup framework can use wrong jvm libraryALV Gridview: hotspot doesn't workALV Gridview: sequence of resizing, scrolling and focusingATRA: Missing trace files for E2E traceCorrect DDLOG cleanup procedure for central systemsDB4: XDN: Start XDN on all Virtual HostsDisplaying of IPC statistics is invalidFix for HttpModRuleInit: cannot compile regular expressionHanging Workprocess after Cancel in SNC ConfigurationHanging work processes with user SAPSYSJobs terminate during message server outageNo embedding of True Type Fonts in SAPGOFOpen SQL: Support for NewDB HintsREAD TABLE .. INTO .. for a STRUCTURE Typed TABLES ParamROUTER connections are forwarded to P4S portScratch area is too small, opcode 6Support for ITS service namespace starting with a slashSystem log: -No Active Link Found in the Link TableTrace output in UpdateEntryVMC App Mgmt: Optimized repository refreshWeb Dispatcher crashes with core dumpDeadlock D345T and D342LImprove transaction parameter handlingListfocus disappears at scrollingNo search help on some input fieldsScreen compression not downward compatibelTp: TRUNCATE TABLE reports ERROR 64: no record foundAvoid compiler warningsDB2 z/OS: hybrid V9: deadlock not detectedDB6: patch collection 03/11Secondary connections to Oracle database, default charsetUPSERT retry correctedR3load: display process id in log fileCore while Generating Programs with Nested DDIC ItabsEscaping corrupts absolute URLsICM in client role returns HTPIO_PLG_CANCELLED errorIMPORT: WRONG_COMP_LENG and ACC PADITS: applet with relative codebase pathIncorrect reference info on LOOP stack after unsharingSTAT: too many open files stat.DATWrong CJK font for 'Enclosed Alphanumerics'Allow sort in all search help result columnsKeyboard navigation in searchhelp not possibleDB2-z/OS: db2radm fix version msg, sapclinst > 10 tsoIASPIFSCRT bugfixIBM i: APYSIKRN does not apply IGS packageI5/OS: Administration of IFS objectsCore in msgserverITS: fixed ~template handlingTableControl: default Fokus and invalid SET CURSORTableControl: default Fokus bei suppress dialogTray selection of Sapscript form via Output DeviceDB2 z/OS: error while applying 7.10 SP4Check journalsettingsSYBASEPilot Sybase ASE corrections for tools and lib_dbslHom./Het.System Copy SAP NW 7.0 incl. EHP 2Installing the SAP CTS plug-inR3trans crash in 'db_repo' with reference to 'SYMTAB'R3trans crash in DIFFEXP*: sap_dext 400ALV Gridview: Scrolling processed on wrong control(s)ALV Gridview: column too small for broad iconsALV grid view: Sequence of resizing, scrolling, and focusHMAC Enqueue-Lock adaption for mass-parallel accessDynamic temporary variables are not part of GC's root setError Handling in Upgrade Phase PARCONF_UPGGetting HTTP header field with name longer than 255 crashLgIGetAppSrv: no server foundModification rule not applied with long SSL certificatesPage authorization checkSAP-OSCMD-05: Os Command injectionScreen compression not downward-compatibleSystem will not bootUNPACK: floating point handling unchangedVMC: timezone update 2011dWrong addressing information for references to boxesDisp+work on AIX with Profile Based OptimizationForce version check for its mimes and kernelDB6: REORG table causes SQL0108IBM i: support SAPJVM4 in 7.02IBM i: support signature of ILE objectsEvent SAP_SYSTEM_START_VMC when starting/resetting VMCExtended passport function for background programs IIICM crashes with closed P4 connectionsITS: Wrong tree header icon appears after tree expandInvalid boundary in multipart HTTP request causes core dumLong wait times when expanding nodes in treePortal based Web Dynpro apps don't work after kernel updateSystem logon, Crystal Reports, starting from the SAP GUICore in cua_gtab()Shortdumps PKRT_INCONSISTENT_DEFENVSDB2 z/OS: SET CURRENT DEGREE = 'ANY' HintMaxDB: R3load core dump export option -read_committedCUABUFFER_READ and missing icon-idsChange default for rdisp/check_master_slave_active to 2Core dump when printing very wide RTL ABAP listsDeadlock on D342L and D345TDefault of gw/so_keepaliveENQ HOLDENQU: Busy loop in ERS when polling is activatedGW: potential core fix in gwrdITSmobile: XSRF fixModification handler does not workNTAB: Remove incompatible key length checkST: Missing table registration for template parametersTableControl: default Fokus and leftColWebGUI Java applet security redesignWork process no longer rolled inWorkprocess in state 'running' without user and programCatch DYNPRO_SEND_IN_BACKGROUND cpic-serverCheck screen contentEnhancement for wide listError message ends with useless textRdisp/TRACE_RESOLUTION im GatewaySapstartsrv: J2EEControlCluster extensionUnexpected display of iconAIX: Apparent memory leak in EMSecurity options (XSS) for ESCAPEVMC: invalid sessionWithdraw Catching DYNPRO_SEND_IN_BACKGROUND for CPIC servDB2 z/OS: R3load does not recognize dbs_db2_sap_stosidERROR: Unregister application infoIBM i: update infoapar only when changedImproved version of iASP toolsetService cannot be activated/deactivated in SMICMIBM i: Error when starting JUMP/JPREPARE when using SAPJVMIBM i: Error when starting UASERVER when using J9IBM i: Missing Index Data in Space: State on DiskDB2 z/OS: lib_dbsl signal 6 in dbdd_dbtab_columns97DB6: FOR ALL ENTRIES with SUBSTITUTE VALUESUPDSTAT with SAPSYSTEMNAME longer as 3 charactersNo effect of deletion of an enhancement implementationABAP code generationABAP compiler: slowed down by info messagesALV Gridview: hotspot on icons does not workAllow to run interactive shell lev2rCanceled download leads to canceled ABAP sessionDirectory traversal in ABAP LanguageERROR: Premature EOS in requestEnable DB-failover for WPs in hold modeEnable creation of assertion tickets w/o logon ticketsITS Up/Down: fix for new security appletITS: F4 2ndLevel hitlist search not workingITS: wrong ITS session properties check sequenceInvalid LUW-IdLinux: Alternative method to generate an SAP hardware keyMaxDB protocol filename for UPDSTATMessage server not reachableMessage server: client patch level might be requiredMissing authorization check in TH_CREATE_FOREIGN_MODEOBN supportPXA: optimization of mutex timeout handlingREJECT has no effect after logical conditionSCOV: avoid inconsistent statement resultsSE30: Avoid negative runtimesSHO: user for automatic buildSHO: weak referencesSYSTEM_INVALID_PXAINDEX or ABAP_ASSERT in ab_popfstSecure Storage Migration for SAP-internal Inst. NumbersSession token on disconnectoncloseShort dump ROLLBACK_IN_POSTINGSlin: no crossref collection for test datidsTableControl: default Fokus and call dialogTablecontrol: icons are not displayedWeb Dispatcher/ICM crash using Admin UI with trace level 2Wrong output of color background in Smart formAvoid crash in search help result listCase insensitive s_dataset authorizations on NTCcq issue resolvedCore in DiagIsSameId()Core in DiagTcColGetColumnByBsdupColumnNr()Core in dynppai0()Dev_webdisp_watchdog trace file does not rotate into .oldDisconnectonclose AJAX requestEnable SAP Memory parameter for string fieldsEnqueue replication server crashesLost focus on input field with context menuRepair SECUDIR putenv during SSF initializationSapstartsrv: SYBASE database detectionUrgui: fixed missing Menu and System button textUrgui: fixed non-unicode case~webgui_simple_toolbar with enhanced feature setF4 help button placed below input field in firefoxMissing owner in menu system -> statusSecurity concept on IBM iABAP (in Eclipse) Debugger: fix for changing long fieldsCONVERSION ERRORS: more informationFront-end printing: Short dump RAISE_EXCEPTIONITS: Scroll position in tree when accessing transactionITS: new CSS escaping function xss_css_escapeIgnore '102 Processing' headerP4 keepalive mechanismSTAT: reading stat data when compression is offSession abort in CALL TRANSFORMATIONShortdump RAISE_EXCEPTION in SAPLOLEATrInit: invalid parameter value <FALSE>VMC: Estimating shared closure sizeVMC: timezone update 2011gWrong owner in menu system -> statusAvoid overtaker problems with CTC=true and umode 0IBM i: save program directory after APYSIDKRNError when reading long fields in DSQL without is_lobDB6: ASYNC option for data loadR3load: Coredump in dbslABAP-SYCH: Core in type definition in interfacesALV Gridview: readonly cells w/o text can be editedAvoid help button on standard toolbarBatch-Input: log with wrong screen indexDoubleclick on textfield fixedICM: Normalize multiple slashes in HTTP Rewrite HandlerITS: fixed possible stack corruptionPrevent overwriting of statics by ab_CDestr_*Remove Sent URL ... dialogWrite log records in case of ACCEPTING DUPLICATE KEYSTp breaks when delivery after import failsDB2-z/OS: db2radm print correct patch level headerSQL error during TOUCH_REPORTS accessDeletion of inactive enhancement objectsParallel import - error in 'autorepeat'ENQU: Signal 11 in pending listEnqueues remain after shutdownFIELDS_TO_STRING method removes '=' signGUI-status generation tracesHanging RFC connection with SNC (II)ITS: Changes to column widths in tree are lostITS: Icons in tree may initially have wrong size in MSIE6ITS: column tree columns divider not visibleITS: empty toolbar buttonsITS: fixed error caused by missing sap_secu.js fileJ2EE Server operational shows wrong status in SMICMRemove compiler warningsSTAT: GetActRec and CPU timeSUSR_INTERNET_USERSWITCH funktioniert nicht mit internem ITSTableControl: default Fokus only output fieldsUnjustified runtime error DYN_WHERE_PARSE_ERROR in LOOPWeb Dispatcher process generates very high CPU loadWork process in state 'hold SNC'Pushbutton without functioncodeRemote control for ui with cfw kernel partSapstarsrv: Fix AS Java MSSQL named instance detectionSapstartsrv: Unix environment setup fixSaving Textedit control value in tabstrip after roundtripServer crash on page with splitter of size 0Urgui: day in the wrong month is marked in calendar contr.Secondary connection to HANADB2-z/OS: DEFINE NO for tablespaces and indexesIBM i: CONVUSRCPT supports new option *CHECKIBM i: MCH3601 after calling command APYSIDKRNALV Gridview & Tablecontrol: column resize erroneousALV Gridview: range selection after roundtrip doesn't workALV Gridview: rowcount erroneous after dynpro resizeEscaping cookie values IIExtend URL evaluation for appending a tokenITS: Context menu actions ignore multiple selection in treITS: Scroll position in tree control is not maintainedITS: Selection in tree control is not retainedITS: Tree node content is not updated in SBWPITS: resync response when stepcounter is out of orderWork process are blocked by semaphore 7Output field with icon should be displayed as labelResizing of window can cause loops or closed popupsUseragentversion for firefox not correctBatch-Input: not all SY-MSGV* variables are filledCONVERSION ERRORS: more information 2Content Scan returns HTTP 400 on large POST requestsENQU: mutexes in ENSAITS: Session termination: Wrong image URLs in tree headerSCOV LiteTablecontrol: text wrapsVMC: improve mutex recoveryMemory leak in native layer of SAP Java ConnectorDB2 z/OS: Avoid SQLBREAK during commit: avoid wp restartR3load import: Invalid field size for datatypeALV Gridview: double click on icon doesnt workBatch-Input: COMMIT WORK inside of variant transactionsDATASET: rc addedGET_SINGLE_REFS: To many hitsHTTP log file download not work in WDP/ICM web adm UIIBM i: float modulus which should be null isn'tITS: textedit control wrong border height in firefox browsMissing authorization check in TH_CREATE_FOREIGN_MODE (2)PXA: Additional diagnostic informationReference count of unshared shared objects tablesResizing closes popupTable Control: Default focus after call dialogCorrection of webgui_simple_toolbarCross reference for ASSIGN dref->*Duplicate short cuts in menubarMake second label in <label>><input><label> navigatableMandatory fields are prefilled with a starNo authorization trace when session breakpoint activeSuppress error messages on non existent table MLICHECKSM51, Display of maximum used WP/APPC blocksALV Gridview: Checkbox cannot be selectedALV Gridview: Text not displayed with iconsALV Gridview: wrong text in header cellsASXML: Support for 24:00:00 xsd:time valuesAvoid unnecessary accesses to table defintion bufferC_DD_READ_FIELD: Ignore duplicate key errorsCalls to the Kaon Parser are terminatedEXPECT_RABAX Potential memory overwrite in abrabax.cFailing controls with appserver on SolarisGW: core in GwHdlPendingWriteGW: core in GwRqDpSendToIBM i: show private shared segments in cleanipc/showipcITS: restored mimeUrl() default ~service parameter valueKernel patches for code pages, languages and localesMissing Information in Systemarea in DebuggerNo valid destination server available when using J2EE grouOpenSQL : Wrong shortdump at SELECT with LOBsPopups are placed centeredPotential remote code execution in SAP kernelSIGBUS in function db_repo when deleting runtime objectSearchhelp icon missing on readonly table fieldsShortdump CALL_FUNCTION_RECEIVE_ERRORVMC: change default of vmcj/enableVMC: tracelevel 2 not reset after signalCustom control with several entries is not displayedTable control column not invisibleApplication info (DBSL Oracle), correctionDB2 z/OS: tp cored; tp finished with return code: 219IBM i: don't set CURLIB on local ccms connectIBM i: Fix SAPJVM default path in CONFIGJVMHDBFAE with equi-joinTraditional Chinese collation in Unicode systemsAvoid OBJECTS_GLCLASS_NO_LOAD_OKBatch Job has empty field REAXSERVERCC: fixed empty signature of reimplemented methodsDefault GUI-Focus : Check/Radio-Buttons not allowedError message: ES_SPIN_LOCK_ERRORGOS_CONTAINER is missingITS: F4 sporadic JS error : could not set focus to windowITS: No effect when clicking on Icons in tree controlOutput field with icon is displayed without itPerformance improvements for FIN DecouplingSAPLOGON LanguageServer crash caused by splittercell with height 0VMC JARM: Checking switch settings[DSECRG-00221] DoS of Server / SAP CCMS XML parserContainer resize issuesContext menu selection without effectLabel overlapps entry fieldSystem core dump in trace_authcall_newAdvanced URL recognition for XSRF protectionDB2 z/OS: db2radm -m db2i fails on DB2 10Double free during HttpClearSessionDownward compatible handling of URL escape in 7.20 kernelITS: Checkboxes in tree control can't be checked/uncheckedVMC error when accessing shared closuresVMC: Fix SM53 with reverse references/load performanceHexadecimal trace for all parametersSuppress empty column in search help result tableUrgui: sort event is sometime not availableWrong cursor position at warning messageConvert RAW input parameters to literalsIBM i: MaxDB DbSl does not load with MaxDB Client >=7.8Secure connect via secure storeDB2-z/OS: Create table fails w/ segmentation fault in dbslDBSL convertion: wrong error codeUse filesystem counter for R3szchkIBM i: support for MAXDB Client 7.8Enablement of ABAP Secure Store for Database ConnectDB6: combination of DEF_CRT and OPT_COMPRESSDB6: correction for R3load PL 91 on HP-UX and SOLARISCore in cua_dbobject()'tp import subset' uses client 0 instead of export clientMtxLock rrol deadlockCL_ABAP_MESSAGE_DIGEST sometimes returns empty hashvalueWork process in status 'On Hold SNC'Saplikey: illegal format of the value stringIssues when resizing containersFix bug in transport of views ( CDAT, VDAT )R3load/MSSQL: throughput in import log fileR3load: Wrong default InstNoDB4: Correct Array Fetches of SHORT STRING in EXEC SQLDB4: DB Multiconnect - Prepared Statement Not FoundFix for unknown table __TABLE_SIZES_ (R3szchk)Archive not extracted due to incorrect timestamp checkAvoid dump BCD_FIELD_OVERFLOW when calling ST02Bad handling of ill-formed UTF-8Connection test for SNC secured connections failsCorrections for List driver SWIN Cascading FontsEXTRACT: output len of sum fieldsMaximum number of systems is limited to 30New search option for ENQUEUE_READParameter ACTIVE=0 not working for wdisp/serverReturn signal number in Trace FileSE30: Core dump in find_recordSHO: problems with locksSyslog Q0I when operating system call writev failsUpdate sec. indices after DELETE WITH TABLE KEYWeb dispatcher dispatches requests to deactivated serversWork Processes in status HOLDDropdown listbox entry sorting fixedRdisp/rollin_locking not dynamic in 710 to 720ITS: internal server error 500 at ITS session endReturn spool ID for PDF converterSE30: Record mismatch - trace switched on during RFC callSignal 11 AIXUse connect property VARCHARMODE=ABAPUse sys.table_columns instead of sys.columnsIBM i: APYSIDKRN fails on systems using QFileSvr.400 links720 AKK regarding setting watchpointsENQU: enqueue log: resetES_SPIN_LOCK_ERRORITS: restored AJAX-abilityList driver: Wrong font for PCL/POST/PRESMtxLock SLICBUF deadlock warningsProblem with webgui - SAPITS_MENU_SYSTEMSTAT: get last and act dia recordsTablecontrol: empty cells have nove bordersToggling radio buttons in nested group boxesVMC: CVMspLockSharedMutex: failed to acquire lock, rc=10Sapstartsrv: Windows service dependency and recoveryTooltips on dynpro elements missingUrgui: calendar date formatWdispmon/icmmon does not startIBM i: WP0 dies on IBM i application serverR3load fastload import hangs on index creationWrong message from conversion check functionABAPList fields are not submitted to backendALV Gridview: not all rows are displayed on small containerCode Completion : INCLUDE TYPE for type aliasesCore dump for Text Edit ControlCoredump in the function ab_InitStackCounter()ITS: no locks can be held when session is destroyedSYSTEM_CORE_DUMPED to LOAD REPORT PART 'LREF'Correction for STORAGE_FREE_FAILED in CDESKGui status : trace load contentIcm/P4/ignore_duplicate_banner does not workMissing warning messages and design issues in firefoxSearchhelp on searchhelp looses select optionsITS: updated XSS-escaping functionsLong strings truncated by SELECTSybase ASE enablement for tools and lib_dbslClose all lob locators at end of the transactionShort dump when reading database columns of type DFnn_SCLUPSERT without a primary keyDBSL hint dbsl_add_stmtIBM i: Fix JAVA_HOME in ABAP only scenariosChecking and reconstructing systables by AS4FIXFILENewDB: Inconsitenz databype LCHR between DDIC and R3loadNewDB: Porting ChangesR3load/MSSQL: using hintfiles for exportActions on tree manipulate docker sizeDestroyed ref. in case of INTERFACES DATA VALUESTablecontrol: rows are erroneously selectableWP restart due to VMC JIT compiler problemAvoid repeatedly opened external popup windowFocus not set correctlyResizing of relative docker/splitter incorrectDB2 z/OS: wrong out of stored procedure argumentsDB6: collection of network statisticsSybase ASE performance enhancements lib_dbslDB4: Missing sapms<SID> Service causes Java Upgrade to stoIBM i: Support for SAPJVM4 under 7.02IBM i: iletools supports now ILE.SAR and SAPEXE.SARNewDB: Inconsitenz databype LCHR between DDIC and R3ABAP kernel synchronisationABAPList fields are not submitted to backend (2)CALL TRANSACTION xxx USING: SY-SUBRC is always 0Default GUI-Focus : table control fixed column cellsErrors when cancelling a stopped work processICM, WDP: ExecWaitForProcess failed (rc=-14) on HP-UXIMPORT CREATE DATA for tables w/ unstruct. linesITS: restore textedit scrollbar position after roundtripNo connection to J2EE after restart of application serverPOSTING_ILLEGAL_STATEMENT dump in Perform on commitPrepare usage of Linux 3.x kernelSE30: Missing trace recordsAvoid STORAGE_FREE_FAILED in dyFreeTxParameters()Correct /N! handlingFixed safari useragent detectionHorizontal scrolling in ABAPList and Value submitNew supportbit ALLWAYS_SEND_CLIENTResizing in portal framework disturbs ITSSupport of saplogon language kernel partDB6: refresh connection infos on seamless failoverIBM: Index advised (ST04) leads to Work Process restartclose all lob locators at end of the transactionjs-error after logout from WebGUISharing of Text-ElementsABAP sessions are displaced for applications in theHorizontal scroll bar and transfer of input in ABAPListSHO: Dataelement dependencyTesting program for HA systems inflictedHorizontal scroll bar and transfer of input in ABAPSupport for screen scrolling addedAccessibility: input mask in ERFIBM i: REmove Printer Output After Jobs Have EndedITS: backend textedit text selection left shift in firefoxITS: picture control icon click event missingInstable fingerprint for structured constantsNew List driver attributes SWIN (Cascading Fonts)Pause security session cleanup during offline backupsST02: wrong number of PXA directory entriesPXA: remove unjustified warning messageThEppGetRootContextIdAsXuuid failed with (98)Reduced complexity of HTML groupbox/subscreen/steploopCorrect check for overlapping fields on dynprosJ2EE crash in IcmAdm.getInstanceEnable loading animationIncorrect output at WRITE TO and conversion exitStart new debugger from veri programs (TPDA_START_VERI)~webgui=0 starts ITS in unified rendering modeCRTSAPUSR: implement default locale settingsIBM i: CRTR3SYS fails on index lockIBM i: CRTSAPUSR fails with SPCAUT overflowIBM i: Support of a signature of ILE objectsDB2-z/OS: db2radm fix version, no ftp on sapclinstSelect error in dbsl adbc interfaceIBM i: Startsap with *DB does not workCorrection SAP-DDIC inconsistency /MAXDB/DUMMYTAB<No>POSTLANGUAGEIMPORT imports texts incompletelyTransports between Basis Releases 7.0* and 7.1*Upgrade: SQL Error during read of report source tableABAPList fields are not submitted to backend (3)Control level processing and fieldsymbols:wrong cmp lenghtENQU: creation of enqueue tableITS: Some tree items are replaced by other tree itemsITS: Tree-Control shows tooltips even when emptySignal 7 in TrReadRecFromAbapVMC: Revised Mutex statistics in SM52VMC: recover VMCADMPerformance improvementsSize is partly hidden after uncollapsing of nodeTraffic control timeout does not work properlyValue help button not visibleConnect to a HDB schemaMissing import steps in import historyOvertaker transports and CTC=trueIBM i: paseinlpgm could not determine kernel libraryACCESS Option in File gw/reginfoAKK: Webgui with new design in 700, 701, 710, 711ENQU: busy loop when ERS gets suspendedENQU: forgotten trace; memory leakENQU: memory leak when requesting repl info (328)New traces in dev_rd filePotential remote code execution in RFC(Remote Function CalRemove Compiler WarningsSE30: Wrong gross time for aggregated measurementsTheming in unified rendering based sap gui for htmlVMC: timezone update 2011iClassical debugger: toolbar buttons missingDialogbox dimension and list displayImprove qRFC debugging with classic ABAP debuggerJcontrol, jcmon, jlaunch: no error if called without parmsWrong StatementID for EXEC SQL StatementInternal error in listparserDESCRIBE with columnnames > 32 charactersUse SDB_CLIENT_INFOIBM i: APYSIDKRN to correct profilesR3load NewDB core dump by create tableCore dump in DlLoadLib2() loading the DBSLDB2 z/OS: STU3_ADMIN_SWITCH_DB_CON, dbds NULL indicatorsALV Grid View Control: Search Help button is not visibleALV Gridview: cell contents or input containing semicolonsALV Gridview: cell selection and focus on dropdownALV Gridview: copying and duplicating rowsALV Gridview: linksBuffer synchronisation: Avoid misleading syslog msg. BS5Function parameter as target for strcpy_saUITS Calendar: focus changed on selectionITS: fixed mimeUrl() unnamed parameter is ~nameMissing translation for Hebrew languagePXA: no memory protection as default for HP-UXSupport for Gos-container with popup windowSupport of RFC 2397 in CL_HTTP_UTILITY->IS_VALID_URLTextfield with oversized text not truncatedURGUI; no tooltips in SAPCALENDARUser actions fail when HTMLviewer control is displayedAbap/heap_area_total wrongly calculated when using %Avoid scrollbars around tabstrip pagesCore dump in AgiTableView::DiagITableHeadPopups are displayed in wrong orderScrollbars around userarea sometimes missingSet page title to current transactionSingle session gui connectionsResize the browser included PopUpsIBM i: Wrong statement length causing SQL-113ALV Gridview: cell styles bold, italic and underlineCode analysis findings in Secure StorageENQU: memory leak when requesting repl info (328, 2)ITS: textedit control click event do not set focusMissing state of local TabStrip scrollingMoving of splitter sash hides cell areaSHO: Avoid SHM_LOCK_OPERATION_FAILED due to kernel loopSHO: memory leak in table sharingST: corrupted tags in RESULT STRINGSXML virus scannerTable logging: correct timestamp computationXSLT: Variables in rule patternsNew profile parameter sapgui/theme_1 kernel partIBM i: STARTSAP/STOPSAP now works for remote Windows InstIBM i: send correct message at end of APYSIDKRNDB4: Resolve Kernel Library for Standalone ProgramsWorkprocess exit in DSQL/ADBCVirus scanner integration for SXMLminimal supported HDB release is 1.00.17Enhancements for HANA system copyIBM i:Updating software packages before installation/upgradeNewDB: R3load executing savepoint aftler loading tableABAP-SYCH: Overflow of Expression IDBuffer sync.: Avoid core dump if WP trace is switched onCompiler warning for illegal ABAP expressionCorrect failover of database connectionsDP: disable reverse name lookup automaticallyError messages for missing table MLICHECKGET_DIRECTORY: raise exceptionITS: fixed template recyclingIncorrect work of applications on SAP GUI for HTML in SM7.Linux: force and improve UUID checkMEMORY_PGFREE_FAILEDPopup calendar is emptySYSTEM_NO_ROLL in listparserShared Objects: Method GET_INSTANCE_INFOS extendedVMC: Debug Info for Data Exchange ContainerVMC: Detail view of SCs in SM53 is loaded filteredVMC: Type check on CORBA serializationVMC: timezone update 2011k including format switchSapstartsrv: Bootstrap does not cleanup shared memorySapstartsrv: ParameterValue does not find parameterSyntax error at RISK LEVEL/DURATIONABAP-COCO: Cyclic Use of TypepoolsABAP-PH: Core dump when referring to deferred classesAbort when reading files from other systemsCore in ABAP SCAN ...WITH PRAGMA... commandDump CALL_TRANSACTION_USING_NESTED after kernel patchEnable password RFC logon despite SNC usageHTML Businees ASSERT function not working correctlyIBM i: sapcontrol fails on StartServiceNo more ABAP contexts available for protocol: HTTP (90%)SAP GUI for HTML: Tabstrip scrollingSE30: Record mismatch for HTTP call issuing an RFC callNewDB R3load better supportTransport for EnhancementsDB6: Galileo patch collectionNew DbSlPing for HDBUnicode SAPHTTP does not work during masscheck out featureFile transfer to client slow via saphttp when using CitrixSAPFTP does not work during the Passive modeIBM i: Refine patch check in APYSIDKRNIBM i: Retrieve SAPCAR output correctlyNewDB R3ldctl Correction dbdiff selectAvoid loading Oracle functions on MaxDBCopy Window doesn't work with ABAP PDL driverDynamic LOOP WHERE parse error for literalsPossible remote execution of code in Startup ServiceENQU: creation of enqueue table, nr 99Fix DEFAULT textelement in interface methodsGW: ERROR missing tp specificationSCOV: suppress updating COVREF during compilationSapSSL fix for client-side TLS session caching/resumptionVMC: Startup of VMC fails with unitialized Win32-usersBgRFC enqueue locks remainNew interface GetXMLPropertiesDynproSapstartsrv: search for sapuxuserchkDB2 z/OS: coninfo parsed incorrectlySYB: Database connect information for Sybase ASESapcpe reports misleading error when file copy is incompleDB4: Starting SAP from SAPSTRSRV also start Database ListeDB2 z/OS: lib_dbsl V9 cores in build_dbsl_stmtAPG: avoid GEN_INCLUDE_NOT_EXECAdapt intervals in SNRO: SAPSQL_ARRAY_INSERT_DUPRECDELETE DATASET: tracingEnhance saproot.sh to configure sapuxuserchkGW: ERROR => failed to open (No such file or directory)GW: Gateway statistics wrong number of TCP errorsHourglass missing in transactions with initial dialog boxIBM i:Profilparameter fuer die Analyse von SQL0913-FehlernITS: fixed charset issue in non-Unicode casePotential remote code execution in SAP Message ServerPrinter error with monospaced TTF fonts and PCL printVMC: Set default state of Supportlet Container to offNew correction for STORAGE_FREE_FAILED in CDESKScreen resizing not downward compatibelDB2 z/OS: vx error with secondary connectionsDBSL correction for Oracle type mappingSupport of MaxDB 7.8 and 7.9Progress Bar indicator during Mass Checkout in SAPHTTPALV Gridview: height calculaton wrongCrash in search help with results that show icon onlySLIN: ASSERTION FAILED in code with static ENH-SECTIONWebgui: missing delimiters in date fieldAvoid coherent switching of tabstripsIBM i: APYSIDKRN did not update SAPJVM_VERSIONIBM i: Call of DLTOLDPKG by STARTSAP config by Inst. ProfALV Gridview: optimize all cols doesnt work after updateCONVERT TIMESTAMP yields wrong resultDP: work process stuck in state 'On Hold'ITS:Wrong position of images of text items in tree controlOutput of Lines and Boxes via printer driver SWINSAP GUI for HTML: Splitter cell resized to 0px fixedSTAT: DB connections not registeredSTAT: memory overflow (STATAB)Tablecontrol: horizontal scroll position resettedVMC: timezone update 2011nCore in dyCheckContainerGeometry_1Sybase ASE: DB Error 7136Tp getdbobjsize returns size 0 for all objectsHandle deprecated SQL problems as warningsSapcpe overwrites target files owned by a foreign ownerITS: Wrong alignment of monospaced items in list treesTablecontrol: text wraps behind iconWrong calculation of relative splitter cellALV Gridview: selection menu not displayedSwitch of tabs with mandatory fields does not workALV Gridview: range selection with last row failsCCMS agent and kernel patches 2011/3ENQU: creation of enqueue table, nr 99 (2)IBM i: DATASET_SEEK_ERROR when accessing QNTC filesIBM i: open dataset in legacy mode for NFS and QNTCJSON Support (Kernel)Saplicense -pinstall optionSimple Transformation: Core during ouput parameter fillingTH: Status line text 'Update failed'Dump in listparser at setSuccJumpIndicesFrequent workprocess dumps after kernel upgradeNtenv2reg.exe/ntreg2env.exe incomplete variable transferProfile parameter sapgui/signature_colorResizing of dynpro-based splitter does not workABAPList labels with iconALV Gridview: wrong backbground colorAvoid decreasing controls after roundtripEXTRACTS: CNT() handlingGW: Konsitent use of COMM_ADMHandle Leak in Work ProcessITS UpDown: moved applet into kernel for urguiITS: Tree is not displayed correctly in narrow environmentOpenSQL : SELECT INTO CORRESPONDING and LCHR und LRAWR3ta: new split method for MSSQLSupport for Ctrl+F4 to insert new rowsText wrap on dynpro textfields with iconsIBM i: Speed-up system start after applying a patchIBM: SQL-227 Error accessing NRIVMaxDB R3load dbms_check availableNewDB R3load Correction CREATE VIEW wrong empty stringALV Gridview and Tablecontrol: f4 button hoversAn instance cannot write into the central syslog (2)CCMS Monitoring: DbReqTime is wrongly calculatedExtended tree hidden by elements belowGW: Core in R3DEALITS_TEMPLATE_NOT_FOUND short dumps after importing SPNo update server for language foundSYSLOG: output of 'Initialization complete'Support for ~noheaderokcodeImproved display of searchhelp resultsSupport contextmenu on popupsIBM: SQL-502 during language importDefine a primary key on the temp tables for R3szchkHandle new return code INVALID_CALC_SCENARIOCPIC: client with wrong appc header version rejected700710701702703711720730731732AIX 1 6AIX 1 7700 710 701 702 703 711 712 720 730 731 732 disp+workdisp+work -Vgatewaygwrd -Vmsgservermsg_server -VR3transR3trans -Vtptp -Vsaplicensesaplicense -versionrelinfodbslenqueueenserver -Vicmanicman -Vjcontroljcontrol -vjlaunchjlaunch -vjcmonjcmon -vvscan_rfcvscan_rfc -VLDAP Connectorldap_rfc -vSAProutersaprouter -VERSIONSAPCARSAPCAR -versionR3loadR3load -VR3ldctlR3ldctl -VR3szchkR3szchk -VSAPinstsapinst -vjstartjstart -vjsmonjsmon -vsaplikeysaplikey -versionILEDSPSAPVERS ILEdb2radmdb2radm -vdb2jclliblibinfo <DBMS> <lib>RSecSSFxrsecssfx -vR3taR3ta -VSAPSLDREGsldreg -versionccmagentsapccmsr -VERSIONlibrfclibinfo ALL <lib>cpictlibrslgcollrslgcoll -VERSIONrslgsendrslgsend -VERSIONsapcpesapcpe versionsaphttpsaphttp -VERSIONsapftpsapftp -VERSIONsapiconvsapiconv -VERSIONsapstartsapstart versionsapxpgsapxpg -VERSIONsapevtsapevt -VERSIONcleanipccleanipc versionshowipcshowipc versionlgtstlgtst -Versionsappfparsappfpar versionR3checkR3check -Vsybctrlsybctrl versionunknown720_EXT_RELAIX 1 6 00F674C64C00Dec 16 2011 21:04:15executablePATCHHISTTIMESTAMP"TIMESTAMP"saprel.cIBADASELECT EXECUTABLE,SAPRELEASE,HOSTNAME,PLATFORM,DBVENDOR,%s,PATCHNO,DBSLPATCHN FROM PATCHHIST WHERE EXECUTABLE = '%s' AND %s = (SELECT MAX(%s) FROM PATCHHIST WHERE EXECUTABLE = '%s' AND SAPRELEASE = '%s' AND HOSTNAME = '%s' AND PLATFORM = '%-.*s' AND DBVENDOR = '%-.*s')AIX%04d%02d%02d%02d%02d%02dIB%-*.*s%-*.*s%-*.*s%-*.*s%-*.*sIB%0*dIB(%2d.%03d) %-.*s (note %d)IBSAP_IKVERSIBGot SAP_IKVERS=%d from environment 31030E72L --------------------------- %s patch information --------------------------- IB ---------------------- IB---------------------- %s update level %d IB patch number %d IB source id %d.%03d -------------------- IB%s information -------------------- kernel release %s IB kernel make variant %s IBnone DBMS client library %s IB DBSL shared library version %s IB compiled on %s for %s rs6000_64 compiled for 64 BIT IB compilation mode UNICODE compile time %s IB --------------------- IBsupported environment IB--------------------- IB database (SAP, table SVERS) %s DBMS server %s IB operating system IB -VIB-VERSIONIBR3CHECKR/3IBdbms_type%-*.*snlsui3.cIBMunameU16IBMwname->sysnameISAP_SYS_NMLNIBMwname->nodenamewname->releaseIwname->versionIwname->machineIreaddir_rU16IBMentry->d_nameIBMAX_PATH_LNreaddirU16Iw_rc.d_nameopendirU16Icdir_nameIB--IB%s: option requires an argument -- %c IB%s: illegal option -- %c getpassU16IpassUIBMAX_PASSWD_LNIBpromptCMAX_PROMPT_LNIBgetgrgidU16gr_name_bufMAX_GRNAME_LNIBgr_passwd_bufIBMAX_GRPASSWD_LN&gr_mem_buf[i * MAX_GRMEM_LN]IBMAX_GRMEM_LNIBMMAX_GRMEMBERSIBgr_mem_bufzdate/DSTswitch_contloctimeoffonIBmktime_cont: got NULL from localtime(&t) @(#) $Id: //bas/720_REL/src/krn/rscp/rscpu86r.c#3 $ SAPdest buffer overflowIBHalf surrogate in middleIBHalf surrogate at endHalf low surrogate in middleIBcontrol codes not allowed hereIBillegal start byteIBsource exhausted within a charIBillegal follow-up byteIBoverlong UTF-8 sequenceUTF-8 bejond UTF-32source exhaustedIBcontrol code not allowed0     #[%]SAPPlatform: rs6000_64#[%]SAPFileVersion: 7200, 117, 19, 50061#[%]SAPSpecialBuild: optu (Dec 18 2011, 20:05:23)#[%]SAPProductVersion: 720, patch 117, changelist 1295245#[%]SAPrbIFileVersion: IBProductVersion: IBMPlatform: ISpecialBuild: (@(#)23 1.6 src/bos/usr/ccs/lib/libpthreads/init.c, libpth, bos610 6/21/07 15:28:59@(#)61 1.16 src/bos/usr/ccs/lib/libc/__threads_init.c, libcthrd, bos61B, b2007_33A0 8/2/07 13:09:21H@(#)42 1.1 src/bos/usr/ccs/lib/libc/POWER/crti.C, libcproc, bos610 3/13/07 11:03:08ޭ`x@(#) Unicode@(#) Unicode.@(#) Unicode@(#) $Id: //bas/720_REL/src/flat/nlsui1.c#10 $ SAP@(#) Unicode@(#) Unicode@(#) Unicode@(#) Unicode@(#) Unicode@(#) Unicode@(#) UnicodeMhNNNNNNNNNNNO0NNNNO0NNNNOP PhNNQHNRLNNR@(#) Unicode@(#) Unicode@(#) Unicode@(#) Unicode@(#) Unicode@(#) $Id: //bas/720_REL/src/flat/nlsui5.c#2 $ SAP 8Ph@(#) UnicodexxƀƐƠ@(#) $Id: //bas/720_REL/src/flat/nlsui0.c#10 $ SAP@(#) Unicode@(#) $Id: //bas/720_REL/src/flat/nlsui2.c#1 $ SAP@$'DN = u0- @(#) Unicode@(#) Unicode@(#) Unicode (08@HPX`hpxHPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hppx (08@HPX`hpx$,4<DLT\dlt| Dt$,4<DLT\dlt\ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (px (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx| $,4<DLT\dlt|(4@LXdp|    $ (08@HPX`hpxӀӈӐӘӠӨӰӸ<ҰDLҰTҰ\ҰҰҰdlҰtҰ|ԄҰԌԔԜҰҰԤԬԴԼҰҰҰҰҰҰҰ ҰҰ$Ұ,ҰҰ4Ұ<DҰLT\ҰdҰltҰҰҰ|ҰҰҰҰҰҰҰՄՄҰՌՌҰՔՔҰ՜ҰդҰլҰմҰռҰҰҰҰҰҰҰҰҰҰҰ ҰҰҰҰ$$Ұ,Ұ4<DҰLҰTҰ\ҰdҰlҰtҰ|ҰքҰ֌Ұ֔Ұ֜Ұ֤Ұ֬ҰִҰּҰҰҰҰҰҰҰҰҰҰҰҰ ҰҰҰ$T\dlt|ׄ׌הלפ׬״׼Ұ $,4<ҰҰҰҰ (08@HҰPX`hpxTҰҰҰҰҰҰҰҰҰҰҰ $,4<DLT\dlt| $T\dlt|ҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰ $,4<ҰҰҰҰҰҰҰҰDLT\dlҰҰҰҰҰҰҰҰҰҰt|ҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰ ҰҰҰҰҰҰҰҰҰҰҰ$Ұ,Ұ4Ұ<ҰҰҰҰҰҰҰҰDLT\dlt|ҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰ $,4<ҰҰҰҰҰҰҰҰDLT\dҰҰҰҰҰҰҰҰҰҰҰlt|ҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰҰ8@HPX`hpx$0<HT`lx ,8DP@(#) Unicode@(#) UnicodeÀ4<lÀÀÀ4Ĭ4444(44T4ń44(@(#) Unicode@(#) Unicode@(#) Unicode@(#) Unicodeii(@(#) $Id: //bas/720_REL/src/flat/saprel.c#35 $ SAPhhhhhhhiiiiiiij j j<jLjdjljxjjjjijjjkkk0kHkXkpk|kkkkkl l4lDldltllllllmmm$m0mDmXm|mmmmmn n n8nDnTnhnnnnnnooo@oToxooooop p pDpXp|pppppqq$qDqPqpqqqqqri8iDiPi\ihitiiiiib ,U;F<TEJ^4UU]]]a8g@fqa,`hhAAZZl<2MhlZjLy]}Yp]j|PUn)ee`cs@s|zlPhy hyUn@Un@Un@ Un@ Un@ Un@Un@Un@o7|A A(Dp}QHUU4IRxdV(/D,8,8,8d ,8((^(t4(('#D(#P##95,## Q' `'1'/'95,'95,xULH%%@%ۗ%8%~H%$0$H$@$-$0$S$$$*0${lAqװX-l23%֯$AA X  @e 8 ;  l /0I`@&F&# & |p& |p!!r,!x!W&!@"r,"(  \8 ~wTw n"(P8@%M8P9XX2J 2JdL L ,! /]8lPa]8z=]8H]8]]]T  ,W<QKQ@[5`g ,m,t$vhsNDĔZP]Ŵ A@]Ƹ dDA@CǤ>CǤ]8OtPȬ LɄ]A 8Ux]ʠty s\14 ̄x]8Q Q QQl͸ 0΄)ZWc4@`ϐp rtL dр tt d#$xt,Ԅ$ dՀմ,mX eִ]8 ׀#@;؜ dՀ(ٌtpTXڨ^L0ۨ^^܈^DLl]$ȥhL8Ʀ|ZXT ekP  dȩ$ȩ$ ȩ$ȩ$Z`<th,,Ql  ܇ @  (  ] ,@ ,@ Wc4 E t  ~x S [ XT Yp 2 ʅ ν p  ]  `hh H ; a  rtP ɧ  U, єt ,t ( Yp  +  0<  rt t "G , Vx  U4 | & BX  @ @    48 |  ,  Yp  X  9 9   ^ 3T  Wc t ,t0 ,t ,t 8  u.8H $$tCǤ0 l,$$tCǤ0 lj#dLSd<md\ [ rtt l"y'-$'.t!&,&, &,&,t0d dՀM4$&()L@(ltd/L.h-s # T  dՀ0l  X-Y ,t ,t l5^ 9t  d dՀ5W ( 8 Z$ 4<[ p< : 6y$ S S0l8:yp@E ;t00 0=AAA,&h44Dt 2&XPPHp dՀ@t,P,P,7?1C%HC dՀP PP J@Ot-LRPT,uAH4PVRZ<XZ]^d^G^P rt( VlyFJpE"mtcTj   d \I  rt! nK!D`y!m"j"Xm"o"p6# p#w#\$dtqqq qqw $m%Dp%w%g&h&w& dՀDL'$2'~R'~( |((6)e)lZzE)Z*8*x d** +@ )+ n, (,,U- ,t-P-c-e.8.~R./DN/U- (/0\ 0t?1$1x12 2H2 d3  3pX3}g4P,*4~R55P556,e6P d6 d67T8@7 S8( S8(\18O8m989:V:x:;$tZS;;;; ;;<<>p,>$? ?h?? @ @p Z @ üA +AD A DA  B\ ΓB C  dՀ 5C D D 6Dt çD E E\ /E F Fd 6bF t  G YG 0G )H( H!|H!HI`!I!J$!ƗJ`!%J! sJ!K\!3K!@p!˜L!̉LD!L!M!$M"M"ѾN"zNT"+N"ӗN"5P"jO "Ot"OO"t"rO"P4"PT"PT"E#P"E#P"iP"iP" Q"Q"mQ"RL" V9R":S"Sd" S"FT "Td" PT" PT"PT" տT" տT"տT#U$#U# dU#*V#Z#V<#5C#V#V#޺W,#Wh#W#5P#X0#X# X# dX# 0#YT#Y# SZ(#FZ|#OZ# P[$# P[$#P[$# տT# տT#տT#@[$j\$â\p$\$߈] $]$[]$^$o^t$^$t$n_$,_d$@[$_$q`$$G`d$`$ `$a<$a$,_a$Fb($ rt%ӱb|%ۼb%)c$%c%c%c%( % ddL%6d%ce %Set%Ze%e&f&fp&%f&vg&g|&g&g& hh& h&t&Ui$'i'=j'Hj\'j' k('g'g'kl' k' fl' fl' ll',tl(l(hm(md(m(5C(Pn( Gnh( ^n( o8( @o(o(o( o(p (p<(<p(/p(q()m'q\)q)jq)Z)[rd)!r) Ss,) Ss,*st*YT*s*$t4*<td*1jt*;u*'aux*Au*]v4*]v4* evt*cnv*1w$*wd*w*x*xd+8x+)ky0+,:yd+1y+8lz+zx+z+.z+.{8+K{+ K{+K{+K{+3{+|d+j|+9}+#d}p+8@}+>~4+>~4+>~4+,:~, ~,(,z,zE),)k,,!L,=,?b, Bl,: -->;h-><h->?h->Ah- d-K -Bnd-C-C-~-C-)kp-I-g-g- g-J`-J-L-L-E-ַt-t-J_ -LT-,3-- -ٔD---CT-,D-S..Z.IX.P..Uc.,:~.t. d(. d.Q .&;H.,%.,A.,GN\.,M&/AV/<[P/1j/^/X(/Fd/ @\/]7/UuT//U_/,H/,_0K00Sw000`m0`80bt0aO0a00d70 0 0000h<04\0,j1=1'd1[*1S$1 rt1d1@1E1r$1 d(1- d1- 1- 1 - 18{1Vp1^1ZK1f1,:~1єp1qhp1[1G1Ol1l1 (2s2r2T22[2s8D2r3zE)3k3\@3~3#3 rt\331j3h~3Q|3933tu|3 d4k4zE)4- 4- 4 - 4- 4_44H4 rt4484-t4lm4@e4S4\4#4V?5\5{\5- 5b5[)l5y5 R$5qh545 D55^ 5u|P5u|P5u|P5 u|P555 5h5 5Q6L6+6Z666J6 d466t6 d 6|X6G6t6}h6v`66 6 6  6&h67)7p777Ut77 7:P88$ 888 08W|88#8 8?p88@8u|P8u|P88p838 D8,e88j|99,9hx9G9t99{U,9Kl99 (9j=d9j=d99 9 S9\99 9L|989{U :z:{P:jØ:g :Ą:t:X:::B(:+x:ư:x(:p:$Ǽ:: pX:J: S,;ɘ;L;ăd; ʼ;i';|;h;0;F̠;f;; 0;Z͐;0;l;>ΐ;lj;Pp<<<u<ɘ<Jp<|и<< `<<fL<?t< < +@=t=X==,:=X=׵Ԉ=s8= =a Ո=C=P=֤=I=LX>0>\>p>6>a @>nbٔ>,t>#@>FT >,:~>lڸ>m>8>ې>?Sh?h?F?e?;݈?z?g@?Vh?=? ?5d? ? SH? ? )?ut?u?S$?S$??@Q5@\\@ \\@ d@ @ex@@$@ $@Zl@P@(@4@ 4@C@ @|@@qd@@@ @c@T@=@A%8AAA,8AAâLA rtAhA$APAAAădAMPA{PAA SAA,tTAA,A\BB BtBB$BjBBvPB BVByhBB0Bc`B_BU<B, B BBB BCpC (C`|C'GC˚hC2CDCCCgC$CypCC8C5dC4CClC UCDD>dD>dD >dD dD 'DTDD!DD@DD DXdDD' DeDD RpD{PDD׫DcxDCD<DcDD % DrhD]D D0DyxD½D `E  EU 4E " E{U EDE& <ER E+ E ,E ED EhE(E+ lE7 E!N EDEEE' E\E0EcXE.EE5"xE2F!DF<#FFDFDF SF SF@F`@FMJF?F6adF>qF23F2~F½FyxF:rF7F:B,F dF#XF7pLF:FF>HF8oFF?lG%MG;(GGJ\GHdGZG8@G 4G8G 'G#G #GhG*G GdG8G G  GF XG5 G!GZ!lG`!GT\" G"8GG"|GF8"G@#$GK3#tG!8#GH$G$lGG$G%GFy%tGBs%GD&,G[&G S'G S'Go(G].(XHd(HTV(H,T)dH,t)Hd$)H * H.*dH^*H3*HG+ H G+ H*+HR, H R, HJ,HQ,HZ&,HT8-`H<-H].H.8H[.H d.H$H,8IF,/,Is /Ic0IQ0`IF0I0Ig31@I g31@Ig31@IeI1pIu1Ik2DIh2IB2IJ3Ilv3Ir3I:44IG4I Ij35Iw]5lI S5ItY64I .6I V97I,\Y7pIx7JP18JZJG8JD8Jz 9J90J}I9J|:Jd:HJm:Jr:J$;\Jz<J\;Jc;J{D<8JG<Jyr<J=@K~=K q>$LiK>L>L^?XL?L }2@Lr<@XL{@MmA$M{DAtMKAMj3B`M SBMC MX=CMCMdDPMlDM qE$MEtMEM;FMF@M8FhMFMFNG$N(GXN7XGNHNH\NHN&INILN½NhININ m<JNtJNJOKO KxOx~KOLOsMLpOtO=LOpMO-MpOdMO½N<Or:O%NOOO\COTO\OO[8OO3OOPHO V9POJP SQP9Q`PÚQP,kR@P\RP0SP/STPSPT4PTPTP dTPU PUhPUPUPVTPVPaW P½PWtPWP\X0PrXP1XP 1XPbYHP6YPYPZ0PRZPVZP[,P[P8\ Pż\`P8\PY]P,t]HP]P]P6^PQ[Q3^Q,7<_QG_@QU_Qɻ_Q,:~Q{U,Qs`$QŤ`hQ`Q`Qea R^RatRUaRIbR'b|RbRbRWRc R w!cRjcSjcS8d0SdXSdS BeStSetS&eSf$SfSfSng,SgS+gS׫h$SߌhS hSiPSէiSiSj SjTSjTT?jT jT jT+khTkTbl(TlxT0lT0lTjm4T zmT mTonhTnTmoT(odThoT pT d}pxTpT pTpTTcq0TqT\qT Kr(T}rtTлrTrTs<T@sTsT8tHTtxTtT V9uTu|UuUuU vhU  vhU vhU vU0wU{w\UwUxUxdUxUyV SyxVh]yV3zVu1z`VzV~zV{ V{tVT{V<|<VV |W|:|W QWqE}0Wd}W4}W7~4W ~W ~WPW,8dWWy,WzWW W lW lWdW dW#W<PW@WAWWpWzW W gxW WWTWWWlWW WW\<W \<W%WwW wWWuW$XXpX X4X|X ^XuX}PXXXXEtX!j8XdxX-MpX 9XXXX#@X |X }2@XCXLX LX@XXXXpXX2X dHX tXMX'X-XXX){XhXXlX %HX%HY5Y0vY5$Y $Y$oY5dY45Y8TY,/YYYzY<Y`Y %YlxY}PY YY/\Y /\Y YՔY3\Y2`YYlY>YY,EHY@YUYdY dY:_\Y tY0Y4b(YtY*Y2GY2o$Y.|Y'Y;xY@DY4YiPY.Y3)8YY YCY*Y0V\Y(Yc Y84Y0dY8Y 9Y dXY$BY;Y\OY9<Y9Y dY6DY6Y.Y5HYBZ rZ94ZZ$Z Z5HPZ=Z =Z:\Z :\Z.5Z@Z@B8ZC`Z;Z@RZBTZXZAh[Fd[&[>b[?D[N[J[Lq\[I%[K[ K[N@`[B[Lu[3@[M\ S\(\Gl\\] \\\`\f$\Qe\}0\l\'\I\WA\`\L \3&\3&\ 3&\3&\L\T$\>`\P\_8<\ W\Rp\XX\B/\ d\ d`\SV\@t$\:\(]l,4][]G]m]Ah]iP]j]i4]]d]H,]]j]lgt]d]]_<]]m]g\^^sq^^ u%d^S@^j^u:^4dp^rÄ^sø^XU_eT_y*_z(_ssň_jW_f_ lX_y_}C$_]lǜ__q`_z_._|^P_qɘ_|Z_u _sʐ_f_{T_e_e_ e`; `t`{]`r `4x``7@`Fΐ``yT`ϐ` `j`4`Ш`Ш`F` ~p`'` t`uD`g|`g|` g|`ot`HH`Ӭ`d}`d|@`Ԕ``:`H`ՠ`ko `Ch`jB`~IaMaTaטa~a}PaLaشaa`,a٠ajaШa alaaaiPaLaTk۔aa~#,axaB/a ܰa5dbbl\b}PbݰbTblbbF8b bߨbߨbbXbbIbXbebbb,tb6 beTb,8bbdd>d,dXdRpddte9eSe-he,e]ve,0|ee eLe7ee Tee3\ememe memerTerTee eeev}Dee%e ee e-re0e|e\e]@efjBfjBfjB`ff4f1f1fĖfq lffTfɮfhfffbHffsf0df dpfjf$f p\ffyfdTg:g2 ggg(g#gTg8LgȀgyg yg\@gQg gqTg|:g,gXgXgXgjBg™ga 8h> h5dhh~lh?hh}Phn@hbh[h%hbXh0dh^hh$DhEh|>iPiii|ii: ijiitTi ݺiFii +ihiviiLiTiАiqi i iB/i, i i ti| ijB Li$Di i i  (i i if 8i iW j4<jBjj`j8jOj |jjИ@jjj*\jjj4jjjhjkjH jdjj5dj Sj,j|>js(kpkdk,k|:k|:k,k;kk:Tkk0k0kpk k-+gkC@kd|kߏk k$k4k 4kkjB$kjBkVTkXllTll}Pl!lLlll4,lRll @lG lj l!8lۮ!l !l !l !l"`lN"ljB"ljB#Hm#pm #m$ m$ m$dm[m|:m n$m%Lm o%m&,m&m&m' mG'xm 'm(,m(|m(mu)4m)m )m*<m-*m+m+hm ?+mB/ml,m,`m|,mX,m,-4n-n-n-n.Pn.nx/$n/xn/n508ns0|n0n 0n1Hn 1nB/n1n2dn5dn2n 3,n}Pn3hnjB3ne4o54Ho E4o A54o5o5o6Po66o{7oF7To' 7o)W7o98Ho w8o8og|oS8o9(or9o9o c:Po:o d;o d;to;o|:pI<$peLp,>p%?p>?xp?pB/p~@4pd}p @lp;p,@p|:pjB@p$dA p$'Ap%6SAqBXq#BXq-yBq;Bq~@4q=2CHqCq}Pq5Cq)DLqDqDqEq4Edq w8qq-Eq Fq$Fq-FqcFq/"G,q''Gxq4Gq|HHq#!Htq'$[Hq?sIdrGIrJrjWJlr'Jr@Jr@Khr?>?>?>?> ?>(?>0?>8?>@?>H?>P?>X?>`?>h?>p?>x?>?>?>?>?>?>?>?>?>?>?>?>?>?>?>?>?????????? ??(??0??8??@??H??P??X??`??h??p??x?????????????????????????????????@?@?@?@?@ ?@(?@0?@8?@@?@H?@P?@X?@`?@h?@p?@x?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?A?A?A?A?A ?A(?A0?A8?A@?AH?AP?AX?A`?Ah?Ap?Ax?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?B?B?B?B?B ?B(?B0?B8?B@?BH?BP?BX?B`?Bh?Bp?Bx?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?C?C?C?C?C ?C(?C0?C8?C@?CH?CP?CX?C`?Ch?Cp?Cx?C?C?C?C?C?C?C?C?C?C?C?C?C?C?C?C?D?D?D?D?D ?D(?D0?D8?D@?DH?DP?DX?D`?Dh?Dp?Dx?D?D?D?D?D?D?D?D?D?D?D?D?D?D?D?D?E?E?E?E?E ?E(?E0?E8?E@?EH?EP?EX?E`?Eh?Ep?Ex?E?E?E?E?E?E?E?E?E?E?E?E?E?E?E?E?F?F?F?F?F ?F(?F0?F8?F@?FH?FP?FX?F`?Fh?Fp?Fx?F?F?F?F?F?F?F?F?F?F?F?F?F?F?F?F?G?G?G?G?G ?G(?G0?G8?G@?GH?GP?GX?G`?Gh?Gp?Gx?G?G?G?G?G?G?G?G?G?G?G?G?G?G?G?G?H?H?H?H?H ?H(?H0?H8?H@?HH?HP?HX?H`?Hh?Hp?Hx?H?H?H?H?H?H?H?H?H?H?H?H?H?H?H?H?I?I?I?I?I ?I(?I0?I8?I@?IH?IP?IX?I`?Ih?Ip?Ix?I?I?I?I?I?I?I?I?I?I?I?I?I?I?I?I?J?J?J?J?J ?J(?J0?J8?J@?JH?JP?JX?J`?Jh?Jp?Jx?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?K?K?K?K?K ?K(?K0?K8?K@?KH?KP?KX?K`?Kh?Kp?Kx?K?K?K?K?K?K?K?K?K?K?K?K?K?K?K?K?L?L?L?L?L ?L(?L0?L8?L@?LH?LP?LX?L`?Lh?Lp?Lx?L?L?L?L?L?L?L?L?L?L?L?L?L?L?L?L?M?M?M?M?M ?M(?M0?M8?M@?MH?MP?MX?M`?Mh?Mp?Mx?M?M?M?M?M?M?M?M?M?M?M?M?M?M?M?M?N?N?N?N?N ?N(?N0?N8?N@?NH?NP?NX?N`?Nh?Np?Nx?N?N?N?N?N?N?N?N?N?N?N?N?N?N?N?N?O?O?O?O?O ?O(?O0?O8?Op?Ox?O?O?O?O?O?O?O?O?O?O?O?O?O?O?O?O?P?P?P?P?P ?P(?P?P?Q@?QH?QP?QX?Q`?Qh?Qp?Qx?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?Q?R?R?R?R?R ?R(?R0?R8?R@?RH?RP?RX?R`?Rh?Rp?Rx?R?R?R?R?R?R?R?R?R?R?R?R?R?R?R?R?S?S?S?S?S ?S(?S0?S8?S@?SH?SP?SX?S`?Sh?Sp?Sx?S?S?S?S?S?S?S?S?S?S?S?S?S?S?S?S?T?T?T?T?T ?T(?T0?T8?T@?TH?TP?TX?T`?Th?Tp?Tx?T?T?T?T?T?T?U@?U?U?V0?V?V?W ?Wp?W?X ?X0?XH?XX?Xp?X?X?X?X?X?X?X?Y?Y ?Y8?YH?Y`?Yp?Y?Y?Y?Y?Y?Y?Z?Z?Z(?Z8?ZP?Z`?Zx?Z?Z?Z?Z?Z?Z?[?[?[(?[@?[P?[h?[x?[?[?[?[?[?[?\?\?\0?\@?\X?\h?\?\?\?\?\?\?\?]?] ?]0?]H?]X?]p?]?]?]?]?]?]?]?^?^ ?^8?^H?^`?^p?^?^?^?^?^?^?_?_?_(?_8?_P?_`?_x?_?_?_?_?_?_?`?`?`(?`@?`P?`h?`x?`?`?`?`?`?`?a?a?a0?a@?aX?ah?a?a?a?a?a?a?a?b?b ?b0?bH?bX?bp?b?b?b?b?b?b?b?c?c ?c8?cH?c`?cp?c?c?c?c?c?c?d?d?d(?d8?dP?d`?dx?d?d?d?d?d?d?e?e?e(?e@?eP?eh?ex?e?e?e?e?e?e?f?f?f0?f@?fX?fh?f?f?f?f?f?f?f?g?g ?g0?gH?gX?gp?g?g?g?g?g?g?g?h?h ?h8?hH?h`?hp?h?h?h?h?h?h?i?i?i(?i8?iP?i`?ix?i?i?i?i?i?i?j?j?j(?j@?jP?jh?jx?j?j?j?j?j?j?k?k?k0?k@?kX?kh?k?k?k?k?k?k?k?l?l ?l0?lH?lX?lp?l?l?l?l?l?l?l?m?m ?m8?mH?m`?mp?m?m?m?m?m?m?n?n?n(?n8?nP?n`?nx?n?n?n?n?n?n?o?o?o(?o@?oP?oh?ox?o?o?o?o?o?o?p?p?p0?p@?pX?ph?p?p?p?p?p?p?p?q?q ?q0?qH?qX?qp?q?q?q?q?q?q?q?r?r ?r8?rH?r`?rp?r?r?r?r?r?r?s?s?s(?s8?sP?s`?sx?s?s?s?s?s?s?t?t?t(?t@?tP?th?tx?t?t?t?t?t?t?u?u?u0?u@?uX?uh?u?u?u?u?u?u?u?v?v ?v0?vH?vX?vp?v?v?v?v?v?v?v?w?w ?w8?wH?w`?wp?w?w?w?w?w?w?x?x?x(?x8?xP?x`?xx?x?x?x?x?x?x?y?y?y(?y@?yP?yh?yx?y?y?y?y?y?y?z?z?z0?z@?zX?zh?z?z?z?z?z?z?z?{?{ ?{0?{H?{X?{p?{?{?{?{?{?{?{?|?| ?|8?|H?|`?|p?|?|?|?|?|?|?}?}?}(?}8?}P?}`?}x?}?}?}?}?}?}?~?~?~(?~@?~P?~h?~x?~?~?~?~?~?~???0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?ˆ?˜?°??????(?8?P?`?x?È?à?ð??????(?@?P?h?x?Đ?Ġ?ĸ??????0?@?X?h?ŀ?Ő?Ũ?Ÿ????? ?0?H?X?p?ƀ?Ƙ?ƨ?????? ?8?H?`?p?Lj?ǘ?ǰ??????(?8?P?`?x?Ȉ?Ƞ?Ȱ??????(?@?P?h?x?ɐ?ɠ?ɸ??????0?@?X?h?ʀ?ʐ?ʨ?ʸ????? ?0?H?X?p?ˀ?˘?˨?????? ?8?H?`?p?̈?̘?̰??????(?8?P?`?x?͈?͠?Ͱ??????(?@?P?h?x?ΐ?Π?θ??????0?@?X?h?π?ϐ?Ϩ?ϸ????? ?0?H?X?p?Ѐ?И?Ш?????? ?8?H?`?p?ш?ј?Ѱ??????(?8?P?`?x?҈?Ҡ?Ұ??????(?@?P?h?x?Ӑ?Ӡ?Ӹ??????0?@?X?h?Ԁ?Ԑ?Ԩ?Ը????? ?0?H?X?p?Հ?՘?ը?????? ?8?H?`?p?ֈ?֘?ְ??????(?8?P?`?x?׈?נ?װ??????(?@?P?h?x?ؐ?ؠ?ظ??????0?@?X?h?ـ?ِ?٨?ٸ????? ?0?H?X?p?ڀ?ژ?ڨ?????? ?8?H?`?p?ۈ?ۘ?۰??????(?8?P?`?x?܈?ܠ?ܰ??????(?@?P?h?x?ݐ?ݠ?ݸ??????0?@?X?h?ހ?ސ?ި?޸????? ?0?H?X?p?߀?ߘ?ߨ?????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p??????? ? ? (? 8? P? `? x? ? ? ? ? ? ? ? ? (? @? P? h? x? ? ? ? ? ? ? ? ? 0? @? X? h? ? ? ? ? ? ? ? ? ? 0? H? X? p? ? ? ? ? ? ? ? ? ? 8? H? `? p? ? ? ? ? ? ???(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h???????? ? ? 0? H? X? p? ? ? ? ? ? ? ?!?! ?!8?!H?!`?!p?!?!?!?!?!?!?"?"?"(?"8?"P?"`?"x?"?"?"?"?"?"?#?#?#(?#@?#P?#h?#x?#?#?#?#?#?#?$?$?$0?$@?$X?$h?$?$?$?$?$?$?$?%?% ?%0?%H?%X?%p?%?%?%?%?%?%?%?&?& ?&8?&H?&`?&p?&?&?&?&?&?&?'?'?'(?'8?'P?'`?'x?'?'?'?'?'?'?(?(?((?(@?(P?(h?(x?(?(?(?(?(?(?)?)?)0?)@?)X?)h?)?)?)?)?)?)?)?*?* ?*0?*H?*X?*p?*?*?*?*?*?*?*?+?+ ?+8?+H?+`?+p?+?+?+?+?+?+?,?,?,(?,8?,P?,`?,x?,?,?,?,?,?,?-?-?-(?-@?-P?-h?-x?-?-?-?-?-?-?.?.?.0?.@?.X?.h?.?.?.?.?.?.?.?/?/ ?/0?/H?/X?/p?/?/?/?/?/?/?/?0?0 ?08?0H?0`?0p?0?0?0?0?0?0?1?1?1(?18?1P?1`?1x?1?1?1?1?1?1?2?2?2(?2@?2P?2h?2x?2?2?2?2?2?2?3?3?30?3@?3X?3h?3?3?3?3?3?3?3?4?4 ?40?4H?4X?4p?4?4?4?4?4?4?4?5?5 ?58?5H?5`?5p?5?5?5?5?5?5?6?6?6(?68?6P?6`?6x?6?6?6?6?6?6?7?7?7(?7@?7P?7h?7x?7?7?7?7?7?7?8?8?80?8@?8X?8h?8?8?8?8?8?8?8?9?9 ?90?9H?9X?9p?9?9?9?9?9?9?9?:?: ?:8?:H?:`?:p?:?:?:?:?:?:?;?;?;(?;8?;P?;`?;x?;?;?;?;?;?;?<?<?<(?<@??> ?>0?>H?>X?>p?>?>?>?>?>?>?>???? ??8??H??`??p?????????????@?@?@(?@8?@P?@`?@x?@?@?@?@?@?@?A?A?A(?A@?AP?Ah?Ax?A?A?A?A?A?A?B?B?B0?B@?BX?Bh?B?B?B?B?B?B?B?C?C ?C0?CH?CX?Cp?C?C?C?C?C?C?C?D?D ?D8?DH?D`?Dp?D?D?D?D?D?D?E?E?E(?E8?EP?E`?Ex?E?E?E?E?E?E?F?F?F(?F@?FP?Fh?Fx?F?F?F?F?F?F?G?G?G0?G@?GX?Gh?G?G?G?G?G?G?G?H?H ?H0?HH?HX?Hp?H?H?H?H?H?H?H?I?I ?I8?IH?I`?Ip?I?I?I?I?I?I?J?J?J(?J8?JP?J`?Jx?J?J?J?J?J?J?K?K?K(?K@?KP?Kh?Kx?K?K?K?K?K?K?L?L?L0?L@?LX?Lh?L?L?L?L?L?L?L?M?M ?M0?MH?MX?Mp?M?M?M?M?M?M?M?N?N ?N8?NH?N`?Np?N?N?N?N?N?N?O?O?O(?O8?OP?O`?Ox?O?O?O?O?O?O?P?P?P(?P@?PP?Ph?Px?P?P?P?P?P?P?Q?Q?Q0?Q@?QX?Qh?Q?Q?Q?Q?Q?Q?Q?R?R ?R0?RH?RX?Rp?R?R?R?R?R?R?R?S?S ?S8?SH?S`?Sp?S?S?S?S?S?S?T?T?T(?T8?TP?T`?Tx?T?T?T?T?T?T?U?U?U(?U@?UP?Uh?Ux?U?U?U?U?U?U?V?V?V0?V@?VX?Vh?V?V?V?V?V?V?V?W?W ?W0?WH?WX?Wp?W?W?W?W?W?W?W?X?X ?X8?XH?X`?Xp?X?X?X?X?X?X?Y?Y?Y(?Y8?YP?Y`?Yx?Y?Y?Y?Y?Y?Y?Z?Z?Z(?Z@?ZP?Zh?Zx?Z?Z?Z?Z?Z?Z?[?[?[0?[@?[X?[h?[?[?[?[?[?[?[?\?\ ?\0?\H?\X?\p?\?\?\?\?\?\?\?]?] ?]8?]H?]`?]p?]?]?]?]?]?]?^?^?^(?^8?^P?^`?^x?^?^?^?^?^?^?_?_?_(?_@?_P?_h?_x?_?_?_?_?_?_?`?`?`0?`@?`X?`h?`?`?`?`?`?`?`?a?a ?a0?aH?aX?ap?a?a?a?a?a?a?a?b?b ?b8?bH?b`?bp?b?b?b?b?b?b?c?c?c(?c8?cP?c`?cx?c?c?c?c?c?c?d?d?d(?d@?dP?dh?dx?d?d?d?d?d?d?e?e?e0?e@?eX?eh?e?e?e?e?e?e?e?f?f ?f0?fH?fX?fp?f?f?f?f?f?f?f?g?g ?g8?gH?g`?gp?g?g?g?g?g?g?h?h?h(?h8?hP?h`?hx?h?h?h?h?h?h?i?i?i(?i@?iP?ih?ix?i?i?i?i?i?i?j?j?j0?j@?jX?jh?j?j?j?j?j?j?j?k?k ?k0?kH?kX?kp?k?k?k?k?k?k?k?l?l ?l8?lH?l`?lp?l?l?l?l?l?l?m?m?m(?m8?mP?m`?mx?m?m?m?m?m?m?n?n?n(?n@?nP?nh?nx?n?n?n?n?n?n?o?o?o0?o@?oX?oh?o?o?o?o?o?o?o?p?p ?p0?pH?pX?pp?p?p?p?p?p?p?p?q?q ?q8?qH?q`?qp?q?q?q?q?q?q?r?r?r(?r8?rP?r`?rx?r?r?r?r?r?r?s?s?s(?s@?sP?sh?sx?s?s?s?s?s?s?t?t?t0?t@?tX?th?t?t?t?t?t?t?t?u?u ?u0?uH?uX?up?u?u?u?u?u?u?u?v?v ?v8?vH?v`?vp?v?v?v?v?v?v?w?w?w(?w8?wP?w`?wx?w?w?w?w?w?w?x?x?x(?x@?xP?xh?xx?x?x?x?x?x?x?y?y?y0?y@?yX?yh?y?y?y?y?y?y?y?z?z ?z0?zH?zX?zp?z?z?z?z?z?z?z?{?{ ?{8?{H?{`?{p?{?{?{?{?{?{?|?|?|(?|8?|P?|`?|x?|?|?|?|?|?|?}?}?}(?}@?}P?}h?}x?}?}?}?}?}?}?~?~?~0?~@?~X?~h?~?~?~?~?~?~?~?? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?ˆ? ?°??????(?@?P?h?x?Ð?à?ø??????0?@?X?h?Ā?Đ?Ĩ?ĸ????? ?0?H?X?p?ŀ?Ř?Ũ?????? ?8?H?`?p?ƈ?Ƙ?ư??????(?8?P?`?x?Lj?Ǡ?ǰ??????(?@?P?h?x?Ȑ?Ƞ?ȸ??????0?@?X?h?ɀ?ɐ?ɨ?ɸ????? ?0?H?X?p?ʀ?ʘ?ʨ?????? ?8?H?`?p?ˈ?˘?˰??????(?8?P?`?x?̈?̠?̰??????(?@?P?h?x?͐?͠?͸??????0?@?X?h?΀?ΐ?Ψ?θ????? ?0?H?X?p?π?Ϙ?Ϩ?????? ?8?H?`?p?Ј?И?а??????(?8?P?`?x?ш?Ѡ?Ѱ??????(?@?P?h?x?Ґ?Ҡ?Ҹ??????0?@?X?h?Ӏ?Ӑ?Ө?Ӹ????? ?0?H?X?p?Ԁ?Ԙ?Ԩ?????? ?8?H?`?p?Ո?՘?հ??????(?8?P?`?x?ֈ?֠?ְ??????(?@?P?h?x?א?נ?׸??????0?@?X?h?؀?ؐ?ب?ظ????? ?0?H?X?p?ـ?٘?٨?????? ?8?H?`?p?ڈ?ژ?ڰ??????(?8?P?`?x?ۈ?۠?۰??????(?@?P?h?x?ܐ?ܠ?ܸ??????0?@?X?h?݀?ݐ?ݨ?ݸ????? ?0?H?X?p?ހ?ޘ?ި?????? ?8?H?`?p?߈?ߘ?߰??????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p????????? ?8?H?`?p?????????(?8?P?`?x?????????(?@?P?h?x?????????0?@?X?h????????? ?0?H?X?p?? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h????? ?0?8?H?P?`?h?x?????????????? ?(?8?@?P?X?h?p???????????????(?0?@?H?X?`?p?x??????????? ?(?0?&8?@?H?P?X?%`?h?p?x????]?)??? ??G?H??5?:???2?3?1?'? ?$(?B0?F8?-@?(H?P?X?`?h? p?x? ?"??t?c?v?r?x?w??d?\??D??K?J?N?M?P?a ?^(?_0?.8?Q@?RH?yP?*X?`?sh?p?#x?????!??4?`?S?e???V?? ?????? ?(?0?8?@?H?+P?oX?`?h?p?x????????l?f?g?h?i?j?k??????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????m?> ?6(?n0?[8?E@?H?P?X?`?h??p?x?@?|?{?z?~?}?U?T??? ??????????q ?(?80?8?;@?H?P?7X?`?<h?0p?Cx???,?? ???????????b??u??? ?(?W0?Z8?X@?H?P?X?L`?Ih?Op?x????????????????Y?/?p?9?=?A ?/usr/lib:/usr/vac/lib:/usr/vacpp/lib:/usr/lib:/liblibc.ashr_64.olibC.ashr_64.olibC.aansi_64.olibpthreads.ashr_xpg5_64.oenvironerrnoaccesschdirchmodchownlinkmkdirmsgctlmsgget readlinkrenamermdirsemctlsemgetshmctlshmgetsymlinkunameunlink gethostname_system_configuration ___memcmp64 ___bzero64 ___memmove64 ___fill64 shm_unlink_iob __mod_initmalloccallocfreereallocgetenvexitatexitstrlen freopen64fopen64open64fprintffclosestrchrabortgetuidstrtolsprintfgetpidtime vsnprintffwritetolower localeconv_filbufstrncmpfputcungetcstrtodfreadtoupper getpwnam getpwuidstrdupfgetcstrtoulstatvfsstat64fputsstrspnstrpbrk localtime_rctime_r asctime_r localtimectimeasctimemktime setlocaledlopendlsymsystem xdr_free xdr_stringgetcwdopendir readdir_r closedirreaddirmktemppopenfdopentempnamttynameputenvtmpnam getgrgidutime strerror strftime iswalpha iswcntrl iswlower iswprint iswspace iswupper iswalnumecvt mkstemp64dlcloseftokgetc_unlockedputc_unlockedremovemkfifogetpasscreat64 funlockfile flockfiledlerror gethostentgethostbynamegethostbyaddrgetservbyportgetservbynamerexec__run_final_dtors__run_initial_ctors __n_pthreads_DBLINF__crt0vopterroptindoptopt__malloc_user_defined_name __pth_init __pthread__CleanupCatchV6a __ReThrowV6#__setUncaughtExceptionFlag__3stdFb__start P i  &m$ y8   ^r ($ p<` @d,Dl  4 ` 0 `  @   0 `(`@\@< |`\H |  d  P ,` l @/T/00@12 34 567899;;==??AAAB B,B`HI de xxx{{`4`Td@hՠX؀ڼ`ܠܨߔH0`x@   @h  $`@ t       @h@@L$`h,`d (` $` $@@D`|TLLP ( ` h ""###$$$$% ' '@'D''''(((@(H() )@**@*X*++.L.//@//23335556 6H66677@7778 8(8`89 9$9@999:::<<@<<==@=D=`>>>>???@ @@CD EEEF II@IDIKL L$L`LM M$M`MtMMMMN N$N`PP@PHPQ Q@QDQ`QRRR@TTTU UUUV VVZPZZZZ[[ [@[T[[[[\\]]]@]T]^X^^^_`____```@`T`a0a`ataaabbccd`depef@fgghPhi|ijxjkllmmpmnn`op pq@qr ss@tt@u@@H4`l  h    p    $ ` d @Ht@@DD x    T    X    @$`@ DL@Td @      ,`p X@|@@d8` t $`P''2d28 P4,7+L8 hp"(x@| @dpX@ @  @   T 4` (`| 0`|@@@<`@ $`   ` h     @     l P0`d`    @""%%)))**X***++@+D+,, ,$,`---. ./ /$/`0L01@L H@ph@PD X@xH D%\%<0%&H'D-J0.2l3':(h:)8&*h80P P1H&2x<4XP4=#4=$ @H  $@0`@D$`@D`h0`d x      $ @ T   `h@ @H (` , ` h @Ht<`h@@| dp`H@0`p`p @Dx @D@ 8@Hx @H`  @@    P@D@x `d(`p@H @D@H@H@HPpd0`|@@L@H    $`h `!@D@L (`h (`@D0@ 8x8@Hp @D@@H0X @@,`l  @ t  p ,`8 @h <`l ( `  '@H "@Bz|DzF~ FB A AN*$ (& K.0 P"4( UH Z` _p F| d",J2r68:<>F |  | f j +  +  6  6  6   6 . 8 6 B H 6 n t+ ~ 6  6     " . < 6 J ` 6 j r ܙ  6   6   6 . 2 < 6 T 6 ^ dܙ |   ^ b [   &:Rd 6p 6| 6[ 6ԏ֏&d r 6  6*Vvڏz܏~ޏF  6 6 F$ҙ8 6D 6Nn  ( 68 6B` 6j  ( 68 6B` 6j 8 6H 6Rp 6z "@ 6P 6Zx 6   6&D 6N|  6 6$ .BT 6^| 6  6 6*X bv 6 6 Fҙ 6$ 62` j~ 6 6   6&D 6N^| 6 6P+`lGxW? V GD 6Njl vz 6 VL 6d 6 6  6ҙ 6$ .@ 6J^Fhҙ| 6 6  6Fҙ  6 ,  6 H 6 R fF pҙ 6   6  F ҙ 6! !!( 6!2!FF!Pҙ!d 6!v! !F!! 6!!ҙ! 6!"" "&F"*"< 6"F"`ҙ"t 6" "F"" 6""ҙ" 6# #F##$ 6#.#Hҙ#\ 6#l 6#v# 6##'## $$@ 6$ 6$ 6$ 6% O%*%@ 6%L 6%X 6%d 6%p 6%[%%[%&[&&@[&R&[&& &&[''' 6(F(P<(\}(d ș(F(()C)()< )` 6)p 6)Й))+* <**8*X @*d*'** *Й*'+ @+[+P[+h 6+t +}+ S++ ++ +G+ 6, 6, ҙ,4 6,@ 6,PЙ,`Й,p,, ,- -$ <-0 -@Й-T-h-C-- -Й-.+. <.$.@.` @.l.'.. .Й.'/ @/[/P[/h 6/t 6/Й/Й//0 004 0T <0` 0pЙ0~F000C00 1 Й118+1L <1X1t1 @11'11 2Й2'2@ @2P[2 62 62 2}2 S22 33 3(G3< 63L 63`ҙ3t 63 63Й3Й334 4$4D 4d <4p 4Й4ҙ4 64 65(?5H6 6, 6F7 7N7H7H8( 86N8NH894ߙ: :.N:BH:H: :N:H; Ù;H<F>H >H>H?( ?JH?H?H@j|@r~@|+A ~A@SB~B|B+C SCSDt }DHD }DHE EHF F*HFHG ͙GHG` GnHG יH ͙HpIHI4 xI xJ*HJl gJ gK HKH Kd KHL, qLP qLFMZMșMHM$ M4șMD EM MHM~M~N N~N.~N OHOD OjHOHP P< PHP wP wQfHQ Q RT RbHST SbHTP T^HTb~U, U:HUJ~Uz~W>FXJHXh X~~XHX Y Y Z~Z [ [ ͙[.H[` י[x י[ י[H\@ \ZH^ ^&~^*H^^~^ ^ ͙^H_2H_jHa ͙b b4 ͙b יcHcH יcHd dDəddd|əgFhBFjFkPՙkݙllplHl l lm mHn, nP nHo o o oHo~p^Hp p pNs s&Ns:Hs~Hs sNsHt tHt u HuHu bu bvRNvwbNwNw ܙxHx(Hx@יxX ܙx~HxHxיx יy"Hy,HyDיyNz יzHzHzיzHzH{י{ {H| | ͙|J||H} י}8 ͙}L ͙}nH} י} י} י}H~ י~*H~rH( H\ ͙jH |||D יv| ͙| י יH@ ™\ ™H$ +HH`  HL ip iH n< n љFrH љ ͙*F8 יD יp יH י יH יH s sH  H ͙ 4 ͙ י0 Fh י  ͙ יX י F F"P Df~r~H~ Y 1 1 1 Y Y4 1D 1 1 1p 1 1BV י יB~HD$2Z@ ,H IH J*LP PFPPbPPJP` ͙əP&P٢TۆF4 T F ݂R6V.X Z ,0 E߂Nߊ`ߺbb b>b^bdrbbb^b  "  lH™` l ™ `Jl`™`bBN b d bl  ``H   b  `>`  2b6`b  0D mp mBN™bN F, >Z\ FNBNlbl l^b  b ™b(Z` b\^d:fbhjn prtv.xVz~Fnp ] { v@ {L v v ]RZd {p v v { v?*Rz  B j     2 Z     " J r  : : > p > 2, 4 40 2 . .( 'h '\ ' ' . .XT?Fp #| ) %Z B?,  x  d j l n  8 f l  ! !P !#"0 -?$8ʙ'>ď'L''ď''(lԙ)lə)ə)ə*ə* ?+ j+ |+, +8 +D 7+ l+ ~+ + + 9, - -d - .NΏ.`.p ;/ ~/, /H I/T E/h/x S/ / / S/ ~/Ώ/'0'0 ?00 ?0H ?0 ?0 ?0 ?1 C1, z1T |1 W2 2$ 2D E2T Y2d x2 2 S2 ~2Ώ2'2Ώ2'3 ?34 3L 3l 3 ?3 3 x3 4h 4 x4 4 ?4 4 5 ?5< 5X 5 5 5 r?: ?;Ə? ?C ?I8 ?MRȏMl M N N&ʏN ͙NʏOO4 O PʏPP ͙PəQ QNʏQ ͙QəQR 'R8RP R R SD S ͙SʏTWt ͙XəXjʏXxXY.ʏ[d [vN[ʏ[י[ ͙\< י\fʏ\p\ ͙\ʏ\\ʏ] ͙]6ʏ]@]y` יc ͙d ܙdp ҙdəe46e2eəfL2ftəf2g 6g2g6g?hh*hRhzhhhiiBijj"jkbllmBmno"o op.Zp6pD pp Ep p p ppZqq q@ Eq\ qx qZq q Eq r r4 r Nr rs"Zs&s4 s` Es| s sZs t Et t8 th t ttZuu u@ Eu\ ux u uuZu v Ev v8 v v wəwwwZw wZxZx Ex, x:x>ZxP xzx~x xx xxy y yyBy~y yyyZy EyyZy z Ez< zX zfzzz ͙zzzZz { E{< {X {b{x ͙{{{Z{ { E{ | |"|j|~| | י|Z} E}Z}}( }P E}l }z} }}~ ~0~|~~~Z~ E~  E, H N *8FTbp~P.H/ Z ZZ0 EL ZZ^p | F FZ 0 EL ^l z "*.:>JN Z ^jZ  E  Bf"Bb Z @ E\ x Z  E  :ZH  E   Z 0 EL h Z  E  *Z8 p E   Z  E< X ~Z  E  Z( ` E|   Z  E, H nZ|  E   Z P El   Z  E 8 ^Zl  E  Z @ E\ x  Z  E ( NZ\  E  Z 0 EL h | Z  E  >ZL  E  Z  E< X l zZ  E  .Z< p E  Z  E, H \ jZ  E  Z, ` E|  Z Z EZ .Z@   b ?Z  E 0 JP  E   ?N` !Z Z EZ Z *Z4 JZp EZ Z  !Bd &Z  E  *0 ` E|   &.@ +nrZ| Z EZ Z  Z *ZP EbZp ~Z  +"D 0vZz  E    @ E\ n  0 5NRZ\ rZ EZ Z Z  Z0 EBZP ^Zp | 5$ :VZZd  E    E< N` l :RrvZ Z EZ Z  Z *ZP EbZp ~Z zZ~  E   P El z " Z  E, H Z  E  >Z  E ( H jZx  E  Z, ` E|  Z  E  *Z.8 ` E|  Z ZZ E Z0 FNZ`  E  Z E*VZr "$&(*2,R.r024&6B8d Z  E ( NZ\  EZ  E ( < bZp  E  Z @ EbZp  E   Z P El  Z  EZ P El   Z  E 8 ^Zl  EZ  E 8 L rZ  E  Z P ErZ  E   "Z0 ` E|  Z  E"Z0 ` E|   Z  E, H nZ|  EZ  E, H \ Z  E  Z, ` E‚Z  E   2Z@ p EÌ è Z  E2Z@ p EČ Ĩ ļ Z  E< X ~ZŌ  EZ  E< X l ƒZƠ  E  .Z< p EǒZǠ  E   BZP Ȁ EȜ ȸ Z  EBZP ɀ Eɜ ɸ  Z 0 EL h ʎZʜ  EZ 0 EL h | ˢZ˰  E  >ZL ̀ E̢Z̰  E  , RZ` ͐ Eͬ  Z 0 ERZ` ΐ Eά  ">^:~Ϟ<Ͼ>@BD>F^HzJД ТZ  E< X ~Zь  E  Z( ` E| Ҙ ҢҰ ҾZ  E< X ~Zӌ  E  Z( ` E| Ԙ Ԣ԰ ԾZ  E< X ~ZՌ  E  Z( ` E| ֘ ְ֢ ־Z  E< X ~Z׌  E  Z( ` E| ؘ آذ ؾZ  E< X ~Zٌ  E  Z( ` E| ژ ڢڰ ھZ  E< X ~Zی  E  Z( ` E| ܘ ܢܰ ܾZ  E< X ~Z݌  E  Z( ` E| ޘ ޢް ޾Z  E< X ~Zߌ  E  Z( ` E|   Z  E< X ~Z  EZ Z E2Z@ NZ` jLN ZZ^h  E  Z @ EbZfx  E  bPRTV Z( ` E|  Z  E 8 ZZh  E   Z P El  Z  E ( JZX  E   Z @ E\ x Z  E  :ZH  E   Z 0 EL h Z  E  *Z8 p E   Z  E< X ~Z  E  Z( ` E|   Z  E, H nZ|  E   Z P El   Z  E 8 ^Zl  E  Z @ E\ x  Z  E ( NZ\  E  Z 0 EL h | Z  E  >ZL  EZ Z EZ Z bfXZ\^*>Nbr`bdf&h:Jj^nlnpr0 >~Z  E  "Z&4 ` E|  Z  E .< FT b~Z  E  "Z&4 ` E|  Z  E .< FT b~Z  E  "Z&4 ` E|  Z  E .< FT b~Z  E  "Z&4 ` E|  Z  E .< FT b~Z  E  "Z&4 ` E|  Z  E .< FT b~Z  E  "Z&4 ` E|  Z  E .< FT b~Z  E  "Z&4 ` E|  Z  E   . <  F T  b ~Z   E    "Z & 4  ` E |    Z   E   . <  F T  b ~Z   E    "Z & 4  ` E |    Z   E   . <  F T  b ~Z   E   "Z&4 ` E|  Z  E .< FT b~Z  E  "Z&4 ` E|  Z  E .< FT b~Z  E  "Z&4 ` E|  Z  E .< FT b~Z  E  "Z&4 ` E|  Z  E .< FT b~Z  E  "Z&4 ` E|  Z  E .< FT b~Z  E  "Z&4 ` E|  Z  E .< FT b~Z  E  "Z&4 ` E|  Z  E .< FT b~Z  E  "Z&4 ` E|  Z  E .< FT b~Z  E  "Z&4 ` E|  Z  E .< Ftv x "z B| ^~ x   Z ! E!, !H !nZ!| ! E! ! " Z" "P E"l " " ""Z" # E# #8 #^Z#l # E# # #Z$ $@ E$\ $x $ $$Z$ $ E% %( %NZ%\ % E% % %Z% &0 E&L &h &| &&Z& & E& ' '>Z'L ' E' ' 'Z' ( E(< (X (l (z(Z( ( E( ) ).Z)< )p E) ) )Z) )Z* E*"Z*0 *>Z*P *****++"+6+F+Z+j+~+++++++, ,.,nZ,r, , E, ,, -Z--$ -P E-l -~- -Z-- - E. .., .6.D .R.nZ.r. . E. .. /Z//$ /P E/l /~/ /Z// / E0 00, 060D 0R0nZ0r0 0 E0 00 1Z11$ 1P E1l 1~1 1Z11 1 E2 22, 262D 2R2nZ2r2 2 E2 22 3Z33$ 3P E3l 3~3 3Z33 3 E4 44, 464D 4R4nZ4r4 4 E4 44 5Z55$ 5P E5l 5~5 5Z55 5 E6 66, 666D 6R6nZ6r6 6 E6 66 7Z77$ 7P E7l 7~7 7Z77 7 E8 88, 868D 8R8nZ8r8 8 E8 88 9Z99$ 9P E9l 9~9 9Z99 9 E: ::, :6:D :R:nZ:r: : E: :: ;Z;;$ ;P E;l ;~; ;Z;; ; E< <<, <6 > >B>>Z>> > E? ??, ??$@ @6&@Z@@ @ EA A( AVZAZAd A EA A AZAA B EB, B:BL BBC*CVC~CEFٙFDٙGG*G>GvZGzG G EG G HH^ZHbHl H EH H IZI EIIZI$ IP EIl I IJJZJ J.ZJP EJbZJp J~ZJ K8K KJKLKVKrKK"~KKKKL6ZL@ Lp EL L LMZM( MP EMl M MMZM N EN N8 NZZN` N EN N NN NZO OO@ EO\ Ox OZOO O EO OO PPZP$ EPnPPPZP PZQ ZQ EQ, Q:Q>ZQP QZQQQQQRR"R6RFRZRjR~RRR RSZSS SP ESl S~S SZSS S ET TT, TNZTRTd T ET TT TT TUZUU UP EUl U~U UZUU U EV VV, VNZVRVd V EV VV VV VWZWW WP EWl W~W WZWW W EX XX, XNZXRXd X EX XX XX XYZYY YP EYl Y~Y YZYY Y EZ ZZ, ZNZZRZd Z EZ ZZ ZZ Z[Z[[ [P E[l [~[ [Z[[ [ E\ \\, \NZ\R\d \ E\ \\ \\ \]Z]] ]P E]l ]~] ]Z]] ] E^Z^^( ^FZ^JZ^` E^| ^Z^^ ^^__"_^__``, `~Z` ` E` ` aZa, a` EaZa a Ea a b b2Zb@ bp Eb b bZb c Ec2Zc@ cp Ec c c cZc d Ed< dX d~Zd d EdZd e Ee< eX el eZe e Ee f f.Zf< fp EfZf f Ef g g gBZgP g Eg g gZg h EhBZhP h Eh h h hZi i0 EiL ih iZi i EiZj j0 EjL jh j| jZj j Ej k k>ZkL k EkZk k Ek l l, lRZl` l El l lZl m0 EmRZm` m Em m nnn6nvnoBop*qNq|əqZqq r Er, rH rl r Er r rəsssst"tJtrtttuu:ubuuuvVvv ^vww0wwxx$xZxxxxy cyyyzz*z2zHzbzzzzz{"{*{@{N{z{{{{{||| }B}v}}~ə:L"z""&D \   JR .6D^"2RZp~  &N&@" $`  ̙  ͙&@RЏ` Ǚ י ̙ Џ ǙTp ͙~ ̙ י?*RzBj XF< Xx X X| X XL XF| { vN י$ۙ { vN ,י@Hۙ vZ {ZZ2Z4 vBNVיۙZZ {< vN י ۙbZZZZ~Z Z*Z, ;BZnZp ;ZZ {6Z8 vZZZN\יpxۙZZZ v ?* ͙Hə ܙ {, 8 H T v   zZF Z?     , X     4 `   < h x љ љ  ͙  6F יP OnvF OF O0 י$ 8P l י  ͙@ P љ  @ |  љ D י י, rD     (      h |  0  ݙL ߙ P   4 ´ ʙ Ι љD P ü ̙  Ġ ̙ ̙ ̙< љ ͙ə0 י JT ?̂*ΊJϦ&>z>"2Z | ?     |  ə 8 ~ D  P ˙ |  ( ϙ ?* R N(LjFn"F^h י2NhF FFP hיNHlFBF~ יRNF *F f p  י "?!!P!tC!!C"""#"#,'#D'$$*$x$$$'%%,'&`-&l&z&[&'-''"',['D-'dS'xS( F)*)4 6)L 6)X 6)h 6)x 6) 6) 6) 6) 6) 6) 6* 6* 6*@ 6*| 6* 6* 6+, 6+P 6+x 6+'+'+ 6,,--*.F.\ !../"/0 6/@ 6/T 6// 6/ 60 600 60p 60 60 601"112 !4&4\ !45,'5D'5^57N7+88P !8r: !:;<<==,'=D=R=X.=== #>b>>O> ?>Z?H 8@A <AfAjBP !BBGB}CC@}C\CtCCC 'Dh<DE@ %E\ %E %E}EEEF F0 'F "FF <G( <Gh <G <G 'H@ Hp IIOI*I2IRIJ&J8 <JBJ^J~J:JJJKK, <L L. L\Ln LL LL M M. M`Nd Nr$N NO O"PJ PdP PQ Q lQ$Q QQ$R$R0 lR(R$R R'S.*SJ,SZS S 8S#S,S.T*T2ZT6 TH 8Tb,T,T,UF.U VV ֙V< ֙V V$V WW*$W ۙW X$XjFX?YY*"YR&Yz0Y2Y4Z6Zz8Z8ZF[8`6`.:`v:`|'a a6bvFc c c6c6d$ d.6dR6db6d d6dZd:d 8e6ee6fg jf6k6kJ:k`'kx'k6k6l<l>l@mtanhaopao~^pap^r rrBr ͙s$ יs0 ͙tətəuduHuvDvFvHvJxDxLxPyFPyH yRLyVPz^DznLzrPzPz zLzP{&D{6L{:P{P{ {L{P{D|L|P|zP|| |L|P}*D}BF}JH}NJ&D6L:PP LPDLPBPD NLRPDLP P  LPfDvLzPP LP.D>LBPP LP^DjFnHJFDVLZPP LPDLPfPh rLvP*DBFJHNJ"D2L6PP LP6D>RBTZVRDfLjPP DLPD.L2PP DLPjDzL~PP LPRDVXTZDLP*P, 6L:PbLfPP LPDLP"P$ .L2P^RbDnVrXvTzZ2R6DBXFVJTNZfLjPP  LPNLRPP LPLPP LPVLZPP L PNLRPP LPDLXTZ\DPBPD NDbPDPP DP&D:PP DPD2PVDPFPH RDfPDPP  DPjDPP  DPbDzPP DPP DDPJPL VDjPDPP D2PJD^PP DPzHDRVXT.ZLPP L"PLPZP\ fLjPRVXTZLN?`bdf"hJjrl^nt  T @ h @ h @, hL @` h T T  י י י י T, ~n h h h h?z?? ?TL?(???? h 4? p 4? x 4? 4? 4? 4? 4? 4? 4? 4? 4? 4? 4? 4? 4? 4? 4? 4? 4? 4?  4?  4?  4? 4? ( 4? 0 4? 8 4? @ 4? H 4? P 4? X 4? ` 4? h 4? ? (? 0? 8? @? H? P? X? `? H? P? X? `? h?????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????? ? ? ? ? ? (? 0? 8? @? H? P? X? `? h? p? x? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?!?!?!?!?! ?!(?!0?!8?!@?!H?!P?!X?!`?!h?!p?!x?!?!?!?!?!?!?!?!?!?!?!?!?!?!?!?!?"?"?"?"?" ?"(?"0?"8?"@?"H?"P?"X?"`?"h?"p?"x?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?"?#?#?#?#?# ?#(?#0?#8?#@?#H?#P?#X?#`?#h?#p?#x?#?#?#?#?#?#?#?#?#?#?#?#?#?#?#?#?$?$?$?$?$ ?$(?$0?$8?$@?$H?$P?$X?$`?$h?$p?$x?$?$?$?$?$?$?$?$?$?$?$?$?$?$?$?$?%?%?%?%?% ?%(?%0?%8?%@?%H?%P?%X?%`?%h?%p?%x?%?%?%?%?%?%?%?%?%?%?%?%?%?%?%?%?&?&?&?&?& ?&(?&0?&8?&@?&H?&P?&X?&`?&h?&p?&x?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?&?'?'?'?'?' ?'(?'0?'8?'@?'H?'P?'X?'`?'h?'p?'x?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?'?(?(?(?(?( ?((?(0?(8?(@?(H?(P?(X?(`?(h?(p?(x?(?(?(?(?(?(?(?(?(?(?(?(?(?(?(?(?)?)?)?)?) ?)(?)0?)8?)@?)H?)P?)X?)`?)h?)p?)x?)?)?)?)?)?)?)?)?)?)?)?)?)?)?)?)?*?*?*?*?* ?*(?*0?*8?*@?*H?*P?*X?*`?*h?*p?*x?*?*?*?*?*?*?*?*?*?*?*?*?*?*?*?*?+?+?+?+?+ ?+(?+0?+8?+@?+H?+P?+X?+`?+h?+p?+x?+?+?+?+?+?+?+?+?+?+?+?+?+?+?+?+?,?,?,?,?, ?,(?,0?,8?,@?,H?,P?,X?,`?,h?,p?,x?,?,?,?,?,?,?,?,?,?,?,?,?,?,?,?,?-?-?-?-?- ?-(?-0?-8?-@?-H?-P?-X?-`?-h?-p?-x?-?-?-?-?-?-?-?-?-?-?-?-?-?-?-?-?.?.?.?.?. ?.(?.0?.8?.@?.H?.P?.X?.`?.h?.p?.x?.?.?.?.?.?.?.?.?.?.?.?.?.?.?.?.?/?/?/?/?/ ?/(?/0?/8?/@?/H?/P?/X?/`?/h?/p?/x?/?/?/?/?/?/?/?/?/?/?/?/?/?/?/?/?0?0?0?0?0 ?0(?00?08?0@?0H?0P?0X?0`?0h?0p?0x?0?0?0?0?0?0?0?0?0?0?0?0?0?0?0?0?1?1?1?1?1 ?1(?10?18?1@?1H?1P?1X?1`?1h?1p?1x?1?1?1?1?1?1?1?1?1?1?1?1?1?1?1?1?2?2?2?2?2 ?2(?20?28?2@?2H?2P?2X?2`?2h?2p?2x?2?2?2?2?2?2?2?2?2?2?2?2?2?2?2?2?3?3?3?3?3 ?3(?30?38?3@?3H?3P?3X?3`?3h?3p?3x?3?3?3?3?3?3?3?3?3?3?3?3?3?3?3?3?4?4?4?4?4 ?4(?40?48?4@?4H?4P?4X?4`?4h?4p?4x?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?4?5?5?5?5?5 ?5(?50?58?5@?5H?5P?5X?5`?5h?5p?5x?5?5?5?5?5?5?5?5?5?5?5?5?5?5?5?5?6?6?6?6?6 ?6(?60?68?6@?6H?6P?6X?6`?6h?6p?6x?6?6?6?6?6?6?6?6?6?6?6?6?6?6?6?6?7?7?7?7?7 ?7(?70?78?7@?7H?7P?7X?7`?7h?7p?7x?7?7?7?7?7?7?7?7?7?7?7?7?7?7?7?7?8?8?8?8?8 ?8(?80?88?8@?8H?8P?8X?8`?8h?8p?8x?8?8?8?8?8?8?8?8?8?8?8?8?8?8?8?8?9?9?9?9?9 ?9(?90?98?9@?9H?9P?9X?9`?9h?9p?9x?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?9?:?:?:?:?: ?:(?:0?:8?:@?:H?:P?:X?:`?:h?:p?:x?:?:?:?:?:?:?:?:?:?:?:?:?:?:?:?:?;?;?;?;?; ?;(?;0?;8?;@?;H?;P?;X?;`?;h?;p?;x?;?;?;?;?;?;?;?;?;?;?;?;?;?;?;?;?<?<?<?<?< ?<(?<0?<8?<@??>?>?>?> ?>(?>0?>8?>@?>H?>P?>X?>`?>h?>p?>x?>?>?>?>?>?>?>?>?>?>?>?>?>?>?>?>?????????? ??(??0??8??@??H??P??X??`??h??p??x?????????????????????????????????@?@?@?@?@ ?@(?@0?@8?@@?@H?@P?@X?@`?@h?@p?@x?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?A?A?A?A?A ?A(?A0?A8?A@?AH?AP?AX?A`?Ah?Ap?Ax?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?A?B?B?B?B?B ?B(?B0?B8?B@?BH?BP?BX?B`?Bh?Bp?Bx?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?C?C?C?C?C ?C(?C0?C8?C@?CH?CP?CX?C`?Ch?Cp?Cx?C?C?C?C?C?C?C?C?C?C?C?C?C?C?C?C?D?D?D?D?D ?D(?D0?D8?D@?DH?DP?DX?D`?Dh?Dp?Dx?D?D?D?D?D?D?D?D?D?D?D?D?D?D?D?D?E?E?E?E?E ?E(?E0?E8?E@?EH?EP?EX?E`?Eh?Ep?Ex?E?E?E?E?E?E?E?E?E?E?E?E?E?E?E?E?F?F?F?F?F ?F(?F0?F8?F@?FH?FP?FX?F`?Fh?Fp?Fx?F?F?F?F?F?F?F?F?F?F?F?F?F?F?F?F?G?G?G?G?G ?G(?G0?G8?G@?GH?GP?GX?G`?Gh?Gp?Gx?G?G?G?G?G?G?G?G?G?G?G?G?G?G?G?G?H?H?H?H?H ?H(?H0?H8?H@?HH?HP?HX?H`?Hh?Hp?Hx?H?H?H?H?H?H?H?H?H?H?H?H?H?H?H?H?I?I?I?I?I ?I(?I0?I8?I@?IH?IP?IX?I`?Ih?Ip?Ix?I?I?I?I?I?I?I?I?I?I?I?I?I?I?I?I?J?J?J?J?J ?J(?J0?J8?J@?JH?JP?JX?J`?Jh?Jp?Jx?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?K?K?K?K?K ?K(?K0?K8?K@?KH?KP?KX?K`?Kh?Kp?Kx?K?K?K?K?K?K?K?K?K?K?K?K?K?K?K?K?L?L?L?L?L ?L(?L0?L8?L@?LH?LP?LX?L`?Lh?Lp?Lx?L?L?L?L?L?L?L?L?L?L?L?L?L?L?L?L?M?M?M?M?M ?M(?M0?M8?M@?MH?MP?MX?M`?Mh?Mp?Mx?M?M?M?M?M?M?M?M?M?M?M?M?M?M?M?M?N?N?N?N?N ?N(?N0?N8?N@?NH?NP?NX?N`?Nh?Np?Nx?N?N?N?N?N?N?N?N?N?N?N?N?N?N?N?N?O?O?O?O?O ?O(?O0?O8?Op ?Ox ?O ?O ?O ?O ?O ?O ?O ?O ?O ?O ?O ?O ?O ?O ?O ?O ?P ?P ?P ?P ?P ?P( ?P ?P ?Q@ ?QH ?QP ?QX ?Q` ?Qh ?Qp ?Qx ?Q ?Q ?Q ?Q ?Q ?Q ?Q ?Q ?Q ?Q ?Q ?Q ?Q ?Q ?Q ?R ?R ?R ?R ?R ?R( ?R0 ?R8 ?R@ ?RH ?RP ?RX ?R` ?Rh ?Rp ?Rx ?R ?R ?R ?R ?R ?R ?R ?R ?R ?R ?R ?R ?R ?R ?R ?R ?S ?S ?S ?S ?S ?S( ?S0 ?S8 ?S@ ?SH ?SP ?SX ?S` ?Sh ?Sp ?Sx ?S ?S ?S ?S ?S ?S ?S ?S ?S ?S ?S ?S ?S ?S ?S ?S ?T ?T ?T ?T ?T ?T( ?T0 ?T8 ?T@ ?TH ?TP ?TX ?T` ?Th ?Tp ?Tx ?T ?T ?T ?T ?T ?T ?U@ ?U ?U ?V0 ?V ?V ?W ?Wp ?W ?X ?X0 ?XH ?XX ?Xp ?X ?X ?X ?X ?X ?X ?X ?Y ?Y ?Y8 ?YH ?Y` ?Yp ?Y ?Y ?Y ?Y ?Y ?Y ?Z ?Z ?Z( ?Z8 ?ZP ?Z` ?Zx ?Z ?Z ?Z ?Z ?Z ?Z ?[ ?[ ?[( ?[@ ?[P ?[h ?[x ?[ ?[ ?[ ?[ ?[ ?[ ?\ ?\ ?\0 ?\@ ?\X ?\h ?\ ?\ ?\ ?\ ?\ ?\ ?\ ?] ?] ?]0 ?]H ?]X ?]p ?] ?] ?] ?] ?] ?] ?] ?^ ?^ ?^8 ?^H ?^` ?^p ?^ ?^ ?^ ?^ ?^ ?^ ?_ ?_ ?_( ?_8 ?_P ?_` ?_x ?_ ?_ ?_ ?_ ?_ ?_ ?` ?` ?`( ?`@ ?`P ?`h ?`x ?` ?` ?` ?` ?` ?` ?a ?a ?a0 ?a@ ?aX ?ah ?a ?a ?a ?a ?a ?a ?a ?b ?b ?b0 ?bH ?bX ?bp ?b ?b ?b ?b ?b ?b ?b ?c ?c ?c8 ?cH ?c` ?cp ?c ?c ?c ?c ?c ?c ?d ?d ?d( ?d8 ?dP ?d` ?dx ?d ?d ?d ?d ?d ?d ?e ?e ?e( ?e@ ?eP ?eh ?ex ?e ?e ?e ?e ?e ?e ?f ?f ?f0 ?f@ ?fX ?fh ?f ?f ?f ?f ?f ?f ?f ?g ?g ?g0 ?gH ?gX ?gp ?g ?g ?g ?g ?g ?g ?g ?h ?h ?h8 ?hH ?h` ?hp ?h ?h ?h ?h ?h ?h ?i ?i ?i( ?i8 ?iP ?i` ?ix ?i ?i ?i ?i ?i ?i ?j ?j ?j( ?j@ ?jP ?jh ?jx ?j ?j ?j ?j ?j ?j ?k ?k ?k0 ?k@ ?kX ?kh ?k ?k ?k ?k ?k ?k ?k ?l ?l ?l0 ?lH ?lX ?lp ?l ?l ?l ?l ?l ?l ?l ?m ?m ?m8 ?mH ?m` ?mp ?m ?m ?m ?m ?m ?m ?n ?n ?n( ?n8 ?nP ?n` ?nx ?n ?n ?n ?n ?n ?n ?o ?o ?o( ?o@ ?oP ?oh ?ox ?o ?o ?o ?o ?o ?o ?p ?p ?p0 ?p@ ?pX ?ph ?p ?p ?p ?p ?p ?p ?p ?q ?q ?q0 ?qH ?qX ?qp ?q ?q ?q ?q ?q ?q ?q ?r ?r ?r8 ?rH ?r` ?rp ?r ?r ?r ?r ?r ?r ?s ?s ?s( ?s8 ?sP ?s` ?sx ?s ?s ?s ?s ?s ?s ?t ?t ?t( ?t@ ?tP ?th ?tx ?t ?t ?t ?t ?t ?t ?u ?u ?u0 ?u@ ?uX ?uh ?u ?u ?u ?u ?u ?u ?u ?v ?v ?v0 ?vH ?vX ?vp ?v ?v ?v ?v ?v ?v ?v ?w ?w ?w8 ?wH ?w` ?wp ?w ?w ?w ?w ?w ?w ?x ?x ?x( ?x8 ?xP ?x` ?xx ?x ?x ?x ?x ?x ?x ?y ?y ?y( ?y@ ?yP ?yh ?yx ?y ?y ?y ?y ?y ?y ?z ?z ?z0 ?z@ ?zX ?zh ?z ?z ?z ?z ?z ?z ?z ?{ ?{ ?{0 ?{H ?{X ?{p ?{ ?{ ?{ ?{ ?{ ?{ ?{ ?| ?| ?|8 ?|H ?|` ?|p ?| ?| ?| ?| ?| ?| ?} ?} ?}( ?}8 ?}P ?}` ?}x ?} ?} ?} ?} ?} ?} ?~ ?~ ?~( ?~@ ?~P ?~h ?~x ?~ ?~ ?~ ?~ ?~ ?~ ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ?ˆ ?˜ ?° ? ? ? ? ? ?( ?8 ?P ?` ?x ?È ?à ?ð ? ? ? ? ? ?( ?@ ?P ?h ?x ?Đ ?Ġ ?ĸ ? ? ? ? ? ?0 ?@ ?X ?h ?ŀ ?Ő ?Ũ ?Ÿ ? ? ? ? ? ?0 ?H ?X ?p ?ƀ ?Ƙ ?ƨ ? ? ? ? ? ? ?8 ?H ?` ?p ?Lj ?ǘ ?ǰ ? ? ? ? ? ?( ?8 ?P ?` ?x ?Ȉ ?Ƞ ?Ȱ ? ? ? ? ? ?( ?@ ?P ?h ?x ?ɐ ?ɠ ?ɸ ? ? ? ? ? ?0 ?@ ?X ?h ?ʀ ?ʐ ?ʨ ?ʸ ? ? ? ? ? ?0 ?H ?X ?p ?ˀ ?˘ ?˨ ? ? ? ? ? ? ?8 ?H ?` ?p ?̈ ?̘ ?̰ ? ? ? ? ? ?( ?8 ?P ?` ?x ?͈ ?͠ ?Ͱ ? ? ? ? ? ?( ?@ ?P ?h ?x ?ΐ ?Π ?θ ? ? ? ? ? ?0 ?@ ?X ?h ?π ?ϐ ?Ϩ ?ϸ ? ? ? ? ? ?0 ?H ?X ?p ?Ѐ ?И ?Ш ? ? ? ? ? ? ?8 ?H ?` ?p ?ш ?ј ?Ѱ ? ? ? ? ? ?( ?8 ?P ?` ?x ?҈ ?Ҡ ?Ұ ? ? ? ? ? ?( ?@ ?P ?h ?x ?Ӑ ?Ӡ ?Ӹ ? ? ? ? ? ?0 ?@ ?X ?h ?Ԁ ?Ԑ ?Ԩ ?Ը ? ? ? ? ? ?0 ?H ?X ?p ?Հ ?՘ ?ը ? ? ? ? ? ? ?8 ?H ?` ?p ?ֈ ?֘ ?ְ ? ? ? ? ? ?( ?8 ?P ?` ?x ?׈ ?נ ?װ ? ? ? ? ? ?( ?@ ?P ?h ?x ?ؐ ?ؠ ?ظ ? ? ? ? ? ?0 ?@ ?X ?h ?ـ ?ِ ?٨ ?ٸ ? ? ? ? ? ?0 ?H ?X ?p ?ڀ ?ژ ?ڨ ? ? ? ? ? ? ?8 ?H ?` ?p ?ۈ ?ۘ ?۰ ? ? ? ? ? ?( ?8 ?P ?` ?x ?܈ ?ܠ ?ܰ ? ? ? ? ? ?( ?@ ?P ?h ?x ?ݐ ?ݠ ?ݸ ? ? ? ? ? ?0 ?@ ?X ?h ?ހ ?ސ ?ި ?޸ ? ? ? ? ? ?0 ?H ?X ?p ?߀ ?ߘ ?ߨ ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ?  ? ( ? 8 ? P ? ` ? x ? ? ? ? ? ? ? ?  ? ( ? @ ? P ? h ? x ? ? ? ? ? ? ?  ?  ? 0 ? @ ? X ? h ? ? ? ? ? ? ? ?  ? ? 0 ? H ? X ? p ? ? ? ? ? ? ? ?  ? ? 8 ? H ? ` ? p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ?  ? ? 0 ? H ? X ? p ? ? ? ? ? ? ? ?! ?! ?!8 ?!H ?!` ?!p ?! ?! ?! ?! ?! ?! ?" ?" ?"( ?"8 ?"P ?"` ?"x ?" ?" ?" ?" ?" ?" ?# ?# ?#( ?#@ ?#P ?#h ?#x ?# ?# ?# ?# ?# ?# ?$ ?$ ?$0 ?$@ ?$X ?$h ?$ ?$ ?$ ?$ ?$ ?$ ?$ ?% ?% ?%0 ?%H ?%X ?%p ?% ?% ?% ?% ?% ?% ?% ?& ?& ?&8 ?&H ?&` ?&p ?& ?& ?& ?& ?& ?& ?' ?' ?'( ?'8 ?'P ?'` ?'x ?' ?' ?' ?' ?' ?' ?( ?( ?(( ?(@ ?(P ?(h ?(x ?( ?( ?( ?( ?( ?( ?) ?) ?)0 ?)@ ?)X ?)h ?) ?) ?) ?) ?) ?) ?) ?* ?* ?*0 ?*H ?*X ?*p ?* ?* ?* ?* ?* ?* ?* ?+ ?+ ?+8 ?+H ?+` ?+p ?+ ?+ ?+ ?+ ?+ ?+ ?, ?, ?,( ?,8 ?,P ?,` ?,x ?, ?, ?, ?, ?, ?, ?- ?- ?-( ?-@ ?-P ?-h ?-x ?- ?- ?- ?- ?- ?- ?. ?. ?.0 ?.@ ?.X ?.h ?. ?. ?. ?. ?. ?. ?. ?/ ?/ ?/0 ?/H ?/X ?/p ?/ ?/ ?/ ?/ ?/ ?/ ?/ ?0 ?0 ?08 ?0H ?0` ?0p ?0 ?0 ?0 ?0 ?0 ?0 ?1 ?1 ?1( ?18 ?1P ?1` ?1x ?1 ?1 ?1 ?1 ?1 ?1 ?2 ?2 ?2( ?2@ ?2P ?2h ?2x ?2 ?2 ?2 ?2 ?2 ?2 ?3 ?3 ?30 ?3@ ?3X ?3h ?3 ?3 ?3 ?3 ?3 ?3 ?3 ?4 ?4 ?40 ?4H ?4X ?4p ?4 ?4 ?4 ?4 ?4 ?4 ?4 ?5 ?5 ?58 ?5H ?5` ?5p ?5 ?5 ?5 ?5 ?5 ?5 ?6 ?6 ?6( ?68 ?6P ?6` ?6x ?6 ?6 ?6 ?6 ?6 ?6 ?7 ?7 ?7( ?7@ ?7P ?7h ?7x ?7 ?7 ?7 ?7 ?7 ?7 ?8 ?8 ?80 ?8@ ?8X ?8h ?8 ?8 ?8 ?8 ?8 ?8 ?8 ?9 ?9 ?90 ?9H ?9X ?9p ?9 ?9 ?9 ?9 ?9 ?9 ?9 ?: ?: ?:8 ?:H ?:` ?:p ?: ?: ?: ?: ?: ?: ?; ?; ?;( ?;8 ?;P ?;` ?;x ?; ?; ?; ?; ?; ?; ?< ?< ?<( ?<@ ? ?> ?>0 ?>H ?>X ?>p ?> ?> ?> ?> ?> ?> ?> ?? ?? ??8 ??H ??` ??p ?? ?? ?? ?? ?? ?? ?@ ?@ ?@( ?@8 ?@P ?@` ?@x ?@ ?@ ?@ ?@ ?@ ?@ ?A ?A ?A( ?A@ ?AP ?Ah ?Ax ?A ?A ?A ?A ?A ?A ?B ?B ?B0 ?B@ ?BX ?Bh ?B ?B ?B ?B ?B ?B ?B ?C ?C ?C0 ?CH ?CX ?Cp ?C ?C ?C ?C ?C ?C ?C ?D ?D ?D8 ?DH ?D` ?Dp ?D ?D ?D ?D ?D ?D ?E ?E ?E( ?E8 ?EP ?E` ?Ex ?E ?E ?E ?E ?E ?E ?F ?F ?F( ?F@ ?FP ?Fh ?Fx ?F ?F ?F ?F ?F ?F ?G ?G ?G0 ?G@ ?GX ?Gh ?G ?G ?G ?G ?G ?G ?G ?H ?H ?H0 ?HH ?HX ?Hp ?H ?H ?H ?H ?H ?H ?H ?I ?I ?I8 ?IH ?I` ?Ip ?I ?I ?I ?I ?I ?I ?J ?J ?J( ?J8 ?JP ?J` ?Jx ?J ?J ?J ?J ?J ?J ?K ?K ?K( ?K@ ?KP ?Kh ?Kx ?K ?K ?K ?K ?K ?K ?L ?L ?L0 ?L@ ?LX ?Lh ?L ?L ?L ?L ?L ?L ?L ?M ?M ?M0 ?MH ?MX ?Mp ?M ?M ?M ?M ?M ?M ?M ?N ?N ?N8 ?NH ?N` ?Np ?N ?N ?N ?N ?N ?N ?O ?O ?O( ?O8 ?OP ?O` ?Ox ?O ?O ?O ?O ?O ?O ?P ?P ?P( ?P@ ?PP ?Ph ?Px ?P ?P ?P ?P ?P ?P ?Q ?Q ?Q0 ?Q@ ?QX ?Qh ?Q ?Q ?Q ?Q ?Q ?Q ?Q ?R ?R ?R0 ?RH ?RX ?Rp ?R ?R ?R ?R ?R ?R ?R ?S ?S ?S8 ?SH ?S` ?Sp ?S ?S ?S ?S ?S ?S ?T ?T ?T( ?T8 ?TP ?T` ?Tx ?T ?T ?T ?T ?T ?T ?U ?U ?U( ?U@ ?UP ?Uh ?Ux ?U ?U ?U ?U ?U ?U ?V ?V ?V0 ?V@ ?VX ?Vh ?V ?V ?V ?V ?V ?V ?V ?W ?W ?W0 ?WH ?WX ?Wp ?W ?W ?W ?W ?W ?W ?W ?X ?X ?X8 ?XH ?X` ?Xp ?X ?X ?X ?X ?X ?X ?Y ?Y ?Y( ?Y8 ?YP ?Y` ?Yx ?Y ?Y ?Y ?Y ?Y ?Y ?Z ?Z ?Z( ?Z@ ?ZP ?Zh ?Zx ?Z ?Z ?Z ?Z ?Z ?Z ?[ ?[ ?[0 ?[@ ?[X ?[h ?[ ?[ ?[ ?[ ?[ ?[ ?[ ?\ ?\ ?\0 ?\H ?\X ?\p ?\ ?\ ?\ ?\ ?\ ?\ ?\ ?] ?] ?]8 ?]H ?]` ?]p ?] ?] ?] ?] ?] ?] ?^ ?^ ?^( ?^8 ?^P ?^` ?^x ?^ ?^ ?^ ?^ ?^ ?^ ?_ ?_ ?_( ?_@ ?_P ?_h ?_x ?_ ?_ ?_ ?_ ?_ ?_ ?` ?` ?`0 ?`@ ?`X ?`h ?` ?` ?` ?` ?` ?` ?` ?a ?a ?a0 ?aH ?aX ?ap ?a ?a ?a ?a ?a ?a ?a ?b ?b ?b8 ?bH ?b` ?bp ?b ?b ?b ?b ?b ?b ?c ?c ?c( ?c8 ?cP ?c` ?cx ?c ?c ?c ?c ?c ?c ?d ?d ?d( ?d@ ?dP ?dh ?dx ?d ?d ?d ?d ?d ?d ?e ?e ?e0 ?e@ ?eX ?eh ?e ?e ?e ?e ?e ?e ?e ?f ?f ?f0 ?fH ?fX ?fp ?f ?f ?f ?f ?f ?f ?f ?g ?g ?g8 ?gH ?g` ?gp ?g ?g ?g ?g ?g ?g ?h ?h ?h( ?h8 ?hP ?h` ?hx ?h ?h ?h ?h ?h ?h ?i ?i ?i( ?i@ ?iP ?ih ?ix ?i ?i ?i ?i ?i ?i ?j ?j ?j0 ?j@ ?jX ?jh ?j ?j ?j ?j ?j ?j ?j ?k ?k ?k0 ?kH ?kX ?kp ?k ?k ?k ?k ?k ?k ?k ?l ?l ?l8 ?lH ?l` ?lp ?l ?l ?l ?l ?l ?l ?m ?m ?m( ?m8 ?mP ?m` ?mx ?m ?m ?m ?m ?m ?m ?n ?n ?n( ?n@ ?nP ?nh ?nx ?n ?n ?n ?n ?n ?n ?o ?o ?o0 ?o@ ?oX ?oh ?o ?o ?o ?o ?o ?o ?o ?p ?p ?p0 ?pH ?pX ?pp ?p ?p ?p ?p ?p ?p ?p ?q ?q ?q8 ?qH ?q` ?qp ?q ?q ?q ?q ?q ?q ?r ?r ?r( ?r8 ?rP ?r` ?rx ?r ?r ?r ?r ?r ?r ?s ?s ?s( ?s@ ?sP ?sh ?sx ?s ?s ?s ?s ?s ?s ?t ?t ?t0 ?t@ ?tX ?th ?t ?t ?t ?t ?t ?t ?t ?u ?u ?u0 ?uH ?uX ?up ?u ?u ?u ?u ?u ?u ?u ?v ?v ?v8 ?vH ?v` ?vp ?v ?v ?v ?v ?v ?v ?w ?w ?w( ?w8 ?wP ?w` ?wx ?w ?w ?w ?w ?w ?w ?x ?x ?x( ?x@ ?xP ?xh ?xx ?x ?x ?x ?x ?x ?x ?y ?y ?y0 ?y@ ?yX ?yh ?y ?y ?y ?y ?y ?y ?y ?z ?z ?z0 ?zH ?zX ?zp ?z ?z ?z ?z ?z ?z ?z ?{ ?{ ?{8 ?{H ?{` ?{p ?{ ?{ ?{ ?{ ?{ ?{ ?| ?| ?|( ?|8 ?|P ?|` ?|x ?| ?| ?| ?| ?| ?| ?} ?} ?}( ?}@ ?}P ?}h ?}x ?} ?} ?} ?} ?} ?} ?~ ?~ ?~0 ?~@ ?~X ?~h ?~ ?~ ?~ ?~ ?~ ?~ ?~ ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ?ˆ ?  ?° ? ? ? ? ? ?( ?@ ?P ?h ?x ?Ð ?à ?ø ? ? ? ? ? ?0 ?@ ?X ?h ?Ā ?Đ ?Ĩ ?ĸ ? ? ? ? ? ?0 ?H ?X ?p ?ŀ ?Ř ?Ũ ? ? ? ? ? ? ?8 ?H ?` ?p ?ƈ ?Ƙ ?ư ? ? ? ? ? ?( ?8 ?P ?` ?x ?Lj ?Ǡ ?ǰ ? ? ? ? ? ?( ?@ ?P ?h ?x ?Ȑ ?Ƞ ?ȸ ? ? ? ? ? ?0 ?@ ?X ?h ?ɀ ?ɐ ?ɨ ?ɸ ? ? ? ? ? ?0 ?H ?X ?p ?ʀ ?ʘ ?ʨ ? ? ? ? ? ? ?8 ?H ?` ?p ?ˈ ?˘ ?˰ ? ? ? ? ? ?( ?8 ?P ?` ?x ?̈ ?̠ ?̰ ? ? ? ? ? ?( ?@ ?P ?h ?x ?͐ ?͠ ?͸ ? ? ? ? ? ?0 ?@ ?X ?h ?΀ ?ΐ ?Ψ ?θ ? ? ? ? ? ?0 ?H ?X ?p ?π ?Ϙ ?Ϩ ? ? ? ? ? ? ?8 ?H ?` ?p ?Ј ?И ?а ? ? ? ? ? ?( ?8 ?P ?` ?x ?ш ?Ѡ ?Ѱ ? ? ? ? ? ?( ?@ ?P ?h ?x ?Ґ ?Ҡ ?Ҹ ? ? ? ? ? ?0 ?@ ?X ?h ?Ӏ ?Ӑ ?Ө ?Ӹ ? ? ? ? ? ?0 ?H ?X ?p ?Ԁ ?Ԙ ?Ԩ ? ? ? ? ? ? ?8 ?H ?` ?p ?Ո ?՘ ?հ ? ? ? ? ? ?( ?8 ?P ?` ?x ?ֈ ?֠ ?ְ ? ? ? ? ? ?( ?@ ?P ?h ?x ?א ?נ ?׸ ? ? ? ? ? ?0 ?@ ?X ?h ?؀ ?ؐ ?ب ?ظ ? ? ? ? ? ?0 ?H ?X ?p ?ـ ?٘ ?٨ ? ? ? ? ? ? ?8 ?H ?` ?p ?ڈ ?ژ ?ڰ ? ? ? ? ? ?( ?8 ?P ?` ?x ?ۈ ?۠ ?۰ ? ? ? ? ? ?( ?@ ?P ?h ?x ?ܐ ?ܠ ?ܸ ? ? ? ? ? ?0 ?@ ?X ?h ?݀ ?ݐ ?ݨ ?ݸ ? ? ? ? ? ?0 ?H ?X ?p ?ހ ?ޘ ?ި ? ? ? ? ? ? ?8 ?H ?` ?p ?߈ ?ߘ ?߰ ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ? ? ? ? ? ? ? ?8 ?H ?` ?p ? ? ? ? ? ? ? ? ?( ?8 ?P ?` ?x ? ? ? ? ? ? ? ? ?( ?@ ?P ?h ?x ? ? ? ? ? ? ? ? ?0 ?@ ?X ?h ? ? ? ? ? ? ? ? ? ?0 ?H ?X ?p ? ? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h?p?x????????????????????? ?(?0?8?@?H?P?X?`?h??r??? ?0 ;?8?H?P?`?h?x??????U??E??G??I?? K?(?8M?@?PO?X?hQ?p?S??r??v??t??x??z??|??(~?0?@?H?X?`?p?x??? ?? ?x??? =??? ?(?0N?8 3?@?H?P?XL?`?h?p@?x????T??g?B?i???>?l?v???f?h?d?P?? J?(?0?8\?@R?H(?P?X?`?h ?p"?x?F? ????????????&??????? ?(?0^?8?@?H?PV?X?`?h?pH?x ? ? _? ]?D? p?j??????????????? ?(?0?8?@?HX?P?X?`?h?p?x?????????????????????  ?( ?0?8?@?H?P?X?`?h?p?x ?"?$?&?(?*?,?.?0?2?4?6?8?:??@?B?D?F?H? J?(L?0N?8P?@R?HT?PV?XX?`Z?h\?p^?x`?b?d?f?h?j?l?n?p?r?t?v?x?z?|?~?????~? n?(?0?8?@?H?P?X?`?h?p?x??????????????? ? ? ? ??? ?(r?0 ?8x?@?H?Pp?X?`z?hb?p?x ? ?Z??? ? ? ? )?*? -? +? ?$??? ??? ?? "?(?0?8?@9?H;?P7?X?`?h?po?x??????????????k=k(kkFkMkkkkNk=kkkkVkk Ck(#k0@k8k@]kHkP7kXk`]kh+kpvkxDk6k%kk)kkkkk=k/kkTk1kkikakk}kkk k( k0k8k@kHkPokXMk`khkp;kx=k=kk=k/k=kkkk8kkkkk0kjksk|kkkk k(k0k8k@=kHvkPkX]k`khkpkxkkkkk,k:kwkAkJkSk\keknkHk_kpkkkkk k(k0k8k@0kHBkPJkXZk`pkhkpkxkkkkk kk1kIk\kdkskkkkkkkk k k 0k( Jk0 _k8 hk@ {kH kP kX k` kh kp kx k k (k 6k Hk Vk jk ~k k k k k k k k k k .k Bkkk k(k0k89k@=kH]kP ZkXhk`=kh kp]kxk kkk)kkkk bk mk=k {k k k k k k kokakk =k(k0=k8k@=kHkPkXpk`khkp)kxk=k~kZk6k=kk=k=kk]kk]k~k=k k]kkkkk k(k0k8k@kH]kP=kXsk`Ukhkpkxk k k k k #k=k 6k Dk Qk ak qk kk kkkkkkk =kqg g k r   kh      g ! ;@=k`)@ u   kke v      g *D@=k)@}    ~ k k0kxk `k  H ( g0) g l) g %) gA)#,5= gsapversion.cF`=k9n =kk]  gcleanipc.c`=k-9n k ` k     @ '  k'`# k =k bPkW%]k&x Z b m( {0 H P X ` h = gcontloct.c1`KZ=k9nZa [q ` ka ka c kc` e` f@ g kg` kj  j` j0 kD k@S kp=k`k3P]k$ gnlsui0.cn`j=k 9nj kBj kBk@ kBk kBl kBm  kBm kBn` kBo, kBo> kBrL kBt[ kBvh kBw{ kB|` kB} kB kB  B k ~lB kB@ kB B@+ kB : kB I kBX kBg kBv kB kB kB kB B  kB` kB  kB  kB kB` kB`- kB? kB*R kB>@d kB?r kBB kBD kBE BF BF kBI BK kBK kBP`  kBQ kB^0 kBnD kBoQ Bo@Z Bod Bpn Bq y kBx=k hk;h]k )k  (sk  0|k  8 k  @8k  HPk  Ph k  Xk  `-k  j k k k k k k (k @,k X:k  H _ p       0BJ Z(p08@HPX\` hp1xI\ds   0 J _ h {    ( 0 8 @ H (P 6X H` Vh jp ~t x         . B gnlsui1.c`5=ku9Tn5 5 6 7  7` 8 9 9" ;@. ;< <`L =f =n @ x @` B B D  D@ E@ E F F H` H I I  J  J K& K0 K8 LB LK MV Nc Nk Ou O} P Q  Q` R R@ S S@ T T@ U U  U V   X@ Y@$ Y- Z`8 ZB \N ]W ]@b ]l ]x ^ ^ _ ` a` d d e` h i` k@ k  l8 l`K la k ~)m`w m m n n o` o p@ q r@ r r t  t` u` u v@ ky0 k{`F {O ~Z c n w     `         `  `  ( `2 k ~|I @\ m   @      @  @ ! . < L  Y `g @w k@ k  k  k k@ k k@ k@7 kQ kj k@ k k k k k k# k=k @k(]k< gnlsui2.c7`Qv=k9nve v@p y@} y |` | }  k    `   @, < N =kpkN&]k@$ gnlsui3.c]`wL=k 9nL N N@ Q@ Q R U U V V W W  }@=k/kN]k+83H V gnlsui5.c ` * =k 9n > ) ` I ) S ) @ _ ) j ) u )  )  )  )@  )  )  )  )  )  )  )@!  k)!" k)!9 k)!Q k) kNq grscpsc2.c!h`!r=k9$nr! k a[r`! [s! [t ! [t! [t! [u@" [u"  [k grscpscal.c"`"3m=k9nm"I vn@"W vo"e vp"s vk\ grscpu84r.c"`" 6 Q  a     D q  grscpu86r.c"`"v=k99nv" |"  # # #+ `#< @#P  #h  =kkpn grscpuerr.c#`#=k9$n# k# kep #k   gu16_aux.c#`#ހ=k9Hnހ$  $ k߀$1 @$@ @$N $_ @$p $ $ $ @$ $ $ @$ $ % @%  %6 %N k@%n k% k`% k% kP=k k$k >Nk gu16_str.c%`%=k29n&  & &! &- &9 &B `&M &Z &g  &p &{ & @& &  & & @& & & @& &  & & Ơ'  @' ɀ'# ˀ'/ '9  'E `'S @'a Հ'k 'w @' ' ' נ' ' `' ٠' ڠ' ' ' x=kk gu16_mem.c'`(a=k9pna( pa(& pb@(1 pb(: pc(E pc@(N pc(Y pd(b pd`(l pd(u pe (~ pe( pf ( pf( pg`( p pk gu16_cty.c(`(=k<9dn( ̀(  ) ΀) ) @)* Ϡ)6 )B Ѐ)N  )Z Ҁ)f )r h=kk>(n gu16_put.c)~`)=k 9<n) @) ) )  ) )  ) @) `* * @*" *1 =k k  gu16_get.c)~`*>=k9n*S `*e @*} `* * * `* * * *  * @* * k`* k* k=kpk $ gu16_tol.c+`+*=k9n+?  +S  +^  +g  +s  +}  +   +   +  =kPk D gu16_prnt.c+`+=k9n+  ) +  )+  ) ,  ),  ),  )@,(  ),4  ) ,A  ),M  ) ,[  ) k \ gu16_scan.c,h`,=k9<n,  I,  I,  I@,  I,  I`,  I,  IPk t gu16_OutCon.c,h`,+=k 9n+-   a+-!  a,@-7  a,-Q  a/-i  a1-  aŠ=k k gu16_FldWd.c-`-;=k9n;-  y;@-  y;-  y;. k y<@. k y= .%  y=.;  y=.P  y>.e  y>@.  y>. k yÐ=k k gu16_FrmIn.c-`.=k!9n. k @.  .  / k `/  k  / k /) k /3 k /@ k /K k  /V k /d k /o  @/  /  Ơ/ k OXk n gu16_InCS.c/`/ =k9 n /   0    0" k  0G   @0f  O@k gu16_InStrm.c0`0=k9!4n0  `0  Ƞ0  `0  1#  ʠ1?  1P  @1n  ˀ1 k =kk  gu16_LenMod.c0`1D=k9!nD1  D@1  D1  F@2 k F2  F2; k G2S  G@2p  G2  G2  H2  H@2  H3  H3'  I3J   8k / gu16_FrmOut.c3e`3=k9"n3  3  3  3  !3 k  k b gu16_OutCS.c3e`4I=k9#nI40  4I4J  4J@4d  4J4 k 4K4  4K4 k 4L 4  4L`5  4L5@  4M5^  4T`5} k 4Z@5 k 4]5 k 4^@5 k 4^5  4_@6 k 4_6  4`@6F  4`6r k 4X=kF Pk $Dn gu16_OutFlg.c6`66=k9$Xn66  g6@6  g66  g67  g7@76  g77U  g77~  g8 7  g8`7  g87  g87  g9 8  g9`83  g k gu16_OutStr.c6`8F"=k9%,n"8^  "8p  #8  #`8  $8 k $8 k %9   '9+  (@9E k )9e k *9  *9  =k k gu16_OutPrc.c9`9@=k9%n@9  @@:  @:  @:3 k A@:L k B@:b  B:| k  k gu16_InCon.c9`: =k9&dn :   :   :   =kPpk  gsaprel.c:`; !=k(9&n!;  "@;+  #;?  %;R  %;\  (;i   (`;t  (;  ,@;  .;  /; k /; k 0;  1 ;  1`; k 3<  4 <  4<)  8<9  :@  g> k(>  D M> g >k( > I R> gH>&k(H>& N W> gp>.k(p>. S \> g>Ck(>C X a> g>Pk(>P ] f> g>tk(>t b k> gh>k(h> g p> gh>k(h> l u> gi@>k(i@> q z> g>k(> v > g|>k(|> { > gih>k(ih>  > gP>k(P>  > gh>k(h>  > g>k(>  > g H>k( H>  > g>k(>  > g(>k((>  > g>k(>  > gu>k(u>  > g>k(>  > g>k(>  > gY?k(Y?  > g ? k( ?   > g,?k(,?  > g?k(?  > g݀?+k(݀?+  > gh?3k(h?3  > g?;k(?;  > g ?Ak( ?A  > g?Jk(?J  > g?Rk(?R  > g?Zk(?Z  > g(?ek((?e  > g ?nk( ?n  > gs?vk(s?v  > g?k(?  > g?k(?  > g ?k( ?  > g?k(?  > g ?k( ?  > g`?k(`?  > g?k(?  $> g8?k(8?  )> gh(?k(h(? % .> g?k(? * 3> gu8?k(u8? / 8> g ?k( ? 4 => g(?k((? 9 B> g ?k( ? > G> g?k(? C L> g̀?k(̀? H Q> g @k( @ M V> gH@k(H@ R [> gu@k(u@ W `> g@k(@ \ e> g(@(k((@( a j> gp@2k(p@2 f o> g@:k(@: k t> g @Ak( @A p y> g@Jk(@J u ~> gu@Sk(u@S z > g@[k(@[  > g@bk(@b  > g,@jk(,@j  > gl@sk(l@s  > g h@k( h@  > g @@k( @@  > gl@k(l@  > g @k( @  > g @k( @  > gl@k(l@  > g @k( @  > g @k( @  > g @k( @  > ghx@k(hx@  > g@@k(@@  > g@k(@  > gi@k(i@  > gYx@k(Yx@  > gYAk(YA  > gA k(A   > gYAk(YA  > guAk(uA  > gA&k(A&  > gA-k(A-  > g 0A5k( 0A5  > g XA>k( XA>  > ghPAGk(hPAG  > g AOk( AO  > gY(AWk(Y(AW  > glAak(lAa  > gxAhk(xAh  > ghArk(hAr  #> gsA|k(sA|  (> gt Ak(t A $ -> gtHAk(tHA ) 2> gtpAk(tpA . 7> gtAk(tA 3 <> gtAk(tA 8 A> gsAk(sA = F> gtAk(tA B K> gu`Ak(u`A G P> gsAk(sA L U> gAk(A Q Z> gAk(A V _> gAk(A [ d> g pBk( pB ` i> gDBk(DB e n> gYPBk(YPB j s> gBk(B o x> gPB"k(PB" t }> g(B/k((B/ y > g B:k( B: ~ > gBCk(BC  > gxBOk(xBO  > gPB^k(PB^  > gBmk(Bm  > gB|k(B|  > gTBk(TB > gBk(B Benvironerrnoaccesschdirchmodchownlinkmkdirmsgctlmsggetreadlinkrenamermdirsemctlsemgetshmctlshmgetsymlinkunameunlinkgethostname_system_configuration___memcmp64.___memcmp64___bzero64.___bzero64___memmove64.___memmove64___fill64.___fill64shm_unlink_iob__mod_initmalloccallocfreereallocgetenvexitatexitstrlenfreopen64fopen64open64fprintffclosestrchrabortgetuidstrtolsprintfgetpidtimevsnprintffwritetolowerlocaleconv_filbufstrncmpfputcungetcstrtodfreadtouppergetpwnamgetpwuidstrdupfgetcstrtoulstatvfsstat64fputsstrspnstrpbrklocaltime_rctime_rasctime_rlocaltimectimeasctimemktimesetlocaledlopendlsymsystemxdr_freexdr_stringgetcwdopendirreaddir_rclosedirreaddirmktemppopenfdopentempnamttynameputenvtmpnamgetgrgidutimestrerrorstrftimeiswalphaiswcntrliswloweriswprintiswspaceiswupperiswalnumecvtmkstemp64dlcloseftokgetc_unlockedputc_unlockedremovemkfifogetpasscreat64funlockfileflockfiledlerrorgethostentgethostbynamegethostbyaddrgetservbyportgetservbynamerexec__run_final_dtors__run_initial_ctors__n_pthreads_DBLINF__crt0vopterroptindoptopt__malloc_user_defined_name__setUncaughtExceptionFlag__3stdFb__CleanupCatchV6a__ReThrowV6__pth_init__pthreadTOCcrt0_data_$STATIC__C_runtime_termination_cdtorsu16_trace_levelu16_trace_func_$STATIC_BSStoupperUisalnumUisalphaUiscntrlUislowerUisprintUisspaceUisupperUtolowerUlibicuucHandleisalnumU_7bitiscntrlU_7bitisalphaU_7bitislowerU_7bitisprintU_7bitisspaceU_7bitisupperU_7bittoupperU_7bittolowerU_7bitu_versionToString_FPTRu_errorName_FPTRu_getVersion_FPTRu_getUnicodeVersion_FPTRu_charType_FPTRu_getIntPropertyValue_FPTRu_charDirection_FPTRu_getPropertyEnum_FPTRu_getPropertyValueName_FPTRuenum_unext_FPTRuenum_count_FPTRu_strToUpper_FPTRIcuUtilubidi_open_FPTRubidi_setInverse_FPTRubidi_setPara_FPTRubidi_writeReordered_FPTRubidi_getLogicalMap_FPTRubidi_getVisualMap_FPTRubidi_getLevelAt_FPTRu_charMirror_FPTRIcuBiDiIcuShapingu_shapeArabic_FPTRunorm_normalize_FPTRunorm_isNormalized_FPTRunorm_compare_FPTRIcuNormubrk_open_FPTRubrk_openRules_FPTRubrk_safeClone_FPTRubrk_close_FPTRubrk_next_FPTRubrk_previous_FPTRubrk_first_FPTRubrk_last_FPTRubrk_following_FPTRubrk_getAvailable_FPTRubrk_countAvailable_FPTRubrk_getLocaleByType_FPTRuloc_getDefault_FPTRIcuBreakuidna_toASCII_FPTRuidna_toUnicode_FPTRuidna_IDNToASCII_FPTRuidna_IDNToUnicode_FPTRuidna_compare_FPTRIcuIDNAucal_getAvailable_FPTRucal_countAvailable_FPTRucal_open_FPTRucal_close_FPTRucal_set_FPTRucal_setDate_FPTRucal_get_FPTRucal_getMillis_FPTRucal_setMillis_FPTRIcuCollationIcuTransucol_open_FPTRucol_strcoll_FPTRucol_close_FPTRucol_setStrength_FPTRucol_getSortKey_FPTRucol_getLocaleByType_FPTRutrans_openU_FPTRutrans_close_FPTRutrans_openIDs_FPTRutrans_transUChars_FPTRShmidDsMsgBaseKeyOldMsgBaseKeyShmBaseKeyShmOffsetSemBaseKeySapJvmSemBaseKeyOldEvtBaseKeyEvtBaseKeyScsaBaseKeyoptargUkMaximumUCS4rscpReplacementCharacterfirstByteMarkrscpHook_rscpe__errorrscph_rscpe__errorbytesFromUTF8kMaximumUCS2offsetsFromUTF8minValForLengthkMaximumUTF16bytesFromUTF8NoCCcrt0_64.s.__startp_xargcp_xargvp_xrcfgp_xrc_malloc_user_defined_name.file../../../../../../../src/bos/usr/ccs/lib/libc/__threads_init.cTue Feb 12 10:03:12 2008 IBM XL C Enterprise Edition for AIX, Version 9.0.0.0 --- .__threads_init.__threads_init@AF2_1_bsd_init_routine_xti_tli_init_routine_nsl_init_routine__dce_compat_init_routine../../../../../../../src/bos/usr/ccs/lib/libc/POWER/crti.CTue Feb 12 10:03:08 2008 IBM XL C/C++ Enterprise Edition for AIX, Version 9.0.0.0.__User_sinit_begin.__C_runtime_termination.__C_runtime_startup.__4.__3__C_runtime_pstartupstrcat.s.strcatstrcmp.s.strcmpstrncpy.s.strncpymoveeq.s.bcopy.ovbcopy._moveeq.memcpy.memmoveSun Dec 18 20:05:23 2011 IBM XL C for AIX, Version 11.1.0.7$tpo462b001sapversion.cfdpr.GetSAPFileVersionSat Dec 17 12:05:34 2011 $tpo182c001cleanipc.c.statU16.SystemHeader.IpcShm.main.nlsui_main.FillProfArray.RemoveESFileFri Dec 16 21:25:54 2011 $tpo7fd4001contloct.c.localtime_cont.IsDoubleInterval_GetInterval.getPPContTime.N_localtime.localtime_cont_r.R_localtime.mktime_cont.ctime_cont.ctime_cont_r.IsDst.GetDoubleInterval.IsDoubleInterval.abSet_contloctime.abTest_contloctime.ContLoct_Init.abSet_contloctime@AF16_13Sun Dec 18 20:05:04 2011 $tpo373f001nlsui0.c.isalnumU_wrapper.isalphaU_wrapper.iscntrlU_wrapper.islowerU_wrapper.isprintU_wrapper.isspaceU_wrapper.isupperU_wrapper.tolowerU_wrapper.toupperU_wrapper.nlsui_dlopen.nlsui_dlclose.nlsui_dlsym.nlsui_safe_strcat.nlsui_setPath.nlsui_resetPath.nlsui_initLoadIcuTrace.nlsui_initUfuncTrace.nlsui_addIcuSearchPath.icu7bitFallbackOrExit.setCtype7bit.mapCtypeFunctions.useFallBackCtype.isalnumU_7bit.isalphaU_7bit.iscntrlU_7bit.islowerU_7bit.isprintU_7bit.isspaceU_7bit.isupperU_7bit.tolowerU_7bit.toupperU_7bit.useICUCtype.getIcuLibList.openLibIcuUc.mapIcuUtilFunctions.mapUbidiFunctions.mapUshapingFunctions.mapUnormFunctions.mapUbrkFunctions.mapUidnaFunctions.mapUcalFunctions.checkIcuData.nlsui_traceIcuVersion.initIcuUc.nlsui_cpy_cmdline_par.nlsui_store_cmdline.nlsui_initialize.loadIcuDo.nlsui_set7bitUnicode.unsetIcu.openLibIcuI18n.closeLibIcuI18n.mapUcolFunctions.mapUtransFunctions.initIcuI18n.loadIcu.isgraphU.ispunctU.isxdigitU.nlsui_safe_strcat@AF60_13Fri Dec 16 21:26:07 2011 $tpo511f001nlsui1.c.fdopenU.fdopenU16.nlsui_U2sToUtf8s_checked.fopen64U.fopen64U16.nlsui_traceFopen.freopenU.freopenU16.gethostnameU.gethostnameU16.nlsui_Utf8sToU2s_checked.rexecU.rexecU16.dirnameU.dirnameU16.basenameU.basenameU16.linkU.linkU16.symlinkU.symlinkU16.readlinkU.readlinkU16.nlsui_malloc_error.chownU.chownU16.mkfifoU.mkfifoU16.utimeU.utimeU16.creatU.creatU16.perrorU.perrorU16.strerrorU16.popenU.popenU16.rmdirU.rmdirU16.statvfsU16.unlinkU.unlinkU16.asctime_rU.asctime_rU16.ctime_rU.ctime_rU16.asctimeU.asctimeU16.ctimeU.ctimeU16.strerrorU.Utf8sToU2s.setlocaleU16.tmpnamU.tmpnamU16.tempnamU.tempnamU16.mktempU.mktempU16.mkstempU.mkstempU16.ttynameU.ttynameU16.ConvertSCCSID_w.nlsui_wcsar2mbsar.U2sToUtf8s.nlsui_alloc_mbsar.wcstowcs.UcnToFileLenR.Utf8snToU2n.U2nToUtf8.U2snToUtf8n.nlsui_set_trace.nlsui_internalErrorMsg.nlsui_array_short.nlsui_utf8conv_error.cast_raw2ucChkFailed.nlsui_cast_raw2uc.dlopenU.dlopenU16.dlsymU.dlsymU16.dlerrorU.dlerrorU16.vopenU16.openU.openU16.fopenU.fopenU16.renameU.renameU16.removeU.removeU16.cleanup_putenv_table.cleanup_getenv_table.getenvU.getenvU16.putenvU.putenvU16.systemU.systemU16.strcasecmpU.strcasecmpU16.strncasecmpU.strncasecmpU16.strftimeU.strftimeU16.accessU.accessU16.chdirU.chdirU16.getcwdU.getcwdU16.chmodU.chmodU16.mkdirU.mkdirU16.nlsui_alloc_wcsarBase.nlsui_alloc_wcsar.nlsui_alloc_env.nlsui_getenvironU.nlsui_freeenvironU.strtoupperU16.strntoupperU16.strcpytoupperU16.strtolowerU16.strntolowerU16.strcpytolowerU16.ecvtU.ecvtU16.strcasecmpR.strncasecmpR.strtoupperR.strntoupperR.strcpytoupperR.strtolowerR.strntolowerR.strcpytolowerR.strntolowerR@AF139_137.strtolowerR@AF140_136.strntoupperR@AF141_134.strtoupperR@AF142_133.strncasecmpR@AF143_132.strcasecmpR@AF144_131.strntolowerU16@AF145_127.strtolowerU16@AF146_126.strntoupperU16@AF147_124.strtoupperU16@AF148_123.nlsui_freeenvironU@AF149_122.nlsui_alloc_env@AF150_120.strncasecmpU16@AF151_105.strcasecmpU16@AF152_103.nlsui_cast_raw2uc@AF153_78.nlsui_wcsar2mbsar@AF154_65.mkstempU16@AF155_61.mktempU16@AF156_59Fri Dec 16 21:26:11 2011 $tpod87f001nlsui2.c.getpwnamU.getpwnamU16.getpwuidU.getpwuidU16.gethostbyaddrU.gethostbyaddrU16.convertToHostentU16.gethostbynameU.gethostbynameU16.gethostentU.gethostentU16.getservbynameU.getservbynameU16.getservbyportU.getservbyportU16.xdr_stringU16Fri Dec 16 21:26:12 2011 $tpo8e83001nlsui3.c.unameU.getgrgidU.getgrgidU16.getpassU.getpassU16.getoptU.opendirU.opendirU16.readdirU.readdirU16.readdir_rU.readdir_rU16Fri Dec 16 21:26:13 2011 $tpo5936001nlsui5.c.vsprintfU.sprintfU.vsnprintfU.snprintfU.vfprintfU.vprintfU.printfU.fprintfU.sprintf_sU16.vsprintf_sU16.snprintf_sU16.vsnprintf_sU16.sprintf_sRFB.vsprintf_sRFB.snprintf_sRFB.vsnprintf_sRFB.vsnprintf_sRFB@AF17_16.vsprintf_sRFB@AF18_14.vsnprintf_sU16@AF19_12.vsprintf_sU16@AF20_10Fri Dec 16 21:25:27 2011 $tpo4d8f001rscpsc2.c.rscpsc2_c__no_more_malloc__abort.rscpuc_next_buff.UcsToU2s.UcnToU2n.NeutralUcnToUcn.UcnToNeutralUcn.UcnToUcmbn.UcmbnToUcnFri Dec 16 21:25:30 2011 $tpo3515001rscpscal.c.A7sToUcsVola.A7nToUcnVola.UcsToA7sVola.UcnToA7nVolaFri Dec 16 21:25:35 2011 $tpodd23001rscpu84r.cFri Dec 16 21:25:37 2011 $tpo322a001rscpu86r.c.Utf16nToUtf8n.Utf16nToUtf8nNoCC.Utf16nToUtf8nGD.Utf16nToUtf8nSubstAll.Utf8nToUtf16nGD.Utf8nToUtf16nSubst.Utf8nToUtf16nNoCCSubst.Utf8nToUtf16nSubstAllFri Dec 16 21:25:40 2011 $tpo21f7001rscpuerr.c.rscph_rscpe__error.rscpSetHook_rscpe__errorFri Dec 16 21:04:20 2011 $tpoa9dc001u16_aux.c.ascii7bitToU16.u16_trace_to_stderr.u16_set_trace.u16_traceMsg.u16_set_cmdline.u16_endTraceMsg.u16_internalErrorMsg.u16_traceFopen.u16_rawDump.u16_rawStrDump.u16_charDump.u16_rawAndCharDump.u16_rawFileDumpOpt.u16_utf8conv_error.u16_malloc_error.u16_array_short.u16_unknownFormatStr.dbgAlignCheckStringU16.dbgAlignCheckStringU16@AF19_18.u16_unknownFormatStr@AF20_17.u16_array_short@AF21_16.u16_utf8conv_error@AF22_14.u16_internalErrorMsg@AF23_7Fri Dec 16 21:04:21 2011 $tpo6fe2001u16_str.c.strlenU.strlenU16.strnlenU16.strnlenRFB.strcatU.strcatU16.strcat_sU16.strcat_sRFB.strchrU.strchrU16.strcmpU.strcmpU16.strcpyU.strcpyU16.strcpy_sU16.strcpy_sRFB.strcspnU.strcspnU16.strdupU.strdupU16.strncatU.strncatU16.strncat_sU16.strncat_sRFB.strncmpU.strncmpU16.strncpyU.strncpyU16.strncpy_sU16.strncpy_sRFB.strpbrkU.strpbrkU16.strrchrU.strrchrU16.strspnU.strspnU16.strstrU.strstrU16.strtokU.strtokU16.strtok_rU.strtok_rU16.strtok_rRFBFri Dec 16 21:04:23 2011 $tpo46ff001u16_mem.c.memcmpU.memcmpU16.memchrU.memchrU16.memsetU.memsetU16.mallocU.reallocU.callocU.memcpyU.memmoveU.memcpy_sRFB.memcpy_sU16.memmove_sRFB.memmove_sU16Fri Dec 16 21:04:24 2011 $tpofd7b001u16_cty.c.isxdigitU16.isspaceU16.isalnumU16.isalphaU16.islowerU16.isprintU16.isupperU16.isgraphU16.ispunctU16.iscntrlU16.tolowerU16.toupperU16Fri Dec 16 21:04:26 2011 $tpo5e37001u16_put.c.putc_unlockedU16.fputcU.fputcU16.fputsU.fputsU16.fwrite_unlockedU16.putsU.putsU16.fwriteU16_impl.fwriteU16.u16_fwriteU16.u16_fwriteU$tpo9c8f001u16_get.c.getc_unlockedU16.getc_unlockedU16_errno.fgetcU.fgetcU16.fgetsU.fgetsU16.getsU.getsU16.gets_sU16.gets_sRFB.freadU.freadU16.freadU16@AF13_12.gets_sRFB@AF14_10.gets_sU16@AF15_9Fri Dec 16 21:04:28 2011 $tpo9fd6001u16_tol.c.tol_dummy_function.strtolU16.strtolU.strtoulU16.strtoulU.strtollU16.strtollU.strtoullU16.strtoullUFri Dec 16 21:04:29 2011 $tpo52ba001u16_prnt.c.checkArgs.vvfprintfU16.vvfprintf_sU16.vfprintfU16.vprintfU16.printfU16.fprintfU16.vsprintfU16.sprintfU16.vsnprintfU16.snprintfU16Fri Dec 16 21:04:30 2011 $tpo3fdf001u16_scan.c.u16_enlar_nuspace.vvfscanf_sU16.vvfscanfU16.scanfU16.fscanfU16.sscanfU16.vsscanfU16$tpo6f82001u16_OutCon.c.OutputConversionCtor.OutputConversionXtor.OutputConversion_setArgs.OutputConversion_parse.OutputConversion_toString.OutputConversion_outputFri Dec 16 21:04:31 2011 $tpo3864001u16_FldWd.c.FieldWidthCtor.FieldWidthXtor.FieldWidth_parse.FieldWidth_isDigit.FieldWidth_atoi.FieldWidth_isDefined.FieldWidth_getValue.FieldWidth_isStatic.FieldWidth_setArgumentPosition.FieldWidth_setArgumentValue.FieldWidth_parse@AF11_3$tpo14e7001u16_FrmIn.c.skipWhiteSpace.testForNANandINF.testForNIL.reallocbuf.copytobuffer.getLengthType.getCount.getFloating.getNumber.isBetween.getCharClass.getString.FormattedInputCtor.FormattedInputXtor.FormattedInput_input.reallocbuf@AF16_4Fri Dec 16 21:04:32 2011 $tpo291a001u16_InCS.c.InputConversionSpecCtor.InputConversionSpecXtor.InputConversionSpec_isValidSymbol__.InputConversionSpec_setSymbol.InputConversionSpec_getSymbolFri Dec 16 21:04:33 2011 $tpo3459001u16_InStrm.c.InputStreamCtor.InputStreamXtor.InputStream_readSingleCharFromFile.InputStream_readSingleCharFromString.InputStream_readSingleChar.InputStream_EOF.InputStream_unreadSingleChar.InputStream_successfullyRead.InputStream_unreadSingleChar@AF9_7$tpo3ac8001u16_LenMod.c.LengthModifierCtor.LengthModifierXtor.LengthModifier_parse.LengthModifier_setValue.LengthModifier_isCharValue.LengthModifier_isValue.LengthModifier_isShortValue.LengthModifier_isLongValue.LengthModifier_isLongLongValue.LengthModifier_isIntMaxValue.LengthModifier_isSizeValue.LengthModifier_isPrtDiffValue.LengthModifier_isLongDoubleValue.LengthModifier_isLongLongI64Value.LengthModifier_isLongLongFri Dec 16 21:04:34 2011 $tpo4457001u16_FrmOut.c.FormattedOutputCtor.FormattedOutputXtor.OutputStream_writeNullTermination.FormattedOutput_parse.FormattedOutput_findNextSpec$tpobea7001u16_OutCS.c.OutputConversionSpecCtor.OutputConversionSpecXtor.OutputConversionSpec_setSymbol.OutputConversionSpec_isValidSymbol__.OutputConversionSpec_getSymbol.OutputConversionSpec_switchOnNegativeSign__.OutputConversionSpec_isNegative.OutputConversionSpec_getConvertedValue.OutputConversionSpec_isValid.OutputConversionSpec_toString.OutputConversionSpec_itoa__.OutputConversionSpec_dtoa__.u16_strnlenU16.OutputConversionSpec_ptoa__.OutputConversionSpec_isNumber.convertAsciiToWideChar.OutputConversionSpec_getWriteCountPointer.OutputConversionSpec_getConvertedValueSize.OutputConversionSpecXtor@AF19_2Fri Dec 16 21:04:35 2011 $tpo3828001u16_OutFlg.c.OutputFlagsCtor.OutputFlagsXtor.OutputFlags_switchOnLeftJustifiedFlag.OutputFlags_switchOnSignConversionFlag.OutputFlags_switchOnSpaceFlag.OutputFlags_switchOnAlternativeFormFlag.OutputFlags_switchOnZeroFlag.OutputFlags_isLeftJustifiedFlag.OutputFlags_isSignConversionFlag.OutputFlags_isSpaceFlag.OutputFlags_isAlternativeFormFlag.OutputFlags_isZeroFlag.OutputFlags_parse$tpo51e7001u16_OutStr.c.OutputStreamCtor.OutputStreamXtor.OutputStream_isFileOutputStream.OutputStream_writeSingleChar.OutputStream_writeSingleCharToFile.OutputStream_writeSingleCharToString.OutputStream_writeMultipleChar.OutputStream_writeString.OutputStream_writeStringToFile.OutputStream_writeStringToString.OutputStream_getMaxLength.OutputStream_getWrittenCharsFri Dec 16 21:04:36 2011 $tpo3218001u16_OutPrc.c.OutputPrecisionCtor.OutputPrecisionXtor.OutputPrecision_parse.OutputPrecision_isDigit.OutputPrecision_atoi.OutputPrecision_getValue.OutputPrecision_parse@AF7_3$tpo34eb001u16_InCon.c.InputConversionCtor.InputConversionXtor.InputConversion_parseFri Dec 16 21:04:15 2011 $tpo6689001saprel.c.RelCompare.IsVersionRequested.IsLoadDbRequested.RelPrint.RelPrintNew.RelPrint2.RelPrintNewNoExit.RelPrint2NoExit.RelInfo2.GetExecutableName.PrintPatchLevel.PrintPatchInfo.RelSrcProtect.RelForCustomers.GetPatchTextsAndNumber.RelInfo.get_sapreleaseno.saprelease2int.RunningCompatibly.GetPatchLevel.PatchIsRelevant.GetPatchLevel2.GetInternalKernelVersion.GetPatchTexts.convert_patch_info.GetExecutableVersionCommand.NotifyPatchHistoryFri Dec 16 21:04:17 2011 $tpo2c78001saprel0.c.db_describe.DbSlControl.db_dsql2.db_rtab0Wed Jul 27 10:22:09 2011 IBM XL C/C++ for AIX, Version 10.1.0.6../../../../../../../../src/bos/usr/ccs/lib/libpthreads/init.cWed Aug 22 15:27:45 2007 .call_pth_init__pth_init_routineglink64.s.exit.__run_final_dtors.atexit.__run_initial_ctors.__ReThrowV6.__setUncaughtExceptionFlag__3stdFb.__CleanupCatchV6a.access.chdir.chmod.chown.link.mkdir.msgctl.msgget.readlink.rename.rmdir.semctl.semget.shmctl.shmget.symlink.uname.unlink.gethostname.shm_unlink.malloc.calloc.free.realloc.getenv.strlen.freopen64.fopen64.open64.fprintf.fclose.strchr.abort.getuid.strtol.sprintf.getpid.time.vsnprintf.fwrite.tolower.localeconv._filbuf.strncmp.fputc.ungetc.strtod.fread.toupper.getpwnam.getpwuid.strdup.fgetc.strtoul.statvfs.stat64.fputs.strspn.strpbrk.localtime_r.ctime_r.asctime_r.localtime.ctime.asctime.mktime.setlocale.dlopen.dlsym.system.xdr_free.xdr_string.getcwd.opendir.readdir_r.closedir.readdir.mktemp.popen.fdopen.tempnam.ttyname.putenv.tmpnam.getgrgid.utime.strerror.strftime.iswalpha.iswcntrl.iswlower.iswprint.iswspace.iswupper.iswalnum.ecvt.mkstemp64.dlclose.ftok.getc_unlocked.putc_unlocked.remove.mkfifo.getpass.creat64.funlockfile.flockfile.dlerror.gethostent.gethostbyname.gethostbyaddr.getservbyport.getservbyname.rexec.__pth_init